Query         psy17057
Match_columns 80
No_of_seqs    103 out of 703
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 20:46:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17057.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17057hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00014 myosin-A; Provisional  99.9 1.2E-26 2.6E-31  189.9   7.3   74    1-80    188-263 (821)
  2 cd01377 MYSc_type_II Myosin mo  99.9 2.5E-26 5.3E-31  185.2   7.4   80    1-80     96-179 (693)
  3 cd01380 MYSc_type_V Myosin mot  99.9 5.6E-26 1.2E-30  183.0   7.4   78    1-80     91-170 (691)
  4 cd01385 MYSc_type_IX Myosin mo  99.9 7.6E-26 1.6E-30  182.4   7.1   75    1-80     99-175 (692)
  5 cd01381 MYSc_type_VII Myosin m  99.9   8E-26 1.7E-30  181.8   6.4   72    1-80     91-164 (671)
  6 COG5022 Myosin heavy chain [Cy  99.9 1.2E-25 2.6E-30  190.0   6.7   76    1-80    157-234 (1463)
  7 cd01383 MYSc_type_VIII Myosin   99.9 2.5E-25 5.4E-30  179.2   6.6   71    1-80     97-169 (677)
  8 cd01379 MYSc_type_III Myosin m  99.9 3.2E-25 6.9E-30  178.0   7.1   73    1-80     91-165 (653)
  9 cd01382 MYSc_type_VI Myosin mo  99.9 4.7E-25   1E-29  178.4   7.2   72    1-80     96-169 (717)
 10 cd01384 MYSc_type_XI Myosin mo  99.9 4.7E-25   1E-29  177.5   7.1   76    1-80     93-170 (674)
 11 cd01386 MYSc_type_XVIII Myosin  99.9 7.6E-25 1.7E-29  178.3   6.9   74    1-80     91-166 (767)
 12 cd00124 MYSc Myosin motor doma  99.9 1.1E-24 2.4E-29  174.8   7.1   73    1-80     91-165 (679)
 13 cd01378 MYSc_type_I Myosin mot  99.9 1.1E-24 2.4E-29  175.2   6.7   75    1-80     91-167 (674)
 14 smart00242 MYSc Myosin. Large   99.9 2.1E-24 4.4E-29  173.5   7.0   75    1-80     97-173 (677)
 15 cd01387 MYSc_type_XV Myosin mo  99.9 3.8E-24 8.3E-29  172.2   6.5   72    1-80     92-165 (677)
 16 PF00063 Myosin_head:  Myosin h  99.9 9.1E-24   2E-28  168.5   5.6   77    1-80     90-168 (689)
 17 KOG0163|consensus               99.9 2.5E-23 5.4E-28  170.0   5.4   72    1-80    149-222 (1259)
 18 KOG0164|consensus               99.9 3.4E-23 7.4E-28  168.1   5.5   77    1-80     99-177 (1001)
 19 KOG0161|consensus               99.8 1.9E-21 4.1E-26  168.6   6.2   79    1-80    173-253 (1930)
 20 KOG0162|consensus               99.8 3.1E-21 6.7E-26  157.3   6.0   74    1-79    109-184 (1106)
 21 KOG0160|consensus               99.8   2E-20 4.3E-25  153.9   1.6   74    1-80     99-174 (862)
 22 KOG4229|consensus               99.6 1.1E-15 2.4E-20  128.2   4.2   73    1-80    153-227 (1062)
 23 cd01363 Motor_domain Myosin an  97.1 0.00022 4.7E-09   49.1   1.0   30   46-75     64-94  (186)
 24 PF07724 AAA_2:  AAA domain (Cd  94.8   0.019 4.2E-07   39.4   2.0   21    1-21      8-28  (171)
 25 PF13207 AAA_17:  AAA domain; P  94.3   0.027 5.8E-07   35.0   1.6   20    1-20      4-23  (121)
 26 COG0444 DppD ABC-type dipeptid  94.0   0.024 5.3E-07   43.2   1.1   21    1-21     36-56  (316)
 27 PF12846 AAA_10:  AAA-like doma  93.9   0.046   1E-06   38.2   2.4   26    1-26      6-31  (304)
 28 cd02025 PanK Pantothenate kina  93.6   0.055 1.2E-06   38.3   2.3   21    1-21      4-24  (220)
 29 PF00485 PRK:  Phosphoribulokin  93.4   0.046   1E-06   37.4   1.6   22    1-22      4-25  (194)
 30 cd01131 PilT Pilus retraction   93.2   0.061 1.3E-06   37.2   1.9   22    1-22      6-27  (198)
 31 PRK05480 uridine/cytidine kina  93.1   0.065 1.4E-06   36.8   1.9   20    1-20     11-30  (209)
 32 PTZ00301 uridine kinase; Provi  92.9   0.076 1.7E-06   37.7   2.1   20    1-20      8-27  (210)
 33 cd02023 UMPK Uridine monophosp  92.7   0.077 1.7E-06   36.1   1.9   20    1-20      4-23  (198)
 34 TIGR02322 phosphon_PhnN phosph  92.6   0.077 1.7E-06   35.4   1.7   20    1-20      6-25  (179)
 35 PF13238 AAA_18:  AAA domain; P  92.5   0.079 1.7E-06   32.6   1.6   20    1-20      3-22  (129)
 36 cd02020 CMPK Cytidine monophos  92.4   0.095 2.1E-06   33.2   1.9   20    1-20      4-23  (147)
 37 smart00382 AAA ATPases associa  92.3   0.074 1.6E-06   31.8   1.2   23    1-23      7-29  (148)
 38 cd01120 RecA-like_NTPases RecA  92.3    0.12 2.6E-06   32.6   2.2   22    1-22      4-25  (165)
 39 PF01580 FtsK_SpoIIIE:  FtsK/Sp  92.0     0.1 2.2E-06   35.6   1.8   22    1-22     43-64  (205)
 40 cd00009 AAA The AAA+ (ATPases   91.8    0.13 2.8E-06   31.2   2.0   21    1-21     24-44  (151)
 41 PF00004 AAA:  ATPase family as  91.4    0.18 3.8E-06   31.1   2.3   19    2-20      4-22  (132)
 42 cd02028 UMPK_like Uridine mono  91.3    0.15 3.2E-06   34.9   2.0   21    1-21      4-24  (179)
 43 cd00046 DEXDc DEAD-like helica  91.3    0.17 3.7E-06   30.4   2.0   23    1-23      5-27  (144)
 44 PRK00300 gmk guanylate kinase;  91.2    0.12 2.6E-06   35.1   1.4   20    1-20     10-29  (205)
 45 TIGR01587 cas3_core CRISPR-ass  91.2    0.37   8E-06   35.4   4.1   21    1-21      4-24  (358)
 46 PRK06696 uridine kinase; Valid  91.1    0.16 3.4E-06   35.6   2.0   21    1-21     27-47  (223)
 47 PF04851 ResIII:  Type III rest  91.1    0.14 3.1E-06   33.1   1.6   21    2-22     31-51  (184)
 48 PF04665 Pox_A32:  Poxvirus A32  91.0    0.14 3.1E-06   37.5   1.8   22    1-22     18-39  (241)
 49 cd02019 NK Nucleoside/nucleoti  91.0    0.19   4E-06   29.3   1.9   20    1-20      4-23  (69)
 50 cd01129 PulE-GspE PulE/GspE Th  90.7    0.16 3.4E-06   37.1   1.7   22    1-22     85-106 (264)
 51 TIGR02524 dot_icm_DotB Dot/Icm  90.6    0.17 3.7E-06   38.6   2.0   22    1-22    139-160 (358)
 52 TIGR00235 udk uridine kinase.   90.4     0.2 4.3E-06   34.6   2.0   21    1-21     11-31  (207)
 53 PF00437 T2SE:  Type II/IV secr  90.2    0.14 2.9E-06   36.6   1.1   23    1-23    132-154 (270)
 54 TIGR02782 TrbB_P P-type conjug  90.1     0.2 4.3E-06   37.3   1.9   21    1-21    137-157 (299)
 55 TIGR02173 cyt_kin_arch cytidyl  90.1     0.2 4.4E-06   32.6   1.7   20    1-20      5-24  (171)
 56 PRK08233 hypothetical protein;  90.1    0.18   4E-06   33.2   1.5   21    1-21      8-28  (182)
 57 COG0572 Udk Uridine kinase [Nu  89.8    0.24 5.1E-06   36.0   2.0   21    1-21     13-33  (218)
 58 cd01130 VirB11-like_ATPase Typ  89.7     0.2 4.2E-06   34.2   1.4   20    1-20     30-49  (186)
 59 TIGR02525 plasmid_TraJ plasmid  89.7    0.23 5.1E-06   38.3   2.0   22    1-22    154-175 (372)
 60 TIGR01420 pilT_fam pilus retra  89.6    0.22 4.9E-06   37.4   1.9   21    1-21    127-147 (343)
 61 cd00820 PEPCK_HprK Phosphoenol  89.6    0.19   4E-06   32.7   1.2   17    1-17     20-36  (107)
 62 PRK06762 hypothetical protein;  89.4    0.27 5.9E-06   32.3   2.0   20    1-20      7-26  (166)
 63 cd01124 KaiC KaiC is a circadi  89.4    0.31 6.7E-06   32.2   2.2   22    1-22      4-25  (187)
 64 PF13401 AAA_22:  AAA domain; P  89.1    0.24 5.1E-06   30.8   1.4   22    1-22      9-30  (131)
 65 PF01935 DUF87:  Domain of unkn  89.1    0.37   8E-06   33.4   2.5   20    2-21     29-48  (229)
 66 cd01918 HprK_C HprK/P, the bif  89.0    0.25 5.4E-06   33.8   1.6   19    1-19     19-37  (149)
 67 cd02024 NRK1 Nicotinamide ribo  89.0    0.27 5.9E-06   34.4   1.8   20    1-20      4-23  (187)
 68 COG1123 ATPase components of v  88.9    0.17 3.7E-06   41.1   0.8   23    1-23     40-62  (539)
 69 COG2204 AtoC Response regulato  88.9    0.23 4.9E-06   39.7   1.5   61    1-69    169-233 (464)
 70 cd00071 GMPK Guanosine monopho  88.8    0.23   5E-06   32.6   1.3   20    1-20      4-23  (137)
 71 PRK04182 cytidylate kinase; Pr  88.8    0.28 6.1E-06   32.1   1.7   20    1-20      5-24  (180)
 72 PRK00023 cmk cytidylate kinase  88.7    0.32 6.8E-06   34.6   2.0   20    1-20      9-28  (225)
 73 PF05729 NACHT:  NACHT domain    88.6     0.4 8.6E-06   30.5   2.2   25    1-25      5-29  (166)
 74 PRK00131 aroK shikimate kinase  88.5    0.34 7.3E-06   31.5   1.9   20    1-20      9-28  (175)
 75 PRK13833 conjugal transfer pro  88.5    0.32 6.9E-06   36.9   2.0   21    1-21    149-169 (323)
 76 PRK09270 nucleoside triphospha  88.4    0.34 7.4E-06   34.0   2.0   22    1-22     38-59  (229)
 77 PF13671 AAA_33:  AAA domain; P  88.1    0.26 5.6E-06   31.2   1.1   20    1-20      4-23  (143)
 78 PRK07667 uridine kinase; Provi  88.0    0.39 8.4E-06   33.0   2.0   22    1-22     22-43  (193)
 79 PRK13900 type IV secretion sys  88.0    0.29 6.3E-06   37.0   1.5   20    1-20    165-184 (332)
 80 PF07728 AAA_5:  AAA domain (dy  88.0    0.46   1E-05   30.2   2.3   19    2-20      5-23  (139)
 81 PRK13851 type IV secretion sys  87.9    0.24 5.2E-06   37.8   1.0   20    1-20    167-186 (344)
 82 PF00910 RNA_helicase:  RNA hel  87.7    0.64 1.4E-05   29.0   2.7   24    1-24      3-26  (107)
 83 COG4172 ABC-type uncharacteriz  87.6     0.3 6.5E-06   39.4   1.4   21    2-22     42-62  (534)
 84 PF01583 APS_kinase:  Adenylyls  87.4    0.49 1.1E-05   32.5   2.2   24    1-24      7-30  (156)
 85 TIGR01313 therm_gnt_kin carboh  87.3    0.39 8.5E-06   31.5   1.7   20    1-20      3-22  (163)
 86 COG4608 AppF ABC-type oligopep  87.2    0.29 6.3E-06   36.6   1.1   18    1-18     44-61  (268)
 87 PRK10436 hypothetical protein;  87.2    0.39 8.4E-06   38.1   1.8   22    1-22    223-244 (462)
 88 PRK06547 hypothetical protein;  87.2    0.45 9.9E-06   32.6   2.0   20    1-20     20-39  (172)
 89 TIGR02538 type_IV_pilB type IV  86.9    0.41 8.8E-06   38.5   1.8   21    1-21    321-341 (564)
 90 PF06414 Zeta_toxin:  Zeta toxi  86.9    0.37 7.9E-06   33.1   1.4   20    1-20     20-39  (199)
 91 TIGR03263 guanyl_kin guanylate  86.9    0.29 6.3E-06   32.4   0.9   20    1-20      6-25  (180)
 92 cd02027 APSK Adenosine 5'-phos  86.7    0.51 1.1E-05   31.2   2.0   21    1-21      4-24  (149)
 93 PF13191 AAA_16:  AAA ATPase do  86.7     0.6 1.3E-05   30.5   2.3   23    1-23     29-51  (185)
 94 PRK14737 gmk guanylate kinase;  86.6    0.43 9.3E-06   33.0   1.6   20    1-20      9-28  (186)
 95 PF07475 Hpr_kinase_C:  HPr Ser  86.2    0.39 8.5E-06   33.8   1.3   18    1-18     23-40  (171)
 96 PRK03846 adenylylsulfate kinas  86.2    0.56 1.2E-05   32.1   2.0   22    1-22     29-50  (198)
 97 PRK00889 adenylylsulfate kinas  86.1    0.59 1.3E-05   31.1   2.0   21    1-21      9-29  (175)
 98 TIGR00455 apsK adenylylsulfate  85.9    0.61 1.3E-05   31.3   2.0   21    1-21     23-43  (184)
 99 PRK05541 adenylylsulfate kinas  85.9    0.61 1.3E-05   31.1   2.0   21    1-21     12-32  (176)
100 COG1102 Cmk Cytidylate kinase   85.9    0.61 1.3E-05   33.2   2.1   20    1-20      5-24  (179)
101 TIGR00150 HI0065_YjeE ATPase,   85.9    0.52 1.1E-05   31.6   1.7   21    1-21     27-47  (133)
102 COG2804 PulE Type II secretory  85.8    0.55 1.2E-05   37.9   2.0   24    1-24    263-286 (500)
103 TIGR02533 type_II_gspE general  85.7     0.4 8.7E-06   38.0   1.2   21    1-21    247-267 (486)
104 PRK07261 topology modulation p  85.6    0.58 1.3E-05   31.7   1.8   20    1-20      5-24  (171)
105 TIGR00554 panK_bact pantothena  85.4    0.66 1.4E-05   34.7   2.2   20    1-20     67-86  (290)
106 TIGR02237 recomb_radB DNA repa  85.4     0.7 1.5E-05   31.5   2.1   23    1-23     17-39  (209)
107 cd03115 SRP The signal recogni  85.3     0.7 1.5E-05   30.6   2.1   23    1-23      5-27  (173)
108 cd00464 SK Shikimate kinase (S  85.1    0.68 1.5E-05   29.6   1.9   20    1-20      4-23  (154)
109 cd02034 CooC The accessory pro  85.0    0.78 1.7E-05   29.6   2.1   23    1-23      4-26  (116)
110 TIGR03015 pepcterm_ATPase puta  84.9    0.58 1.3E-05   32.8   1.6   21    1-21     48-68  (269)
111 TIGR00017 cmk cytidylate kinas  84.7    0.68 1.5E-05   32.8   1.9   20    1-20      7-26  (217)
112 COG0542 clpA ATP-binding subun  84.7    0.68 1.5E-05   39.3   2.2   21    2-22    527-547 (786)
113 COG1132 MdlB ABC-type multidru  84.6    0.43 9.4E-06   37.6   0.9   21    1-21    360-380 (567)
114 PRK10751 molybdopterin-guanine  84.5    0.72 1.6E-05   32.1   1.9   22    1-22     11-32  (173)
115 smart00487 DEXDc DEAD-like hel  84.5    0.72 1.6E-05   29.4   1.8   20    1-20     29-49  (201)
116 PF13555 AAA_29:  P-loop contai  84.5    0.86 1.9E-05   26.9   2.0   20    1-20     28-47  (62)
117 cd00984 DnaB_C DnaB helicase C  84.3     0.8 1.7E-05   31.7   2.1   23    1-23     18-40  (242)
118 TIGR01360 aden_kin_iso1 adenyl  84.2    0.81 1.8E-05   30.2   2.0   20    1-20      8-27  (188)
119 cd02029 PRK_like Phosphoribulo  84.2    0.75 1.6E-05   34.6   2.0   22    1-22      4-25  (277)
120 TIGR00929 VirB4_CagE type IV s  84.2    0.71 1.5E-05   37.6   2.0   23    1-23    439-461 (785)
121 TIGR03881 KaiC_arch_4 KaiC dom  84.2    0.81 1.8E-05   31.6   2.1   21    1-21     25-45  (229)
122 TIGR02746 TraC-F-type type-IV   83.9    0.77 1.7E-05   37.6   2.1   22    1-22    435-456 (797)
123 PRK11022 dppD dipeptide transp  83.8    0.62 1.4E-05   34.8   1.4   20    1-20     38-57  (326)
124 COG1123 ATPase components of v  83.7    0.74 1.6E-05   37.5   1.9   19    2-20    323-341 (539)
125 TIGR03878 thermo_KaiC_2 KaiC d  83.5    0.86 1.9E-05   32.9   2.0   22    1-22     41-62  (259)
126 PRK09473 oppD oligopeptide tra  83.2    0.67 1.5E-05   34.7   1.4   20    1-20     47-66  (330)
127 cd02026 PRK Phosphoribulokinas  82.9    0.84 1.8E-05   33.5   1.8   20    1-20      4-23  (273)
128 PRK13894 conjugal transfer ATP  82.9    0.86 1.9E-05   34.3   1.9   21    1-21    153-173 (319)
129 PF00270 DEAD:  DEAD/DEAH box h  82.8     1.1 2.4E-05   28.7   2.2   21    1-21     19-39  (169)
130 cd03229 ABC_Class3 This class   82.7    0.77 1.7E-05   30.8   1.5   18    1-18     31-48  (178)
131 PRK11308 dppF dipeptide transp  82.7    0.75 1.6E-05   34.4   1.5   20    1-20     46-65  (327)
132 cd01983 Fer4_NifH The Fer4_Nif  82.6     1.2 2.7E-05   25.4   2.2   21    2-22      5-25  (99)
133 PRK15093 antimicrobial peptide  82.5    0.77 1.7E-05   34.2   1.5   20    1-20     38-57  (330)
134 PLN02796 D-glycerate 3-kinase   82.5    0.91   2E-05   35.0   1.9   21    1-21    105-125 (347)
135 cd01394 radB RadB. The archaea  82.4     1.1 2.3E-05   30.8   2.1   22    1-22     24-45  (218)
136 PRK09361 radB DNA repair and r  82.4     1.1 2.4E-05   31.0   2.2   22    1-22     28-49  (225)
137 PF06309 Torsin:  Torsin;  Inte  82.3     1.7 3.6E-05   29.2   2.9   23    2-24     59-81  (127)
138 cd00227 CPT Chloramphenicol (C  82.1     1.1 2.3E-05   30.1   1.9   20    1-20      7-26  (175)
139 cd02021 GntK Gluconate kinase   81.9    0.91   2E-05   29.2   1.5   19    1-19      4-22  (150)
140 PF06745 KaiC:  KaiC;  InterPro  81.9       1 2.2E-05   31.1   1.9   20    1-20     24-43  (226)
141 TIGR02788 VirB11 P-type DNA tr  81.9    0.66 1.4E-05   34.3   0.9   20    1-20    149-168 (308)
142 PRK08118 topology modulation p  81.8     1.1 2.3E-05   30.3   1.9   20    1-20      6-25  (167)
143 TIGR01166 cbiO cobalt transpor  81.7    0.89 1.9E-05   30.6   1.5   18    1-18     23-40  (190)
144 TIGR02639 ClpA ATP-dependent C  81.6       1 2.3E-05   37.1   2.1   20    1-20    489-508 (731)
145 cd03293 ABC_NrtD_SsuB_transpor  81.5    0.88 1.9E-05   31.3   1.4   19    1-19     35-53  (220)
146 cd01393 recA_like RecA is a  b  81.2     1.2 2.5E-05   30.6   1.9   21    1-21     24-44  (226)
147 TIGR03420 DnaA_homol_Hda DnaA   81.1     1.5 3.3E-05   29.9   2.5   20    2-21     44-63  (226)
148 PRK10865 protein disaggregatio  81.0     1.1 2.4E-05   37.8   2.1   22    1-22    603-624 (857)
149 PRK05439 pantothenate kinase;   80.9     1.3 2.7E-05   33.6   2.2   21    1-21     91-111 (311)
150 cd03259 ABC_Carb_Solutes_like   80.9    0.99 2.1E-05   30.9   1.5   19    1-19     31-49  (213)
151 COG1474 CDC6 Cdc6-related prot  80.8     1.4 2.9E-05   33.9   2.4   25    1-25     47-71  (366)
152 PRK00091 miaA tRNA delta(2)-is  80.8       1 2.2E-05   33.9   1.6   20    1-20      9-28  (307)
153 PRK15453 phosphoribulokinase;   80.6     1.2 2.7E-05   33.6   2.0   21    1-21     10-30  (290)
154 PHA02530 pseT polynucleotide k  80.6       1 2.2E-05   32.3   1.6   20    1-20      7-26  (300)
155 cd03225 ABC_cobalt_CbiO_domain  80.5       1 2.3E-05   30.6   1.5   19    1-19     32-50  (211)
156 TIGR02673 FtsE cell division A  80.5       1 2.2E-05   30.8   1.4   19    1-19     33-51  (214)
157 cd03270 ABC_UvrA_I The excisio  80.5     0.7 1.5E-05   32.5   0.6   13    1-13     26-38  (226)
158 cd03224 ABC_TM1139_LivF_branch  80.5    0.99 2.2E-05   30.9   1.4   18    1-18     31-48  (222)
159 PRK15079 oligopeptide ABC tran  80.5       1 2.2E-05   33.8   1.5   20    1-20     52-71  (331)
160 PLN02348 phosphoribulokinase    80.4     1.2 2.7E-05   34.9   2.0   21    1-21     54-74  (395)
161 COG1124 DppF ABC-type dipeptid  80.4    0.99 2.1E-05   33.6   1.4   20    1-20     38-57  (252)
162 TIGR00176 mobB molybdopterin-g  80.4     1.4 2.9E-05   29.7   2.0   23    1-23      4-26  (155)
163 TIGR02868 CydC thiol reductant  80.3    0.71 1.5E-05   36.0   0.6   20    1-20    366-385 (529)
164 PRK13891 conjugal transfer pro  80.2     1.2 2.7E-05   37.5   2.1   22    1-22    493-514 (852)
165 cd01123 Rad51_DMC1_radA Rad51_  80.2     1.1 2.4E-05   30.9   1.6   19    1-19     24-42  (235)
166 PF00625 Guanylate_kin:  Guanyl  80.0     1.2 2.6E-05   30.0   1.6   20    1-20      7-26  (183)
167 PF13245 AAA_19:  Part of AAA d  80.0     1.7 3.7E-05   26.0   2.2   21    2-22     16-36  (76)
168 PRK05428 HPr kinase/phosphoryl  79.9     1.1 2.4E-05   34.0   1.6   19    1-19    151-169 (308)
169 PF00005 ABC_tran:  ABC transpo  79.9    0.88 1.9E-05   28.6   0.9   19    1-19     16-34  (137)
170 PRK10078 ribose 1,5-bisphospho  79.9     0.9 1.9E-05   30.8   1.0   20    1-20      7-26  (186)
171 TIGR00595 priA primosomal prot  79.8     1.7 3.6E-05   34.6   2.6   21    2-22      3-23  (505)
172 cd03297 ABC_ModC_molybdenum_tr  79.8     1.1 2.4E-05   30.7   1.4   19    1-19     28-46  (214)
173 PF13481 AAA_25:  AAA domain; P  79.6     1.3 2.7E-05   29.5   1.6   22    1-22     37-58  (193)
174 TIGR00960 3a0501s02 Type II (G  79.6     1.1 2.4E-05   30.7   1.4   19    1-19     34-52  (216)
175 PLN02318 phosphoribulokinase/u  79.6       1 2.2E-05   37.5   1.4   20    1-20     70-89  (656)
176 PRK13721 conjugal transfer ATP  79.6     1.2 2.7E-05   37.3   1.9   22    1-22    454-475 (844)
177 PF13476 AAA_23:  AAA domain; P  79.5     1.2 2.7E-05   29.1   1.6   20    1-20     24-43  (202)
178 TIGR02881 spore_V_K stage V sp  79.5     1.7 3.7E-05   31.0   2.4   21    2-22     48-68  (261)
179 cd03269 ABC_putative_ATPase Th  79.4     1.2 2.6E-05   30.4   1.5   18    1-18     31-48  (210)
180 cd03255 ABC_MJ0796_Lo1CDE_FtsE  79.4     1.2 2.5E-05   30.5   1.5   19    1-19     35-53  (218)
181 cd03219 ABC_Mj1267_LivG_branch  79.4     1.1 2.3E-05   31.1   1.3   18    1-18     31-48  (236)
182 PRK05973 replicative DNA helic  79.4     1.5 3.2E-05   32.0   2.0   22    1-22     69-90  (237)
183 TIGR03880 KaiC_arch_3 KaiC dom  79.3     1.6 3.5E-05   30.2   2.1   21    1-21     21-41  (224)
184 TIGR00101 ureG urease accessor  79.2     1.4 3.1E-05   30.7   1.9   21    1-21      6-26  (199)
185 PRK07429 phosphoribulokinase;   79.1     1.3 2.9E-05   33.4   1.8   20    1-20     13-32  (327)
186 cd03265 ABC_DrrA DrrA is the A  79.1     1.2 2.6E-05   30.6   1.5   18    1-18     31-48  (220)
187 PRK11545 gntK gluconate kinase  79.0     1.9 4.1E-05   28.9   2.4   19    2-20      1-19  (163)
188 cd03235 ABC_Metallic_Cations A  79.0     1.1 2.4E-05   30.6   1.2   19    1-19     30-48  (213)
189 TIGR00972 3a0107s01c2 phosphat  79.0     1.2 2.6E-05   31.3   1.4   19    1-19     32-50  (247)
190 TIGR03744 traC_PFL_4706 conjug  78.9     1.5 3.3E-05   37.1   2.2   22    1-22    480-501 (893)
191 cd03256 ABC_PhnC_transporter A  78.9     1.2 2.6E-05   30.9   1.4   19    1-19     32-50  (241)
192 TIGR01359 UMP_CMP_kin_fam UMP-  78.7     1.5 3.3E-05   29.0   1.8   20    1-20      4-23  (183)
193 TIGR03499 FlhF flagellar biosy  78.7     1.6 3.5E-05   32.0   2.1   23    1-23    199-221 (282)
194 COG1493 HprK Serine kinase of   78.7     1.3 2.8E-05   33.9   1.6   19    1-19    150-168 (308)
195 PRK15177 Vi polysaccharide exp  78.7     1.3 2.7E-05   30.8   1.5   19    1-19     18-36  (213)
196 COG2884 FtsE Predicted ATPase   78.6     1.4   3E-05   32.3   1.7   19    1-19     33-51  (223)
197 cd03258 ABC_MetN_methionine_tr  78.6     1.3 2.7E-05   30.8   1.4   19    1-19     36-54  (233)
198 cd03292 ABC_FtsE_transporter F  78.6     1.3 2.8E-05   30.2   1.4   19    1-19     32-50  (214)
199 cd03264 ABC_drug_resistance_li  78.5     1.3 2.8E-05   30.3   1.4   18    1-18     30-47  (211)
200 cd03301 ABC_MalK_N The N-termi  78.5     1.3 2.8E-05   30.2   1.5   19    1-19     31-49  (213)
201 PRK13477 bifunctional pantoate  78.5     1.3 2.9E-05   35.7   1.7   20    1-20    289-308 (512)
202 PRK13538 cytochrome c biogenes  78.4     1.3 2.8E-05   30.2   1.5   19    1-19     32-50  (204)
203 PLN02840 tRNA dimethylallyltra  78.3     1.3 2.9E-05   34.9   1.6   20    1-20     26-45  (421)
204 COG0497 RecN ATPase involved i  78.3    0.94   2E-05   37.1   0.8   16    1-16     27-42  (557)
205 cd03245 ABCC_bacteriocin_expor  78.2     1.3 2.9E-05   30.3   1.5   18    1-18     35-52  (220)
206 PRK03839 putative kinase; Prov  78.2     1.7 3.7E-05   29.0   2.0   20    1-20      5-24  (180)
207 PRK02496 adk adenylate kinase;  78.2     1.7 3.8E-05   29.0   2.0   20    1-20      6-25  (184)
208 TIGR02880 cbbX_cfxQ probable R  78.1     1.7 3.8E-05   31.8   2.1   22    2-23     64-85  (284)
209 TIGR01277 thiQ thiamine ABC tr  78.1     1.4   3E-05   30.3   1.5   19    1-19     29-47  (213)
210 cd03298 ABC_ThiQ_thiamine_tran  78.0     1.4   3E-05   30.1   1.5   19    1-19     29-47  (211)
211 TIGR03864 PQQ_ABC_ATP ABC tran  77.9     1.4 2.9E-05   30.8   1.5   18    1-18     32-49  (236)
212 PRK11174 cysteine/glutathione   77.9    0.91   2E-05   35.8   0.6   20    1-20    381-400 (588)
213 cd03260 ABC_PstB_phosphate_tra  77.9     1.4   3E-05   30.4   1.5   20    1-20     31-50  (227)
214 TIGR03877 thermo_KaiC_1 KaiC d  77.7     1.8 3.9E-05   30.5   2.1   20    1-20     26-45  (237)
215 PRK13873 conjugal transfer ATP  77.7     1.7 3.6E-05   36.3   2.1   22    1-22    446-467 (811)
216 cd03234 ABCG_White The White s  77.7     1.4   3E-05   30.5   1.5   20    1-20     38-57  (226)
217 PRK14244 phosphate ABC transpo  77.7     1.4   3E-05   31.0   1.5   19    1-19     36-54  (251)
218 PLN02165 adenylate isopentenyl  77.6     1.5 3.2E-05   33.7   1.7   20    1-20     48-67  (334)
219 PF00158 Sigma54_activat:  Sigm  77.6     1.8 3.8E-05   29.6   1.9   18    1-18     27-44  (168)
220 PRK08356 hypothetical protein;  77.5     1.4   3E-05   30.1   1.4   18    1-18     10-27  (195)
221 TIGR01189 ccmA heme ABC export  77.5     1.5 3.1E-05   29.8   1.5   19    1-19     31-49  (198)
222 PRK14247 phosphate ABC transpo  77.4     1.4 3.1E-05   30.9   1.4   19    1-19     34-52  (250)
223 PRK08903 DnaA regulatory inact  77.3     2.3   5E-05   29.4   2.5   19    2-20     48-66  (227)
224 CHL00095 clpC Clp protease ATP  77.3     1.7 3.6E-05   36.5   2.0   22    1-22    544-565 (821)
225 PRK06761 hypothetical protein;  77.2     1.6 3.4E-05   32.7   1.7   22    1-22      8-29  (282)
226 TIGR01978 sufC FeS assembly AT  77.2     1.4 3.1E-05   30.6   1.4   19    1-19     31-49  (243)
227 PRK06217 hypothetical protein;  77.2     1.7 3.7E-05   29.3   1.7   20    1-20      6-25  (183)
228 PRK13540 cytochrome c biogenes  77.2     1.5 3.3E-05   29.8   1.5   18    1-18     32-49  (200)
229 cd03262 ABC_HisP_GlnQ_permease  77.2     1.5 3.3E-05   29.8   1.5   19    1-19     31-49  (213)
230 TIGR02324 CP_lyasePhnL phospho  77.1     1.5 3.2E-05   30.2   1.4   19    1-19     39-57  (224)
231 TIGR01184 ntrCD nitrate transp  77.1     1.5 3.3E-05   30.6   1.5   19    1-19     16-34  (230)
232 TIGR02928 orc1/cdc6 family rep  77.0     1.9   4E-05   31.7   2.0   22    1-22     45-66  (365)
233 cd03257 ABC_NikE_OppD_transpor  77.0     1.5 3.2E-05   30.1   1.4   19    1-19     36-54  (228)
234 PRK11034 clpA ATP-dependent Cl  76.9     1.7 3.7E-05   36.5   2.0   19    2-20    494-512 (758)
235 TIGR02770 nickel_nikD nickel i  76.9     1.5 3.2E-05   30.5   1.4   19    1-19     17-35  (230)
236 TIGR02640 gas_vesic_GvpN gas v  76.7     2.2 4.8E-05   30.7   2.3   18    2-19     27-44  (262)
237 PRK11131 ATP-dependent RNA hel  76.7     3.4 7.4E-05   36.9   3.8   20    1-23     94-113 (1294)
238 PF03205 MobB:  Molybdopterin g  76.7     1.9 4.1E-05   28.6   1.8   24    1-24      5-28  (140)
239 PRK09493 glnQ glutamine ABC tr  76.7     1.5 3.3E-05   30.5   1.4   19    1-19     32-50  (240)
240 TIGR03005 ectoine_ehuA ectoine  76.6     1.5 3.3E-05   30.8   1.4   18    1-18     31-48  (252)
241 cd03268 ABC_BcrA_bacitracin_re  76.6     1.6 3.5E-05   29.7   1.5   18    1-18     31-48  (208)
242 PRK11629 lolD lipoprotein tran  76.6     1.6 3.5E-05   30.4   1.5   19    1-19     40-58  (233)
243 TIGR03608 L_ocin_972_ABC putat  76.5     1.6 3.5E-05   29.5   1.5   18    1-18     29-46  (206)
244 PRK13541 cytochrome c biogenes  76.5     1.6 3.5E-05   29.6   1.5   18    1-18     31-48  (195)
245 PRK11176 lipid transporter ATP  76.5     1.4   3E-05   34.7   1.3   20    1-20    374-393 (582)
246 PRK11264 putative amino-acid A  76.5     1.6 3.4E-05   30.6   1.5   19    1-19     34-52  (250)
247 PF12774 AAA_6:  Hydrolytic ATP  76.4     1.6 3.5E-05   31.5   1.5   19    2-20     38-56  (231)
248 TIGR02315 ABC_phnC phosphonate  76.4     1.6 3.5E-05   30.3   1.5   18    1-18     33-50  (243)
249 cd03226 ABC_cobalt_CbiO_domain  76.4     1.6 3.4E-05   29.8   1.4   18    1-18     31-48  (205)
250 PRK04040 adenylate kinase; Pro  76.4     1.8   4E-05   29.9   1.7   20    1-20      7-26  (188)
251 PRK09825 idnK D-gluconate kina  76.3     1.9 4.1E-05   29.4   1.8   20    1-20      8-27  (176)
252 PRK11701 phnK phosphonate C-P   76.3     1.6 3.5E-05   30.9   1.5   19    1-19     37-55  (258)
253 TIGR00679 hpr-ser Hpr(Ser) kin  76.3     1.6 3.4E-05   33.2   1.5   19    1-19    151-169 (304)
254 COG4170 SapD ABC-type antimicr  76.3     1.7 3.6E-05   32.9   1.6   17    2-18     39-55  (330)
255 cd03296 ABC_CysA_sulfate_impor  76.2     1.6 3.5E-05   30.4   1.5   19    1-19     33-51  (239)
256 PRK10575 iron-hydroxamate tran  76.2     1.4 3.1E-05   31.4   1.2   18    1-18     42-59  (265)
257 cd03214 ABC_Iron-Siderophores_  76.2     1.6 3.6E-05   29.2   1.4   18    1-18     30-47  (180)
258 PRK11124 artP arginine transpo  76.2     1.7 3.6E-05   30.4   1.5   18    1-18     33-50  (242)
259 TIGR03410 urea_trans_UrtE urea  76.2     1.6 3.4E-05   30.2   1.4   19    1-19     31-49  (230)
260 COG4619 ABC-type uncharacteriz  76.1     1.7 3.6E-05   31.7   1.5   17    1-17     34-50  (223)
261 PRK06067 flagellar accessory p  76.0     2.2 4.8E-05   29.7   2.1   22    1-22     30-51  (234)
262 PRK13539 cytochrome c biogenes  75.9     1.7 3.7E-05   29.8   1.5   18    1-18     33-50  (207)
263 PRK10908 cell division protein  75.8     1.7 3.6E-05   30.0   1.4   18    1-18     33-50  (222)
264 cd03231 ABC_CcmA_heme_exporter  75.8     1.7 3.7E-05   29.7   1.4   19    1-19     31-49  (201)
265 PRK12402 replication factor C   75.8     2.1 4.6E-05   30.8   2.0   23    1-23     41-63  (337)
266 cd03261 ABC_Org_Solvent_Resist  75.8     1.7 3.7E-05   30.2   1.5   19    1-19     31-49  (235)
267 PRK14269 phosphate ABC transpo  75.7     1.7 3.7E-05   30.5   1.5   18    1-18     33-50  (246)
268 PRK10584 putative ABC transpor  75.7     1.8 3.8E-05   29.9   1.5   19    1-19     41-59  (228)
269 PRK10744 pstB phosphate transp  75.6     1.7 3.7E-05   30.9   1.4   19    1-19     44-62  (260)
270 PLN02200 adenylate kinase fami  75.6     2.1 4.5E-05   30.6   1.9   20    1-20     48-67  (234)
271 cd03247 ABCC_cytochrome_bd The  75.5     1.8 3.8E-05   29.0   1.4   18    1-18     33-50  (178)
272 PRK08533 flagellar accessory p  75.4     2.3   5E-05   30.2   2.1   21    1-21     29-49  (230)
273 TIGR03771 anch_rpt_ABC anchore  75.4     1.8 3.8E-05   30.1   1.5   19    1-19     11-29  (223)
274 TIGR02323 CP_lyasePhnK phospho  75.3     1.8 3.8E-05   30.4   1.5   19    1-19     34-52  (253)
275 smart00763 AAA_PrkA PrkA AAA d  75.3     2.1 4.6E-05   33.2   2.0   22    1-22     83-104 (361)
276 PRK14242 phosphate transporter  75.3     1.8 3.9E-05   30.4   1.5   18    1-18     37-54  (253)
277 PF12775 AAA_7:  P-loop contain  75.2     1.9 4.1E-05   31.6   1.6   18    1-18     38-55  (272)
278 TIGR03346 chaperone_ClpB ATP-d  75.1       2 4.4E-05   36.1   2.0   22    1-22    600-621 (852)
279 cd03252 ABCC_Hemolysin The ABC  75.1     1.8 3.8E-05   30.1   1.4   19    1-19     33-51  (237)
280 TIGR03345 VI_ClpV1 type VI sec  75.1     2.1 4.6E-05   36.3   2.1   21    1-21    601-621 (852)
281 PRK14239 phosphate transporter  75.1     1.8 3.9E-05   30.3   1.5   18    1-18     36-53  (252)
282 TIGR00968 3a0106s01 sulfate AB  75.1     1.9   4E-05   30.2   1.5   19    1-19     31-49  (237)
283 cd03230 ABC_DR_subfamily_A Thi  75.1     1.8   4E-05   28.8   1.4   18    1-18     31-48  (173)
284 PF02367 UPF0079:  Uncharacteri  75.1     2.3   5E-05   28.1   1.9   18    3-20     22-39  (123)
285 cd01876 YihA_EngB The YihA (En  75.0     1.9 4.1E-05   26.9   1.4   17    1-17      4-20  (170)
286 TIGR00174 miaA tRNA isopenteny  75.0     1.8 3.9E-05   32.4   1.5   20    1-20      4-23  (287)
287 PRK14530 adenylate kinase; Pro  75.0     2.3   5E-05   29.4   2.0   20    1-20      8-27  (215)
288 TIGR03574 selen_PSTK L-seryl-t  74.9     2.3 5.1E-05   30.0   2.0   21    1-21      4-24  (249)
289 TIGR02204 MsbA_rel ABC transpo  74.8     1.7 3.6E-05   34.1   1.3   20    1-20    371-390 (576)
290 cd03218 ABC_YhbG The ABC trans  74.8     1.9 4.1E-05   29.8   1.5   18    1-18     31-48  (232)
291 PRK14268 phosphate ABC transpo  74.8     1.8   4E-05   30.7   1.4   19    1-19     43-61  (258)
292 PRK14267 phosphate ABC transpo  74.7     1.9 4.1E-05   30.3   1.5   19    1-19     35-53  (253)
293 PRK10247 putative ABC transpor  74.7     1.9 4.1E-05   30.0   1.5   18    1-18     38-55  (225)
294 cd03263 ABC_subfamily_A The AB  74.7     1.9 4.2E-05   29.5   1.5   18    1-18     33-50  (220)
295 PRK11300 livG leucine/isoleuci  74.6     1.8   4E-05   30.3   1.4   19    1-19     36-54  (255)
296 PRK14271 phosphate ABC transpo  74.6     1.9 4.1E-05   31.2   1.5   18    1-18     52-69  (276)
297 PRK14241 phosphate transporter  74.5     1.9 4.1E-05   30.5   1.5   20    1-20     35-54  (258)
298 PRK14240 phosphate transporter  74.5     1.9 4.1E-05   30.3   1.4   18    1-18     34-51  (250)
299 cd03246 ABCC_Protease_Secretio  74.5       2 4.3E-05   28.7   1.5   19    1-19     33-51  (173)
300 PRK10646 ADP-binding protein;   74.4     2.7   6E-05   28.8   2.2   20    2-21     34-53  (153)
301 PRK13764 ATPase; Provisional    74.4     2.2 4.7E-05   35.2   1.9   22    1-22    262-283 (602)
302 cd03216 ABC_Carb_Monos_I This   74.3       2 4.3E-05   28.6   1.4   18    1-18     31-48  (163)
303 cd03249 ABC_MTABC3_MDL1_MDL2 M  74.2     1.9   4E-05   30.0   1.3   19    1-19     34-52  (238)
304 PRK14261 phosphate ABC transpo  74.1       2 4.3E-05   30.3   1.5   18    1-18     37-54  (253)
305 PHA02544 44 clamp loader, smal  74.0     2.8 6.1E-05   30.2   2.3   20    1-20     48-67  (316)
306 PRK05416 glmZ(sRNA)-inactivati  74.0     1.9 4.1E-05   32.2   1.4   16    1-16     11-26  (288)
307 PRK04328 hypothetical protein;  74.0     2.7 5.8E-05   30.1   2.1   20    1-20     28-47  (249)
308 PRK13768 GTPase; Provisional    74.0     2.6 5.7E-05   30.3   2.1   23    1-23      7-29  (253)
309 PRK13645 cbiO cobalt transport  74.0     1.9 4.2E-05   31.2   1.4   19    1-19     42-60  (289)
310 PF08423 Rad51:  Rad51;  InterP  74.0     1.8 3.9E-05   31.4   1.3   17    1-17     43-59  (256)
311 PRK13947 shikimate kinase; Pro  74.0     2.6 5.7E-05   27.6   1.9   20    1-20      6-25  (171)
312 PRK13946 shikimate kinase; Pro  73.9     2.4 5.2E-05   28.7   1.8   20    1-20     15-34  (184)
313 TIGR02211 LolD_lipo_ex lipopro  73.8     2.1 4.5E-05   29.3   1.5   18    1-18     36-53  (221)
314 PRK14270 phosphate ABC transpo  73.8     2.1 4.4E-05   30.1   1.5   19    1-19     35-53  (251)
315 cd03223 ABCD_peroxisomal_ALDP   73.6     2.1 4.7E-05   28.5   1.5   19    1-19     32-50  (166)
316 cd03267 ABC_NatA_like Similar   73.6       2 4.4E-05   30.1   1.4   18    1-18     52-69  (236)
317 PRK05057 aroK shikimate kinase  73.6       3 6.4E-05   28.2   2.2   19    2-20     10-28  (172)
318 PRK14238 phosphate transporter  73.5     2.1 4.5E-05   30.8   1.5   20    1-20     55-74  (271)
319 TIGR00382 clpX endopeptidase C  73.5     2.2 4.8E-05   33.5   1.7   19    2-20    122-140 (413)
320 PRK00411 cdc6 cell division co  73.4     2.6 5.6E-05   31.3   2.0   22    1-22     60-81  (394)
321 PRK07952 DNA replication prote  73.4     2.9 6.2E-05   30.4   2.2   23    1-23    104-126 (244)
322 PRK14245 phosphate ABC transpo  73.4     2.1 4.5E-05   30.1   1.4   18    1-18     34-51  (250)
323 TIGR02982 heterocyst_DevA ABC   73.4     2.1 4.6E-05   29.5   1.5   19    1-19     36-54  (220)
324 PRK10419 nikE nickel transport  73.4     2.1 4.5E-05   30.7   1.4   18    1-18     43-60  (268)
325 cd04163 Era Era subfamily.  Er  73.2     2.3   5E-05   26.3   1.5   18    1-18      8-25  (168)
326 PRK08727 hypothetical protein;  73.2       3 6.5E-05   29.5   2.2   22    1-22     46-67  (233)
327 cd03233 ABC_PDR_domain1 The pl  73.2       2 4.4E-05   29.4   1.3   19    1-19     38-56  (202)
328 PRK13648 cbiO cobalt transport  73.1     2.2 4.7E-05   30.5   1.5   18    1-18     40-57  (269)
329 PRK14250 phosphate ABC transpo  73.1     2.1 4.6E-05   30.0   1.4   18    1-18     34-51  (241)
330 KOG0057|consensus               73.1     2.5 5.4E-05   34.9   1.9   21    1-21    383-403 (591)
331 TIGR02769 nickel_nikE nickel i  73.0     2.2 4.7E-05   30.5   1.4   19    1-19     42-60  (265)
332 PRK14738 gmk guanylate kinase;  73.0     2.1 4.5E-05   29.7   1.3   18    1-18     18-35  (206)
333 PRK14273 phosphate ABC transpo  73.0     2.2 4.7E-05   30.1   1.5   19    1-19     38-56  (254)
334 PRK14253 phosphate ABC transpo  72.9     2.2 4.8E-05   29.9   1.5   19    1-19     34-52  (249)
335 cd03273 ABC_SMC2_euk Eukaryoti  72.9     3.4 7.3E-05   29.2   2.4   20    1-20     30-49  (251)
336 cd03266 ABC_NatA_sodium_export  72.8     2.3 4.9E-05   29.1   1.5   18    1-18     36-53  (218)
337 cd00267 ABC_ATPase ABC (ATP-bi  72.7     2.2 4.8E-05   27.8   1.3   18    1-18     30-47  (157)
338 PRK14251 phosphate ABC transpo  72.7     2.2 4.9E-05   29.9   1.5   20    1-20     35-54  (251)
339 PRK11247 ssuB aliphatic sulfon  72.7     2.2 4.8E-05   30.7   1.4   19    1-19     43-61  (257)
340 COG1125 OpuBA ABC-type proline  72.6     2.5 5.4E-05   32.3   1.7   24    2-26     33-56  (309)
341 COG0529 CysC Adenylylsulfate k  72.6     3.5 7.5E-05   29.8   2.4   24    1-24     28-51  (197)
342 PRK14258 phosphate ABC transpo  72.5     2.3   5E-05   30.2   1.5   20    1-20     38-57  (261)
343 PRK11614 livF leucine/isoleuci  72.5     2.2 4.8E-05   29.7   1.4   18    1-18     36-53  (237)
344 cd03220 ABC_KpsT_Wzt ABC_KpsT_  72.4     2.2 4.9E-05   29.7   1.4   18    1-18     53-70  (224)
345 PRK14528 adenylate kinase; Pro  72.4     2.9 6.4E-05   28.5   2.0   20    1-20      6-25  (186)
346 PRK14260 phosphate ABC transpo  72.4     2.4 5.1E-05   30.1   1.5   20    1-20     38-57  (259)
347 cd03244 ABCC_MRP_domain2 Domai  72.4     2.4 5.2E-05   29.1   1.5   19    1-19     35-53  (221)
348 PRK03731 aroL shikimate kinase  72.3     3.1 6.6E-05   27.4   2.0   20    1-20      7-26  (171)
349 PRK05342 clpX ATP-dependent pr  72.3     2.7 5.9E-05   32.8   1.9   20    1-20    113-132 (412)
350 cd03294 ABC_Pro_Gly_Bertaine T  72.2     2.3 5.1E-05   30.5   1.5   19    1-19     55-73  (269)
351 PRK14527 adenylate kinase; Pro  72.2     2.9 6.3E-05   28.3   1.9   20    1-20     11-30  (191)
352 TIGR03740 galliderm_ABC gallid  72.2     2.4 5.2E-05   29.2   1.5   18    1-18     31-48  (223)
353 cd03213 ABCG_EPDR ABCG transpo  72.1     2.3   5E-05   29.0   1.4   18    1-18     40-57  (194)
354 PRK11248 tauB taurine transpor  72.1     2.3   5E-05   30.3   1.4   19    1-19     32-50  (255)
355 TIGR01193 bacteriocin_ABC ABC-  72.0     1.8 3.9E-05   35.1   0.9   20    1-20    505-524 (708)
356 PRK04220 2-phosphoglycerate ki  72.0     2.8 6.2E-05   31.7   2.0   20    1-20     97-116 (301)
357 cd03238 ABC_UvrA The excision   72.0     2.4 5.2E-05   29.2   1.4   17    1-17     26-42  (176)
358 cd03232 ABC_PDR_domain2 The pl  71.9     2.4 5.2E-05   28.8   1.4   17    1-17     38-54  (192)
359 PRK10418 nikD nickel transport  71.7     2.4 5.3E-05   30.0   1.5   19    1-19     34-52  (254)
360 cd03369 ABCC_NFT1 Domain 2 of   71.6     2.5 5.5E-05   28.7   1.5   19    1-19     39-57  (207)
361 PRK14256 phosphate ABC transpo  71.6     2.5 5.5E-05   29.7   1.5   18    1-18     35-52  (252)
362 PRK14237 phosphate transporter  71.5     2.5 5.4E-05   30.2   1.5   19    1-19     51-69  (267)
363 PRK10869 recombination and rep  71.5     1.7 3.7E-05   35.0   0.7   16    1-16     27-42  (553)
364 PRK10895 lipopolysaccharide AB  71.4     2.5 5.5E-05   29.4   1.5   18    1-18     34-51  (241)
365 PRK14265 phosphate ABC transpo  71.4     2.4 5.3E-05   30.5   1.4   18    1-18     51-68  (274)
366 TIGR03783 Bac_Flav_CT_G Bacter  71.3     3.2 6.9E-05   35.2   2.2   22    1-22    443-464 (829)
367 PRK11831 putative ABC transpor  71.2     2.5 5.4E-05   30.3   1.4   18    1-18     38-55  (269)
368 PF04548 AIG1:  AIG1 family;  I  71.2     3.4 7.3E-05   28.7   2.1   17    2-18      6-22  (212)
369 PRK09984 phosphonate/organopho  71.2     2.5 5.5E-05   29.9   1.5   19    1-19     35-53  (262)
370 cd03114 ArgK-like The function  71.2     3.6 7.7E-05   27.3   2.1   22    2-23      5-26  (148)
371 PRK15056 manganese/iron transp  71.2     2.4 5.3E-05   30.4   1.4   18    1-18     38-55  (272)
372 PRK14252 phosphate ABC transpo  71.1     2.5 5.5E-05   30.0   1.5   18    1-18     47-64  (265)
373 PRK13657 cyclic beta-1,2-gluca  71.1     2.4 5.1E-05   33.6   1.4   20    1-20    366-385 (588)
374 PRK09580 sufC cysteine desulfu  71.1     2.3   5E-05   29.7   1.2   18    1-18     32-49  (248)
375 PRK14255 phosphate ABC transpo  71.0     2.5 5.5E-05   29.6   1.4   18    1-18     36-53  (252)
376 PRK00440 rfc replication facto  71.0     3.4 7.3E-05   29.5   2.1   22    1-22     43-64  (319)
377 PRK14274 phosphate ABC transpo  71.0     2.7 5.8E-05   29.8   1.5   20    1-20     43-62  (259)
378 PRK14248 phosphate ABC transpo  70.9     2.6 5.6E-05   30.0   1.5   18    1-18     52-69  (268)
379 PRK14263 phosphate ABC transpo  70.9     2.6 5.6E-05   30.2   1.5   19    1-19     39-57  (261)
380 PRK13543 cytochrome c biogenes  70.8     2.6 5.7E-05   29.0   1.4   18    1-18     42-59  (214)
381 TIGR00678 holB DNA polymerase   70.8     3.4 7.3E-05   27.8   1.9   23    1-23     19-41  (188)
382 PRK14235 phosphate transporter  70.7     2.7 5.8E-05   30.1   1.5   20    1-20     50-69  (267)
383 PRK13638 cbiO cobalt transport  70.7     2.5 5.3E-05   30.3   1.3   18    1-18     32-49  (271)
384 cd03116 MobB Molybdenum is an   70.7     3.6 7.7E-05   27.9   2.0   23    1-23      6-28  (159)
385 COG3267 ExeA Type II secretory  70.7     3.9 8.4E-05   30.8   2.4   16    1-16     56-71  (269)
386 PRK14262 phosphate ABC transpo  70.6     2.6 5.7E-05   29.5   1.4   19    1-19     34-52  (250)
387 cd03250 ABCC_MRP_domain1 Domai  70.6     2.7 5.8E-05   28.6   1.4   19    1-19     36-54  (204)
388 TIGR01187 potA spermidine/putr  70.6     3.5 7.7E-05   30.6   2.2   19    1-19      1-19  (325)
389 PRK14731 coaE dephospho-CoA ki  70.6     2.7 5.8E-05   29.2   1.5   18    1-18     10-27  (208)
390 PLN03046 D-glycerate 3-kinase;  70.6     3.3 7.1E-05   33.3   2.1   20    1-20    217-236 (460)
391 PRK13631 cbiO cobalt transport  70.6     2.6 5.6E-05   31.4   1.5   19    1-19     57-75  (320)
392 TIGR03754 conj_TOL_TraD conjug  70.5     5.4 0.00012   33.2   3.4   26    1-26    185-210 (643)
393 PRK13695 putative NTPase; Prov  70.4     3.6 7.8E-05   27.4   2.0   21    1-21      5-25  (174)
394 cd03254 ABCC_Glucan_exporter_l  70.3     2.8   6E-05   28.9   1.5   19    1-19     34-52  (229)
395 cd03237 ABC_RNaseL_inhibitor_d  70.2     2.8   6E-05   30.0   1.5   19    1-19     30-48  (246)
396 PRK14734 coaE dephospho-CoA ki  70.2     4.6 9.9E-05   28.1   2.5   18    1-18      6-23  (200)
397 PRK06526 transposase; Provisio  70.1     3.4 7.5E-05   30.0   2.0   22    1-22    103-124 (254)
398 PRK13632 cbiO cobalt transport  70.1     2.8   6E-05   30.1   1.5   19    1-19     40-58  (271)
399 PF14532 Sigma54_activ_2:  Sigm  70.1     1.3 2.7E-05   28.6  -0.3   18    1-18     26-43  (138)
400 cd03248 ABCC_TAP TAP, the Tran  70.0     2.9 6.2E-05   28.8   1.5   19    1-19     45-63  (226)
401 CHL00131 ycf16 sulfate ABC tra  70.0     2.4 5.3E-05   29.6   1.2   18    1-18     38-55  (252)
402 COG4240 Predicted kinase [Gene  70.0     4.1 8.9E-05   30.9   2.4   24    1-24     55-78  (300)
403 cd03222 ABC_RNaseL_inhibitor T  69.9     2.8   6E-05   28.9   1.4   19    1-19     30-48  (177)
404 PRK09544 znuC high-affinity zi  69.9     2.8   6E-05   29.9   1.4   18    1-18     35-52  (251)
405 PRK12339 2-phosphoglycerate ki  69.9     3.2 6.8E-05   29.1   1.7   20    1-20      8-27  (197)
406 PF13086 AAA_11:  AAA domain; P  69.8     3.5 7.6E-05   27.4   1.8   20    1-20     22-41  (236)
407 TIGR02236 recomb_radA DNA repa  69.7     3.4 7.4E-05   30.2   1.9   19    1-19    100-118 (310)
408 PRK10619 histidine/lysine/argi  69.7     2.8 6.2E-05   29.6   1.4   20    1-20     36-55  (257)
409 cd03215 ABC_Carb_Monos_II This  69.6     2.9 6.2E-05   28.1   1.4   18    1-18     31-48  (182)
410 PLN02748 tRNA dimethylallyltra  69.6     2.9 6.3E-05   33.4   1.6   20    1-20     27-46  (468)
411 PRK04296 thymidine kinase; Pro  69.6     3.7 8.1E-05   28.1   2.0   19    1-19      7-26  (190)
412 cd03221 ABCF_EF-3 ABCF_EF-3  E  69.6     2.8 6.1E-05   27.4   1.3   18    1-18     31-48  (144)
413 PRK14249 phosphate ABC transpo  69.4     2.9 6.3E-05   29.4   1.5   19    1-19     35-53  (251)
414 PRK00080 ruvB Holliday junctio  69.4     3.7 8.1E-05   30.3   2.1   20    1-20     56-75  (328)
415 PRK13650 cbiO cobalt transport  69.4     2.9 6.3E-05   30.2   1.4   19    1-19     38-56  (279)
416 PRK14266 phosphate ABC transpo  69.3       3 6.4E-05   29.2   1.5   18    1-18     34-51  (250)
417 PRK04301 radA DNA repair and r  69.3     3.4 7.4E-05   30.5   1.8   19    1-19    107-125 (317)
418 PRK13646 cbiO cobalt transport  69.3     2.9 6.3E-05   30.3   1.4   19    1-19     38-56  (286)
419 PF00406 ADK:  Adenylate kinase  69.3     4.4 9.6E-05   26.2   2.2   19    2-20      2-20  (151)
420 PTZ00424 helicase 45; Provisio  69.2     3.7   8E-05   30.5   2.0   19    2-20     71-89  (401)
421 PRK14259 phosphate ABC transpo  69.2     2.9 6.3E-05   30.0   1.4   19    1-19     44-62  (269)
422 cd03300 ABC_PotA_N PotA is an   69.2       3 6.5E-05   29.0   1.5   19    1-19     31-49  (232)
423 PRK10263 DNA translocase FtsK;  69.2     3.5 7.6E-05   37.1   2.1   22    1-22   1015-1036(1355)
424 TIGR03411 urea_trans_UrtD urea  69.1       3 6.6E-05   29.0   1.5   18    1-18     33-50  (242)
425 PRK03695 vitamin B12-transport  69.0     2.6 5.7E-05   29.8   1.1   18    1-18     27-44  (248)
426 cd00880 Era_like Era (E. coli   68.8     4.6 9.9E-05   24.4   2.1   19    1-19      1-19  (163)
427 PRK08116 hypothetical protein;  68.8     4.2 9.1E-05   29.6   2.2   23    1-23    119-141 (268)
428 cd03295 ABC_OpuCA_Osmoprotecti  68.8     3.1 6.7E-05   29.1   1.5   18    1-18     32-49  (242)
429 cd03288 ABCC_SUR2 The SUR doma  68.7     3.1 6.8E-05   29.5   1.5   19    1-19     52-70  (257)
430 cd03290 ABCC_SUR1_N The SUR do  68.7     3.1 6.7E-05   28.6   1.4   18    1-18     32-49  (218)
431 PRK00279 adk adenylate kinase;  68.7     3.9 8.4E-05   28.2   1.9   20    1-20      5-24  (215)
432 cd03251 ABCC_MsbA MsbA is an e  68.7     3.2 6.8E-05   28.7   1.5   18    1-18     33-50  (234)
433 TIGR03797 NHPM_micro_ABC2 NHPM  68.6     2.9 6.2E-05   33.8   1.4   20    1-20    484-503 (686)
434 PRK10771 thiQ thiamine transpo  68.6     3.1 6.6E-05   28.9   1.4   18    1-18     30-47  (232)
435 cd01122 GP4d_helicase GP4d_hel  68.5     3.8 8.3E-05   28.9   1.9   22    1-22     35-56  (271)
436 PRK03992 proteasome-activating  68.4     3.6 7.9E-05   31.4   1.9   19    2-20    171-189 (389)
437 PRK14243 phosphate transporter  68.4     3.2 6.9E-05   29.6   1.5   18    1-18     41-58  (264)
438 cd03228 ABCC_MRP_Like The MRP   68.3     3.3 7.1E-05   27.5   1.5   18    1-18     33-50  (171)
439 PRK00771 signal recognition pa  68.2     3.9 8.4E-05   32.3   2.0   23    1-23    100-122 (437)
440 PRK13853 type IV secretion sys  68.1       3 6.6E-05   34.8   1.5   18    1-18    431-448 (789)
441 TIGR02857 CydD thiol reductant  68.1     2.2 4.7E-05   33.3   0.6   20    1-20    353-372 (529)
442 PRK13642 cbiO cobalt transport  68.1     3.2 6.9E-05   29.9   1.4   20    1-20     38-57  (277)
443 PRK11160 cysteine/glutathione   68.0     2.3 4.9E-05   33.8   0.7   20    1-20    371-390 (574)
444 PRK13548 hmuV hemin importer A  68.0     3.2 6.8E-05   29.6   1.4   18    1-18     33-50  (258)
445 PRK11231 fecE iron-dicitrate t  68.0     3.2 6.9E-05   29.3   1.4   18    1-18     33-50  (255)
446 cd00882 Ras_like_GTPase Ras-li  67.9     5.2 0.00011   23.7   2.2   19    1-19      1-19  (157)
447 PRK05201 hslU ATP-dependent pr  67.8     3.9 8.4E-05   32.7   2.0   20    1-20     55-74  (443)
448 TIGR01188 drrA daunorubicin re  67.7     3.3 7.2E-05   30.2   1.5   19    1-19     24-42  (302)
449 PRK14531 adenylate kinase; Pro  67.6     4.4 9.5E-05   27.3   2.0   20    1-20      7-26  (183)
450 CHL00181 cbbX CbbX; Provisiona  67.6     5.5 0.00012   29.4   2.6   21    2-22     65-85  (287)
451 COG1220 HslU ATP-dependent pro  67.6     3.7 7.9E-05   32.7   1.7   18    1-18     55-72  (444)
452 cd01428 ADK Adenylate kinase (  67.5     4.1 8.8E-05   27.0   1.8   19    1-19      4-22  (194)
453 PRK09112 DNA polymerase III su  67.5     4.2   9E-05   31.0   2.0   23    1-23     50-72  (351)
454 PRK14272 phosphate ABC transpo  67.4     3.4 7.3E-05   28.9   1.4   19    1-19     35-53  (252)
455 cd03217 ABC_FeS_Assembly ABC-t  67.3     3.3 7.2E-05   28.3   1.4   19    1-19     31-49  (200)
456 COG0194 Gmk Guanylate kinase [  67.3     3.7 8.1E-05   29.4   1.6   20    1-20      9-28  (191)
457 PRK13649 cbiO cobalt transport  67.3     3.3 7.2E-05   29.7   1.4   19    1-19     38-56  (280)
458 PRK13652 cbiO cobalt transport  67.2     3.4 7.4E-05   29.8   1.4   18    1-18     35-52  (277)
459 PRK14961 DNA polymerase III su  67.2     4.4 9.5E-05   30.6   2.1   22    1-22     43-64  (363)
460 PRK10522 multidrug transporter  67.2     3.3 7.2E-05   32.6   1.5   20    1-20    354-373 (547)
461 PRK14236 phosphate transporter  67.2     3.5 7.6E-05   29.5   1.5   19    1-19     56-74  (272)
462 PRK10253 iron-enterobactin tra  67.2     3.1 6.8E-05   29.6   1.2   18    1-18     38-55  (265)
463 PRK15112 antimicrobial peptide  67.1     3.5 7.5E-05   29.5   1.5   19    1-19     44-62  (267)
464 TIGR03743 SXT_TraD conjugative  67.0     6.9 0.00015   32.2   3.3   26    1-26    181-206 (634)
465 TIGR01351 adk adenylate kinase  67.0     4.1 8.8E-05   28.0   1.7   19    1-19      4-22  (210)
466 PHA00729 NTP-binding motif con  67.0     4.5 9.7E-05   29.4   2.0   21    1-21     22-42  (226)
467 PRK13547 hmuV hemin importer A  67.0     3.4 7.4E-05   29.9   1.4   19    1-19     32-50  (272)
468 COG3604 FhlA Transcriptional r  66.8     3.8 8.2E-05   33.6   1.8   59    1-67    251-313 (550)
469 TIGR01242 26Sp45 26S proteasom  66.8     3.7   8E-05   30.8   1.6   19    2-20    162-180 (364)
470 COG2274 SunT ABC-type bacterio  66.8     3.9 8.4E-05   34.2   1.9   20    1-20    504-523 (709)
471 PF03668 ATP_bind_2:  P-loop AT  66.8     3.4 7.4E-05   31.2   1.4   16    1-16      6-21  (284)
472 cd03253 ABCC_ATM1_transporter   66.8     3.7 7.9E-05   28.4   1.5   18    1-18     32-49  (236)
473 PRK13640 cbiO cobalt transport  66.7     3.5 7.6E-05   29.8   1.4   20    1-20     38-57  (282)
474 PRK13636 cbiO cobalt transport  66.7     3.5 7.6E-05   29.8   1.4   19    1-19     37-55  (283)
475 smart00072 GuKc Guanylate kina  66.6     3.9 8.4E-05   27.6   1.6   19    1-19      7-25  (184)
476 PRK13644 cbiO cobalt transport  66.6     3.6 7.7E-05   29.7   1.4   18    1-18     33-50  (274)
477 PRK11153 metN DL-methionine tr  66.5     3.5 7.6E-05   30.9   1.4   19    1-19     36-54  (343)
478 PRK09694 helicase Cas3; Provis  66.4     5.1 0.00011   34.4   2.5   21    3-23    308-328 (878)
479 PF03266 NTPase_1:  NTPase;  In  66.4     4.5 9.7E-05   27.6   1.8   22    1-22      4-25  (168)
480 TIGR00635 ruvB Holliday juncti  66.4     4.5 9.7E-05   29.0   1.9   20    1-20     35-54  (305)
481 TIGR03873 F420-0_ABC_ATP propo  66.3     3.4 7.3E-05   29.2   1.3   18    1-18     32-49  (256)
482 COG5265 ATM1 ABC-type transpor  66.3     7.2 0.00016   31.6   3.2   22    2-23    295-316 (497)
483 PF01695 IstB_IS21:  IstB-like   66.3     4.5 9.7E-05   27.7   1.8   23    1-23     52-74  (178)
484 PRK14532 adenylate kinase; Pro  66.2     4.2 9.1E-05   27.2   1.7   20    1-20      5-24  (188)
485 PRK11144 modC molybdate transp  66.2     3.6 7.7E-05   31.0   1.4   18    1-18     29-46  (352)
486 PRK10261 glutathione transport  66.1     3.6 7.8E-05   33.2   1.5   19    1-19    355-373 (623)
487 PRK10851 sulfate/thiosulfate t  66.1     3.6 7.9E-05   31.1   1.5   19    1-19     33-51  (353)
488 KOG0058|consensus               66.1     4.3 9.4E-05   34.3   2.0   19    2-20    500-518 (716)
489 TIGR00958 3a01208 Conjugate Tr  66.0     3.2   7E-05   33.9   1.2   20    1-20    512-531 (711)
490 PRK13637 cbiO cobalt transport  65.9     3.7 8.1E-05   29.8   1.5   19    1-19     38-56  (287)
491 PTZ00265 multidrug resistance   65.7     4.3 9.2E-05   36.4   2.0   21    1-21   1199-1219(1466)
492 PF01656 CbiA:  CobQ/CobB/MinD/  65.7     5.7 0.00012   26.0   2.2   22    2-23      5-26  (195)
493 TIGR02397 dnaX_nterm DNA polym  65.7     4.8  0.0001   29.4   2.0   22    2-23     42-63  (355)
494 TIGR01194 cyc_pep_trnsptr cycl  65.7     2.5 5.4E-05   33.5   0.5   20    1-20    373-392 (555)
495 PRK14493 putative bifunctional  65.6     5.1 0.00011   29.6   2.2   23    1-23      6-28  (274)
496 TIGR03819 heli_sec_ATPase heli  65.6     3.2   7E-05   31.5   1.1   20    1-20    183-202 (340)
497 PRK00698 tmk thymidylate kinas  65.5     5.5 0.00012   26.6   2.1   22    1-22      8-29  (205)
498 TIGR01288 nodI ATP-binding ABC  65.5     3.8 8.3E-05   29.9   1.4   19    1-19     35-53  (303)
499 PRK13898 type IV secretion sys  65.3     3.7   8E-05   34.2   1.5   20    1-20    451-470 (800)
500 PRK09302 circadian clock prote  65.2     4.7  0.0001   31.6   2.0   22    1-22     36-57  (509)

No 1  
>PTZ00014 myosin-A; Provisional
Probab=99.93  E-value=1.2e-26  Score=189.94  Aligned_cols=74  Identities=34%  Similarity=0.458  Sum_probs=66.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+..      ...++++|+++  ||||||||||.+||||||||||++|+|+.+|.|
T Consensus       188 iSGESGAGKTe~tK~im~yla~~~~~~~------~~~ie~~Il~sNpiLEAFGNAKT~rNdNSSRFGKfi~i~F~~~g~i  261 (821)
T PTZ00014        188 VSGESGAGKTEATKQIMRYFASSKSGNM------DLKIQNAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLQLGEEGGI  261 (821)
T ss_pred             EEcCCCCCchHHHHHHHHHHHHhccCCC------cccHHHHHHHHHHHHHHhhccCcCCCCCcCcceeEEEEEEcCCCcE
Confidence            5799999999999999999998764321      15699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       262 ~G  263 (821)
T PTZ00014        262 RY  263 (821)
T ss_pred             ee
Confidence            76


No 2  
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=99.93  E-value=2.5e-26  Score=185.16  Aligned_cols=80  Identities=34%  Similarity=0.472  Sum_probs=68.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCccc--CccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNR--DTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENG   76 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~--~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g   76 (80)
                      |.|||||||||++|++|+||+..+.+....  .......++++|+++  ||||||||||.+|+||||||||++|+|+..|
T Consensus        96 iSGESGAGKTes~K~il~yLa~~~~~~~~~~~~~~~~~~i~~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~l~f~~~g  175 (693)
T cd01377          96 ITGESGAGKTENTKKVIQYLASVAASSKKKKQSGKGQGTLEDQILQANPILEAFGNAKTVRNDNSSRFGKFIRIHFGNTG  175 (693)
T ss_pred             EEcCCCCCchHHHHHHHHHHHhhcCCCCcccccccccccHHHHHHHHHHHHHHhhccccCCCCCccccceeEEEEECCCC
Confidence            579999999999999999999987643211  112236799999999  9999999999999999999999999999999


Q ss_pred             eecC
Q psy17057         77 MVHG   80 (80)
Q Consensus        77 ~l~G   80 (80)
                      +|.|
T Consensus       176 ~i~G  179 (693)
T cd01377         176 KIAG  179 (693)
T ss_pred             CEEE
Confidence            9876


No 3  
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=99.93  E-value=5.6e-26  Score=183.04  Aligned_cols=78  Identities=28%  Similarity=0.382  Sum_probs=68.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+.....  ......++++|+++  ||||||||+|.+|+||||||||++|+|+..|+|
T Consensus        91 iSGESGaGKTes~K~i~~yLa~~~~~~~~--~~~~~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  168 (691)
T cd01380          91 VSGESGAGKTVSAKYIMRYFASVGGSDSR--EVSETQVEEKVLASNPIMEAFGNAKTTRNDNSSRFGKYIQILFDKRGRI  168 (691)
T ss_pred             EEcCCCCCchHHHHHHHHHHHHhcCCCcc--cccccCHHHHHHHHHHHHHHhhcCCCCCCCCccccceEEEEEECCCCCE
Confidence            57999999999999999999988754211  11236799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       169 ~G  170 (691)
T cd01380         169 IG  170 (691)
T ss_pred             EE
Confidence            76


No 4  
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=99.92  E-value=7.6e-26  Score=182.39  Aligned_cols=75  Identities=49%  Similarity=0.602  Sum_probs=66.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....     ....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.|
T Consensus        99 isGESGAGKTet~K~il~yL~~~s~~~~-----~~~~i~~~i~~snpiLEAFGNAkT~~N~NSSRFGK~i~l~F~~~g~i  173 (692)
T cd01385          99 ISGESGSGKTESTNFLIHHLTALSQKGY-----AGSGVEQTILSAGPVLEAFGNAKTAHNNNSSRFGKFIQVNYRENGMV  173 (692)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhccCCc-----cCCcHHHHHHHHHHHHHHhhccccCCCCCccccceeEEEEECCCCCE
Confidence            5799999999999999999998764211     125699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       174 ~G  175 (692)
T cd01385         174 RG  175 (692)
T ss_pred             EE
Confidence            76


No 5  
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=99.92  E-value=8e-26  Score=181.76  Aligned_cols=72  Identities=35%  Similarity=0.541  Sum_probs=65.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+...        ..++++|+++  ||||||||+|.+|+||||||||++|+|+..|+|
T Consensus        91 isGESGaGKTes~K~i~~yLa~~s~~~--------~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~~~l~F~~~g~i  162 (671)
T cd01381          91 ISGESGAGKTESTKLILQYLAAISGKH--------SWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAI  162 (671)
T ss_pred             EEcCCCCCeehHHHHHHHHHHHhcCCC--------CcHHHHHHHHHHHHHHhhccccCCCCCccccceeEEEEECCCCcE
Confidence            479999999999999999999886421        4599999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       163 ~G  164 (671)
T cd01381         163 EG  164 (671)
T ss_pred             EE
Confidence            76


No 6  
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=99.92  E-value=1.2e-25  Score=190.00  Aligned_cols=76  Identities=34%  Similarity=0.510  Sum_probs=68.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||.+|.||+||+......    +.....++++|+++  ||||||||+|.+||||||||||++|.|+..|.|
T Consensus       157 ISGESGAGKTe~aK~ImqYlasv~~s~----~~~~~~iE~~ILaTNPILEAFGNAkTvRNdNSSRFGKyikI~Fd~~g~I  232 (1463)
T COG5022         157 ISGESGAGKTENAKRIMQYLASVTSSS----TVEISSIEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKIEFDENGEI  232 (1463)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhccCC----cchHHHHHHHHHhcchHHHHhccccccccCCcccccceEEEEECCCCce
Confidence            579999999999999999998876542    23457899999999  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       233 ~G  234 (1463)
T COG5022         233 CG  234 (1463)
T ss_pred             ec
Confidence            86


No 7  
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=99.92  E-value=2.5e-25  Score=179.15  Aligned_cols=71  Identities=35%  Similarity=0.551  Sum_probs=65.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+         ..++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.|
T Consensus        97 isGESGaGKTe~~K~i~~yLa~~~~~---------~~i~~~il~snpiLEaFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  167 (677)
T cd01383          97 ISGESGAGKTETAKIAMQYLASLGGG---------SGIEYEILQTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKI  167 (677)
T ss_pred             EecCCCCCcchHHHHHHHHHHhhCCC---------CcHHHHHHHHHHHHHHhhccccCCCCCcCccceeEEEEECCCCcE
Confidence            57999999999999999999987543         3589999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       168 ~g  169 (677)
T cd01383         168 SG  169 (677)
T ss_pred             EE
Confidence            76


No 8  
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=99.92  E-value=3.2e-25  Score=177.99  Aligned_cols=73  Identities=30%  Similarity=0.459  Sum_probs=66.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++++||+..+.+.       ...++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        91 isGESGsGKTet~K~l~~yL~~~~~~~-------~~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~i~l~f~~~g~i  163 (653)
T cd01379          91 ISGESGSGKTESAHLLVQQLTVLGKAN-------NRTLQEKILQVNSLVEAFGNARTGINDNSSRFGKYLEMKFTRSGAV  163 (653)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhcCCC-------CccHHHHHHHHHHHHHHhhccCcCCCCCcccceeEEEEEECCCCcE
Confidence            479999999999999999998775431       15699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       164 ~G  165 (653)
T cd01379         164 VG  165 (653)
T ss_pred             EE
Confidence            76


No 9  
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=99.91  E-value=4.7e-25  Score=178.37  Aligned_cols=72  Identities=40%  Similarity=0.521  Sum_probs=65.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+......        ..++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        96 isGESGaGKTes~K~il~yLa~~~~~~--------~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  167 (717)
T cd01382          96 VSGESGAGKTENTKFVLRYLTESYGSG--------QDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSV  167 (717)
T ss_pred             EecCCCCChhHHHHHHHHHHHhhccCC--------ccHHHHHHHHHHHHHHhhccccCCCCCcccceeEEEEEECCCCCE
Confidence            479999999999999999998765321        5699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       168 ~G  169 (717)
T cd01382         168 VG  169 (717)
T ss_pred             eE
Confidence            76


No 10 
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=99.91  E-value=4.7e-25  Score=177.51  Aligned_cols=76  Identities=30%  Similarity=0.416  Sum_probs=67.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.....    ....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.|
T Consensus        93 isGESGaGKTe~~K~il~yLa~~~~~~~~----~~~~i~~~il~~npiLEAFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  168 (674)
T cd01384          93 VSGESGAGKTETTKMLMRYLAYMGGRAGV----EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDDYGRI  168 (674)
T ss_pred             EECCCCCCchhHHHHHHHHHHhhcCCCCc----ccccHHHHHHHHHHHHHHhhCCCCCCCCCcchhheeEEEEECCCCcE
Confidence            46999999999999999999988643211    125799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       169 ~G  170 (674)
T cd01384         169 SG  170 (674)
T ss_pred             EE
Confidence            76


No 11 
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=99.91  E-value=7.6e-25  Score=178.30  Aligned_cols=74  Identities=22%  Similarity=0.260  Sum_probs=63.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....     . ....++|+++  ||||||||+|.+|+||||||||++|+|+..|.|
T Consensus        91 iSGESGAGKTe~tK~i~~yla~~~~~~~-----~-~~~~e~i~~~npiLEAFGNAkT~rNdNSSRFGK~i~l~F~~~g~i  164 (767)
T cd01386          91 FLGRSGAGKTTSCKHALEYLALAAGSVD-----G-RVSVEKVRALFTILEAFGNVSTALNGNATRFTQILSLDFDQTGQI  164 (767)
T ss_pred             EecCCCCCcHHHHHHHHHHHHhccCCCC-----c-ccHHHHHHhhchHHHHhhccCcCCCCCcCcceeEEEEEECCCCcE
Confidence            5799999999999999999998764311     0 1224578888  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       165 ~G  166 (767)
T cd01386         165 AS  166 (767)
T ss_pred             eE
Confidence            76


No 12 
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=99.91  E-value=1.1e-24  Score=174.79  Aligned_cols=73  Identities=37%  Similarity=0.514  Sum_probs=66.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+...       ...++++|+.+  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        91 isGESGaGKTe~~k~il~yl~~~~~~~-------~~~i~~~i~~~n~iLEaFGNAkT~~N~NSSRfGk~~~l~f~~~g~i  163 (679)
T cd00124          91 ISGESGAGKTENTKLIMKYLASLAGSN-------DTGIEEKILAANPILEAFGNAKTVRNNNSSRFGKFIELQFDETGKI  163 (679)
T ss_pred             EecCCCCCchHHHHHHHHHHHhccCCC-------cchHHHHHHHHhHHHHHhcccccCCCCCcccceeEEEEEECCCCcE
Confidence            579999999999999999999887542       25699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       164 ~g  165 (679)
T cd00124         164 SG  165 (679)
T ss_pred             eE
Confidence            76


No 13 
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=99.91  E-value=1.1e-24  Score=175.16  Aligned_cols=75  Identities=32%  Similarity=0.457  Sum_probs=66.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....     ....++++|+++  ||||||||+|.+|+||||||||++|+|+..|.+
T Consensus        91 isGESGaGKTe~~K~il~yL~~~~~~~~-----~~~~i~~~i~~~npiLEAFGNAkT~~N~NSSRFgk~~~l~f~~~g~i  165 (674)
T cd01378          91 ISGESGAGKTEAAKKIMQYIAAVSGGGQ-----KVERVKDVILQSNPLLEAFGNAKTLRNNNSSRFGKYMEIQFDFKGDP  165 (674)
T ss_pred             EEcCCCCCcchHHHHHHHHHHhcCCCCC-----ccccHHHHHHHHHHHHHHhhccccCCCCCcchhheeEEEEECCCCCE
Confidence            4799999999999999999998865421     135699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       166 ~g  167 (674)
T cd01378         166 VG  167 (674)
T ss_pred             ee
Confidence            76


No 14 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=99.90  E-value=2.1e-24  Score=173.46  Aligned_cols=75  Identities=33%  Similarity=0.476  Sum_probs=67.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++++||+..+.+..     ....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        97 isGESGaGKTe~~k~il~yl~~~~~~~~-----~~~~i~~~i~~~n~iLEAFGNAkT~~N~NSSRfgk~~~l~f~~~g~i  171 (677)
T smart00242       97 ISGESGAGKTENTKKIMQYLAAVSGSNT-----SVGSVEDQILESNPILEAFGNAKTVRNNNSSRFGKFIEIHFDAKGKI  171 (677)
T ss_pred             EecCCCCcchHHHHHHHHHHHhhcCCCC-----ccccHHHHHHHHHHHHHHhhccccCCCCCccchheeEEEEECCCCcE
Confidence            4799999999999999999998875421     136799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       172 ~g  173 (677)
T smart00242      172 VG  173 (677)
T ss_pred             eE
Confidence            76


No 15 
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=99.90  E-value=3.8e-24  Score=172.23  Aligned_cols=72  Identities=36%  Similarity=0.561  Sum_probs=64.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+.       ...++++|+++  ||||||||+|.+|+||||||||++|+|+ +|.|
T Consensus        92 isGESGaGKTe~~k~il~yl~~~~~~~-------~~~i~~~il~snpiLEAFGNAkT~~N~NSSRfGk~~~l~f~-~g~i  163 (677)
T cd01387          92 ISGESGSGKTEATKLILRYLAAMNQGG-------SAVITEQILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLE-GGVI  163 (677)
T ss_pred             EEcCCCCCeehHHHHHHHHHHhhcCCC-------cchHHHHHHHHHHHHHHHhCcCCCCCCCccccceEEEEEec-CCcE
Confidence            469999999999999999999886542       14699999999  9999999999999999999999999995 6887


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       164 ~G  165 (677)
T cd01387         164 VG  165 (677)
T ss_pred             eE
Confidence            65


No 16 
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=99.89  E-value=9.1e-24  Score=168.54  Aligned_cols=77  Identities=34%  Similarity=0.501  Sum_probs=68.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.....   .....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.+
T Consensus        90 isGeSGsGKTe~~k~il~~L~~~~~~~~~---~~~~~i~~~i~~~~~iLeaFGnAkT~~N~nSSRfgk~~~l~f~~~~~~  166 (689)
T PF00063_consen   90 ISGESGSGKTETSKLILRYLASLSSSSSS---SKSSSIEKKILAANPILEAFGNAKTPRNDNSSRFGKFIELQFDDSGQI  166 (689)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHHHSSSSSS---TCTTHHHHHHHHHHHHHHHHHEEEESSETTEESSEEEEEEEEETTSSE
T ss_pred             eccccccccccchHHHHHHHhhhcccccc---cccccccceEEeccchhhhhcccccccCCcccccceEEEEEecccccc
Confidence            47999999999999999999998765321   2236799999998  999999999999999999999999999999988


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       167 ~g  168 (689)
T PF00063_consen  167 VG  168 (689)
T ss_dssp             EE
T ss_pred             cc
Confidence            75


No 17 
>KOG0163|consensus
Probab=99.88  E-value=2.5e-23  Score=170.00  Aligned_cols=72  Identities=42%  Similarity=0.619  Sum_probs=65.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      +.|||||||||.+|++|+||+.. .+.       ...++++|+.+  ||||||||||++|+||||||||++|||+..|.+
T Consensus       149 VSGESGAGKTEstK~vLrYLces-~gs-------ag~Iq~rileaNPiLEAFGNAKT~RNNNSSRFGKFveiHf~dk~~V  220 (1259)
T KOG0163|consen  149 VSGESGAGKTESTKAVLRYLCES-WGS-------AGPIQTRILEANPILEAFGNAKTLRNNNSSRFGKFVEIHFDDKGQV  220 (1259)
T ss_pred             EecCCCCCcchhHHHHHHHHHhc-cCC-------CCcHHHHHhccChHHHHhccchhhccCChhhccceEEEEEcCCCce
Confidence            36999999999999999998764 332       26799999999  999999999999999999999999999999988


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       221 vG  222 (1259)
T KOG0163|consen  221 VG  222 (1259)
T ss_pred             ec
Confidence            76


No 18 
>KOG0164|consensus
Probab=99.88  E-value=3.4e-23  Score=168.13  Aligned_cols=77  Identities=29%  Similarity=0.451  Sum_probs=66.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+|+++..+..-   ......+..+++++  ||||||||||.+||||||||||+.|+||-.|--
T Consensus        99 ISGESGAGKTEASK~iMqYiAAvtn~~q---q~eierVKn~LLqSN~VLEAFGNAKT~RNdNSSRFGKYMDInFDfKGdP  175 (1001)
T KOG0164|consen   99 ISGESGAGKTEASKIIMQYIAAVTNASQ---QGEIERVKNVLLQSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDP  175 (1001)
T ss_pred             EecCCCCCccHHHHHHHHHHHHhcCccc---cchHHHHHHHHHhcchHHHHhcccccccCCchhhhhcceeeeccccCCc
Confidence            6799999999999999999998876531   12246788999999  999999999999999999999999999988765


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       176 vG  177 (1001)
T KOG0164|consen  176 VG  177 (1001)
T ss_pred             cc
Confidence            44


No 19 
>KOG0161|consensus
Probab=99.84  E-value=1.9e-21  Score=168.64  Aligned_cols=79  Identities=34%  Similarity=0.492  Sum_probs=68.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||.+|-|++||+........ +.+....++.+|+++  +|||||||+|.+|+|||||||||+|+|+.+|+|
T Consensus       173 iTGESGAGKTeNTKkVIqyla~va~~~~~-~~~~~~~le~qi~q~npvLeaFGNa~tvrn~NssRFgkfirI~F~~~G~i  251 (1930)
T KOG0161|consen  173 ITGESGAGKTENTKKVIQYLASVASSSTK-KVKIEGTLEDQILQANPVLEAFGNAKTVRNDNSSRFGKFIRIHFDATGKI  251 (1930)
T ss_pred             eecCCCCCcchhHHHHHHHHHHHhhcccc-CCCCCCChHHHHHHhCchHHHhcChhhhcCCCCcccceeEEEecCCCCcc
Confidence            57999999999999999999887765321 112126899999999  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       252 ~~  253 (1930)
T KOG0161|consen  252 AG  253 (1930)
T ss_pred             ch
Confidence            76


No 20 
>KOG0162|consensus
Probab=99.83  E-value=3.1e-21  Score=157.30  Aligned_cols=74  Identities=30%  Similarity=0.472  Sum_probs=65.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||.+|.||+|..+.|.+.     .....+.+.||++  +||+||||+|++|+||||||||+||+|+..|.-
T Consensus       109 ISGESGAGKT~aAK~IM~YIs~vS~~g-----~kvq~vkdiiL~sNPLLEaFG~akTvRNnNSSR~GKY~Ei~Fs~ggeP  183 (1106)
T KOG0162|consen  109 ISGESGAGKTVAAKRIMQYISRVSGGG-----EKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYLEIQFSRGGEP  183 (1106)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhccCC-----cchhhhhhHhhccchHHHHhcchhhhccCCcccccceEEEEecCCCCc
Confidence            579999999999999999999988542     1247799999999  999999999999999999999999999987654


Q ss_pred             c
Q psy17057         79 H   79 (80)
Q Consensus        79 ~   79 (80)
                      .
T Consensus       184 ~  184 (1106)
T KOG0162|consen  184 D  184 (1106)
T ss_pred             C
Confidence            3


No 21 
>KOG0160|consensus
Probab=99.79  E-value=2e-20  Score=153.89  Aligned_cols=74  Identities=30%  Similarity=0.434  Sum_probs=67.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      +.||||||||+++|++|+||+.....      .....+|++++.+  ++|+||||+|.+|+||||||||++|+|+..|+|
T Consensus        99 vsGESGAgkT~~aK~~m~yla~v~~~------~~~~~vE~~vL~snpi~EafgNakT~rndnsSrFgK~iei~Fd~~~~I  172 (862)
T KOG0160|consen   99 VSGESGAGKTETAKYLMEYLASVGGS------VEGRSIENKVLASNPILEAFGNAKTTRNDNSSRFGKVIEITFDQQGRI  172 (862)
T ss_pred             eeCCCCCchhHHHHHHHHHHHHHhcc------chhhHHHHHHHhcCCcchhhccchhhhcccHHHhhhHHHHhhhhhccc
Confidence            47999999999999999999888653      1237899999998  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       173 ~G  174 (862)
T KOG0160|consen  173 SG  174 (862)
T ss_pred             cc
Confidence            86


No 22 
>KOG4229|consensus
Probab=99.58  E-value=1.1e-15  Score=128.17  Aligned_cols=73  Identities=38%  Similarity=0.594  Sum_probs=66.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.||||+||||.++++++||+.++.+.       ..++++.|+.+  +||+||||+|.+|+||||||||++++|..+|.+
T Consensus       153 isGesgsGktest~l~~~~Ls~Lsq~~-------~~~~e~~il~a~~llEafgnA~t~~ndnssrfgk~i~~~~~~~g~i  225 (1062)
T KOG4229|consen  153 ISGESGSGKTESTKLLWQFLSILSQGN-------NSPVEQLILSANPLLEAFGNAKTPRNDNSSRFGKYIKVNFRKTGII  225 (1062)
T ss_pred             EecccCCCCchhhHHHHHHHHHHhcCC-------CCchhhhhhcchHHHHHhcccCCcccCchhhhhheEEeccccCCCC
Confidence            469999999999999999999998531       26789999998  999999999999999999999999999999988


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       226 ~G  227 (1062)
T KOG4229|consen  226 EG  227 (1062)
T ss_pred             Cc
Confidence            76


No 23 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=97.06  E-value=0.00022  Score=49.08  Aligned_cols=30  Identities=27%  Similarity=0.204  Sum_probs=25.3

Q ss_pred             HHHHhc-CccccCCCCCCCccceEEEEeCCC
Q psy17057         46 WFQAFG-NAKTAHNNNSSRFGKFIQVNYKEN   75 (80)
Q Consensus        46 ileafG-nAkT~~n~nSSrfGk~~~l~f~~~   75 (80)
                      ..+++. ++.|..|++|||+..+++|++...
T Consensus        64 ~g~~~R~~~~t~~N~~SSRsH~i~~i~v~~~   94 (186)
T cd01363          64 KGNANRTTAATAMNEHSSRSHSVFRIHFGGK   94 (186)
T ss_pred             hccccccccccCCCCccCcccEEEEEEEEEe
Confidence            444677 899999999999999999998643


No 24 
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=94.82  E-value=0.019  Score=39.40  Aligned_cols=21  Identities=24%  Similarity=0.298  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||.|||++++.+.++|-
T Consensus         8 l~GpsGvGKT~la~~la~~l~   28 (171)
T PF07724_consen    8 LAGPSGVGKTELAKALAELLF   28 (171)
T ss_dssp             EESSTTSSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            479999999999999999887


No 25 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=94.29  E-value=0.027  Score=35.00  Aligned_cols=20  Identities=15%  Similarity=0.157  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||.+++.+...+
T Consensus         4 I~G~~gsGKST~a~~La~~~   23 (121)
T PF13207_consen    4 ISGPPGSGKSTLAKELAERL   23 (121)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            57999999999999998864


No 26 
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=94.01  E-value=0.024  Score=43.21  Aligned_cols=21  Identities=14%  Similarity=0.237  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.||||+|||.+.+-||..|-
T Consensus        36 iVGESGsGKS~~~~aim~llp   56 (316)
T COG0444          36 IVGESGSGKSVLAKAIMGLLP   56 (316)
T ss_pred             EEcCCCCCHHHHHHHHHhccC
Confidence            469999999999999999763


No 27 
>PF12846 AAA_10:  AAA-like domain
Probab=93.94  E-value=0.046  Score=38.16  Aligned_cols=26  Identities=23%  Similarity=0.167  Sum_probs=22.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFG   26 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~   26 (80)
                      |.|+||+|||.+.+.++..++.....
T Consensus         6 i~G~tGsGKT~~~~~l~~~~~~~g~~   31 (304)
T PF12846_consen    6 ILGKTGSGKTTLLKNLLEQLIRRGPR   31 (304)
T ss_pred             EECCCCCcHHHHHHHHHHHHHHcCCC
Confidence            57999999999999999888776654


No 28 
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=93.64  E-value=0.055  Score=38.33  Aligned_cols=21  Identities=29%  Similarity=0.275  Sum_probs=18.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|||||-+++.+...|.
T Consensus         4 I~G~sGSGKTTla~~L~~~l~   24 (220)
T cd02025           4 IAGSVAVGKSTTARVLQALLS   24 (220)
T ss_pred             eeCCCCCCHHHHHHHHHHHHh
Confidence            689999999999999988774


No 29 
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=93.40  E-value=0.046  Score=37.38  Aligned_cols=22  Identities=23%  Similarity=0.256  Sum_probs=19.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.||||||-+++.+...|-.
T Consensus         4 I~G~sgSGKTTla~~L~~~L~~   25 (194)
T PF00485_consen    4 IAGPSGSGKTTLAKRLAQILNK   25 (194)
T ss_dssp             EEESTTSSHHHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHhCc
Confidence            6899999999999999888853


No 30 
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=93.20  E-value=0.061  Score=37.24  Aligned_cols=22  Identities=14%  Similarity=0.111  Sum_probs=19.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||+|||-+.+.++.++..
T Consensus         6 I~GptGSGKTTll~~ll~~~~~   27 (198)
T cd01131           6 VTGPTGSGKSTTLAAMIDYINK   27 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHhhh
Confidence            5899999999999988888753


No 31 
>PRK05480 uridine/cytidine kinase; Provisional
Probab=93.09  E-value=0.065  Score=36.84  Aligned_cols=20  Identities=25%  Similarity=0.262  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||-+++.+.+.+
T Consensus        11 I~G~sGsGKTTl~~~l~~~l   30 (209)
T PRK05480         11 IAGGSGSGKTTVASTIYEEL   30 (209)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            58999999999999999887


No 32 
>PTZ00301 uridine kinase; Provisional
Probab=92.85  E-value=0.076  Score=37.70  Aligned_cols=20  Identities=15%  Similarity=0.298  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |||.||||||-.++.+.+.|
T Consensus         8 IaG~SgSGKTTla~~l~~~l   27 (210)
T PTZ00301          8 ISGASGSGKSSLSTNIVSEL   27 (210)
T ss_pred             EECCCcCCHHHHHHHHHHHH
Confidence            69999999999998887665


No 33 
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=92.73  E-value=0.077  Score=36.09  Aligned_cols=20  Identities=25%  Similarity=0.272  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|+|||.+.+.+...+
T Consensus         4 i~G~~GsGKSTl~~~l~~~l   23 (198)
T cd02023           4 IAGGSGSGKTTVAEEIIEQL   23 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            57999999999999998876


No 34 
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=92.63  E-value=0.077  Score=35.40  Aligned_cols=20  Identities=15%  Similarity=0.052  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||||||.+.+.+...+
T Consensus         6 i~G~sGsGKttl~~~l~~~~   25 (179)
T TIGR02322         6 VVGPSGAGKDTLLDYARARL   25 (179)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            57999999999999887764


No 35 
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=92.51  E-value=0.079  Score=32.61  Aligned_cols=20  Identities=20%  Similarity=0.120  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+.+.+
T Consensus         3 i~G~~GsGKtTia~~L~~~~   22 (129)
T PF13238_consen    3 ISGIPGSGKTTIAKELAERL   22 (129)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            47999999999999998885


No 36 
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=92.39  E-value=0.095  Score=33.21  Aligned_cols=20  Identities=15%  Similarity=0.189  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|+|||.+++.+...+
T Consensus         4 i~G~~GsGKst~a~~la~~~   23 (147)
T cd02020           4 IDGPAGSGKSTVAKLLAKKL   23 (147)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            57999999999999887754


No 37 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=92.28  E-value=0.074  Score=31.83  Aligned_cols=23  Identities=17%  Similarity=0.088  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+.+.++..+...
T Consensus         7 l~G~~G~GKTtl~~~l~~~~~~~   29 (148)
T smart00382        7 IVGPPGSGKTTLARALARELGPP   29 (148)
T ss_pred             EECCCCCcHHHHHHHHHhccCCC
Confidence            46999999999999998877554


No 38 
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=92.27  E-value=0.12  Score=32.56  Aligned_cols=22  Identities=27%  Similarity=0.286  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.+...++..+..
T Consensus         4 i~G~~G~GKT~l~~~i~~~~~~   25 (165)
T cd01120           4 VFGPTGSGKTTLALQLALNIAT   25 (165)
T ss_pred             EeCCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999999887754


No 39 
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=91.97  E-value=0.1  Score=35.65  Aligned_cols=22  Identities=32%  Similarity=0.360  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.||+|||.+.+-++..|+.
T Consensus        43 i~G~tgsGKS~~l~~ll~~l~~   64 (205)
T PF01580_consen   43 IAGATGSGKSTLLRTLLLSLAL   64 (205)
T ss_dssp             EE--TTSSHHHHHHHHHHHHHT
T ss_pred             EEcCCCCCccHHHHHHHHHHHH
Confidence            5799999999999999888877


No 40 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=91.82  E-value=0.13  Score=31.25  Aligned_cols=21  Identities=19%  Similarity=0.199  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|++|+|||.+.+.+...+.
T Consensus        24 i~G~~G~GKT~l~~~i~~~~~   44 (151)
T cd00009          24 LYGPPGTGKTTLARAIANELF   44 (151)
T ss_pred             EECCCCCCHHHHHHHHHHHhh
Confidence            359999999999999998774


No 41 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=91.45  E-value=0.18  Score=31.15  Aligned_cols=19  Identities=21%  Similarity=0.176  Sum_probs=17.6

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||.+.+.+.+++
T Consensus         4 ~G~~G~GKT~l~~~la~~l   22 (132)
T PF00004_consen    4 HGPPGTGKTTLARALAQYL   22 (132)
T ss_dssp             ESSTTSSHHHHHHHHHHHT
T ss_pred             ECcCCCCeeHHHHHHHhhc
Confidence            4999999999999999986


No 42 
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=91.33  E-value=0.15  Score=34.91  Aligned_cols=21  Identities=29%  Similarity=0.246  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||+|||-.++.+...|.
T Consensus         4 i~G~sgsGKttla~~l~~~l~   24 (179)
T cd02028           4 IAGPSGSGKTTFAKKLSNQLR   24 (179)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            589999999999999988874


No 43 
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=91.26  E-value=0.17  Score=30.39  Aligned_cols=23  Identities=35%  Similarity=0.338  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+....+..+...
T Consensus         5 i~~~~G~GKT~~~~~~~~~~~~~   27 (144)
T cd00046           5 LAAPTGSGKTLAALLPILELLDS   27 (144)
T ss_pred             EECCCCCchhHHHHHHHHHHHhc
Confidence            46899999999998888877654


No 44 
>PRK00300 gmk guanylate kinase; Provisional
Probab=91.20  E-value=0.12  Score=35.10  Aligned_cols=20  Identities=15%  Similarity=0.144  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||.+.+.++..+
T Consensus        10 i~G~sGsGKstl~~~l~~~~   29 (205)
T PRK00300         10 LSGPSGAGKSTLVKALLERD   29 (205)
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            46999999999999998865


No 45 
>TIGR01587 cas3_core CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.
Probab=91.19  E-value=0.37  Score=35.41  Aligned_cols=21  Identities=24%  Similarity=0.127  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.++||+|||++.-+.+.+.+
T Consensus         4 i~apTGsGKT~~~~~~~l~~~   24 (358)
T TIGR01587         4 IEAPTGYGKTEAALLWALHSI   24 (358)
T ss_pred             EEeCCCCCHHHHHHHHHHHHH
Confidence            358999999999887766554


No 46 
>PRK06696 uridine kinase; Validated
Probab=91.12  E-value=0.16  Score=35.57  Aligned_cols=21  Identities=24%  Similarity=0.189  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||||||-.++.+...|-
T Consensus        27 I~G~sgsGKSTlA~~L~~~l~   47 (223)
T PRK06696         27 IDGITASGKTTFADELAEEIK   47 (223)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            689999999999999988873


No 47 
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=91.09  E-value=0.14  Score=33.08  Aligned_cols=21  Identities=29%  Similarity=0.278  Sum_probs=17.0

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      .++||+|||.+...++..+..
T Consensus        31 ~~~tGsGKT~~~~~~~~~l~~   51 (184)
T PF04851_consen   31 NAPTGSGKTIIALALILELAR   51 (184)
T ss_dssp             EESTTSSHHHHHHHHHHHHHC
T ss_pred             EECCCCCcChhhhhhhhcccc
Confidence            478999999999976666655


No 48 
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=91.04  E-value=0.14  Score=37.48  Aligned_cols=22  Identities=27%  Similarity=0.326  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+||+|||..-+.++.++.+
T Consensus        18 iIG~sGSGKT~li~~lL~~~~~   39 (241)
T PF04665_consen   18 IIGKSGSGKTTLIKSLLYYLRH   39 (241)
T ss_pred             EECCCCCCHHHHHHHHHHhhcc
Confidence            5799999999999999987744


No 49 
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=90.97  E-value=0.19  Score=29.32  Aligned_cols=20  Identities=15%  Similarity=0.152  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||...+.+...|
T Consensus         4 i~G~~gsGKst~~~~l~~~l   23 (69)
T cd02019           4 ITGGSGSGKSTVAKKLAEQL   23 (69)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999988876


No 50 
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=90.70  E-value=0.16  Score=37.08  Aligned_cols=22  Identities=27%  Similarity=0.144  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|+||+|||.+.+.++.++..
T Consensus        85 isG~tGSGKTT~l~all~~i~~  106 (264)
T cd01129          85 VTGPTGSGKTTTLYSALSELNT  106 (264)
T ss_pred             EECCCCCcHHHHHHHHHhhhCC
Confidence            5899999999999998888743


No 51 
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=90.60  E-value=0.17  Score=38.64  Aligned_cols=22  Identities=18%  Similarity=0.279  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||||||-+-+.++.++..
T Consensus       139 I~GpTGSGKTTtL~aLl~~i~~  160 (358)
T TIGR02524       139 ITGATGSGKSTLLAAIIRELAE  160 (358)
T ss_pred             EECCCCCCHHHHHHHHHHHHhh
Confidence            5799999999999999998754


No 52 
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=90.44  E-value=0.2  Score=34.58  Aligned_cols=21  Identities=19%  Similarity=0.127  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||||||-..+.+...+-
T Consensus        11 I~G~sGsGKSTl~~~l~~~l~   31 (207)
T TIGR00235        11 IGGGSGSGKTTVARKIYEQLG   31 (207)
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            579999999999999887653


No 53 
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=90.23  E-value=0.14  Score=36.55  Aligned_cols=23  Identities=26%  Similarity=0.239  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |+|++|+|||.+.+.++.++-..
T Consensus       132 i~G~tGSGKTT~l~all~~i~~~  154 (270)
T PF00437_consen  132 ISGPTGSGKTTLLNALLEEIPPE  154 (270)
T ss_dssp             EEESTTSSHHHHHHHHHHHCHTT
T ss_pred             EECCCccccchHHHHHhhhcccc
Confidence            57999999999999998876444


No 54 
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=90.12  E-value=0.2  Score=37.25  Aligned_cols=21  Identities=24%  Similarity=0.262  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|+|||.+.+.++.++.
T Consensus       137 I~G~tGSGKTTll~al~~~i~  157 (299)
T TIGR02782       137 VVGGTGSGKTTLANALLAEIA  157 (299)
T ss_pred             EECCCCCCHHHHHHHHHHHhh
Confidence            589999999999999988764


No 55 
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=90.07  E-value=0.2  Score=32.65  Aligned_cols=20  Identities=20%  Similarity=0.230  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||.+++.+...|
T Consensus         5 i~G~~GSGKstia~~la~~l   24 (171)
T TIGR02173         5 ISGPPGSGKTTVAKILAEKL   24 (171)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            47999999999999887644


No 56 
>PRK08233 hypothetical protein; Provisional
Probab=90.06  E-value=0.18  Score=33.16  Aligned_cols=21  Identities=19%  Similarity=0.056  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|+|||-.++.+..+|.
T Consensus         8 I~G~~GsGKtTla~~L~~~l~   28 (182)
T PRK08233          8 IAAVSGGGKTTLTERLTHKLK   28 (182)
T ss_pred             EECCCCCCHHHHHHHHHhhCC
Confidence            579999999999999888773


No 57 
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=89.84  E-value=0.24  Score=36.04  Aligned_cols=21  Identities=24%  Similarity=0.102  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||-||||||-.++.+...|-
T Consensus        13 IaG~SgSGKTTva~~l~~~~~   33 (218)
T COG0572          13 IAGGSGSGKTTVAKELSEQLG   33 (218)
T ss_pred             EeCCCCCCHHHHHHHHHHHhC
Confidence            699999999999999988765


No 58 
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=89.66  E-value=0.2  Score=34.17  Aligned_cols=20  Identities=25%  Similarity=0.331  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|||||-+.+.++..+
T Consensus        30 I~G~tGSGKTTll~aL~~~i   49 (186)
T cd01130          30 ISGGTGSGKTTLLNALLAFI   49 (186)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            47999999999999887654


No 59 
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=89.65  E-value=0.23  Score=38.27  Aligned_cols=22  Identities=14%  Similarity=0.107  Sum_probs=19.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||+|||.+.+-++.|+..
T Consensus       154 I~G~TGSGKTT~l~al~~~i~~  175 (372)
T TIGR02525       154 ICGETGSGKSTLAASIYQHCGE  175 (372)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            5899999999999999998854


No 60 
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=89.63  E-value=0.22  Score=37.37  Aligned_cols=21  Identities=14%  Similarity=0.089  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||||||-+-+.++.++-
T Consensus       127 i~G~tGSGKTT~l~al~~~i~  147 (343)
T TIGR01420       127 VTGPTGSGKSTTLASMIDYIN  147 (343)
T ss_pred             EECCCCCCHHHHHHHHHHhhC
Confidence            579999999999999888764


No 61 
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=89.58  E-value=0.19  Score=32.68  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=15.0

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      +.|+||+|||.+.++++
T Consensus        20 I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          20 ITGDSGIGKTELALELI   36 (107)
T ss_pred             EEcCCCCCHHHHHHHhh
Confidence            46999999999999875


No 62 
>PRK06762 hypothetical protein; Provisional
Probab=89.45  E-value=0.27  Score=32.32  Aligned_cols=20  Identities=20%  Similarity=0.160  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||..++.+.+++
T Consensus         7 i~G~~GsGKST~A~~L~~~l   26 (166)
T PRK06762          7 IRGNSGSGKTTIAKQLQERL   26 (166)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999988876


No 63 
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=89.39  E-value=0.31  Score=32.19  Aligned_cols=22  Identities=32%  Similarity=0.384  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|++|+|||.++..++...+.
T Consensus         4 i~G~~G~GKT~l~~~~~~~~~~   25 (187)
T cd01124           4 LSGGPGTGKTTFALQFLYAGLA   25 (187)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHH
Confidence            5799999999988877776554


No 64 
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=89.14  E-value=0.24  Score=30.83  Aligned_cols=22  Identities=18%  Similarity=0.090  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +-|++|+|||.+.+.+++-+..
T Consensus         9 i~G~~G~GKT~~~~~~~~~~~~   30 (131)
T PF13401_consen    9 ISGPPGSGKTTLIKRLARQLNA   30 (131)
T ss_dssp             EEE-TTSSHHHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHhHH
Confidence            3599999999999999887654


No 65 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=89.09  E-value=0.37  Score=33.36  Aligned_cols=20  Identities=35%  Similarity=0.252  Sum_probs=18.7

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|.||+|||.+.+.++..+.
T Consensus        29 ~G~TGsGKS~~~~~ll~~l~   48 (229)
T PF01935_consen   29 FGTTGSGKSNTVKVLLEELL   48 (229)
T ss_pred             ECCCCCCHHHHHHHHHHHHH
Confidence            48999999999999999988


No 66 
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=89.04  E-value=0.25  Score=33.77  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|+||+|||+.+...++.
T Consensus        19 i~G~sG~GKStlal~L~~~   37 (149)
T cd01918          19 ITGPSGIGKSELALELIKR   37 (149)
T ss_pred             EEcCCCCCHHHHHHHHHHc
Confidence            4699999999999766664


No 67 
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=89.00  E-value=0.27  Score=34.43  Aligned_cols=20  Identities=25%  Similarity=0.361  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||-.++.+...+
T Consensus         4 i~G~sgsGKTtla~~l~~~~   23 (187)
T cd02024           4 ISGVTNSGKTTLAKLLQRIL   23 (187)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            68999999999999998876


No 68 
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=88.91  E-value=0.17  Score=41.10  Aligned_cols=23  Identities=17%  Similarity=0.307  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |-||||||||.+...++.+|-..
T Consensus        40 IvGESGsGKSt~a~~i~gll~~~   62 (539)
T COG1123          40 IVGESGSGKSTLALALMGLLPEG   62 (539)
T ss_pred             EEcCCCCCHHHHHHHHhccCCCC
Confidence            45999999999999999877443


No 69 
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]
Probab=88.86  E-value=0.23  Score=39.68  Aligned_cols=61  Identities=18%  Similarity=0.258  Sum_probs=35.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH-HHHH--hcCccc-cCCCCCCCccceEE
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA-WFQA--FGNAKT-AHNNNSSRFGKFIQ   69 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s-ilea--fGnAkT-~~n~nSSrfGk~~~   69 (80)
                      |.||||.||-..++.|=.    .|.    +..++.-.|....+.. ++|+  ||..|= ..-.+.+|.|+|-.
T Consensus       169 I~GESGtGKElvAr~IH~----~S~----R~~~PFVavNcaAip~~l~ESELFGhekGAFTGA~~~r~G~fE~  233 (464)
T COG2204         169 ITGESGTGKELVARAIHQ----ASP----RAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQ  233 (464)
T ss_pred             EECCCCCcHHHHHHHHHh----hCc----ccCCCceeeecccCCHHHHHHHhhcccccCcCCcccccCcceeE
Confidence            569999999999987722    122    1122222233322223 5664  998873 33455788898854


No 70 
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=88.83  E-value=0.23  Score=32.55  Aligned_cols=20  Identities=15%  Similarity=0.180  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||...+.+++.+
T Consensus         4 i~GpsGsGKstl~~~L~~~~   23 (137)
T cd00071           4 LSGPSGVGKSTLLKRLLEEF   23 (137)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            46999999999999988864


No 71 
>PRK04182 cytidylate kinase; Provisional
Probab=88.80  E-value=0.28  Score=32.12  Aligned_cols=20  Identities=20%  Similarity=0.207  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||.+.+.+...|
T Consensus         5 i~G~~GsGKstia~~la~~l   24 (180)
T PRK04182          5 ISGPPGSGKTTVARLLAEKL   24 (180)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            57999999999999987643


No 72 
>PRK00023 cmk cytidylate kinase; Provisional
Probab=88.72  E-value=0.32  Score=34.58  Aligned_cols=20  Identities=15%  Similarity=0.167  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||.+++++.+.|
T Consensus         9 i~g~~gsGksti~~~la~~~   28 (225)
T PRK00023          9 IDGPAGSGKGTVAKILAKKL   28 (225)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999998766


No 73 
>PF05729 NACHT:  NACHT domain
Probab=88.57  E-value=0.4  Score=30.50  Aligned_cols=25  Identities=16%  Similarity=0.147  Sum_probs=20.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhcc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDF   25 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~   25 (80)
                      |-|+.|+|||.+.+.++..+.....
T Consensus         5 I~G~~G~GKStll~~~~~~~~~~~~   29 (166)
T PF05729_consen    5 ISGEPGSGKSTLLRKLAQQLAEEEP   29 (166)
T ss_pred             EECCCCCChHHHHHHHHHHHHhcCc
Confidence            4699999999999999888776653


No 74 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=88.53  E-value=0.34  Score=31.45  Aligned_cols=20  Identities=15%  Similarity=0.102  Sum_probs=17.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+.+.|
T Consensus         9 l~G~~GsGKstla~~La~~l   28 (175)
T PRK00131          9 LIGFMGAGKSTIGRLLAKRL   28 (175)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            46999999999999988765


No 75 
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=88.52  E-value=0.32  Score=36.92  Aligned_cols=21  Identities=24%  Similarity=0.346  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||+|||.+.+-++.++.
T Consensus       149 I~G~tGSGKTTll~aL~~~i~  169 (323)
T PRK13833        149 ISGGTGSGKTTLANAVIAEIV  169 (323)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            589999999999999888763


No 76 
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=88.38  E-value=0.34  Score=34.00  Aligned_cols=22  Identities=18%  Similarity=0.227  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.+|||||-..+.+...|-.
T Consensus        38 i~G~~GsGKTTl~~~L~~~l~~   59 (229)
T PRK09270         38 IAGPPGAGKSTLAEFLEALLQQ   59 (229)
T ss_pred             EECCCCCCHHHHHHHHHHHhhh
Confidence            5799999999999998877643


No 77 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=88.12  E-value=0.26  Score=31.21  Aligned_cols=20  Identities=15%  Similarity=0.162  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-..+.+.+.+
T Consensus         4 ~~G~pgsGKSt~a~~l~~~~   23 (143)
T PF13671_consen    4 LCGPPGSGKSTLAKRLAKRL   23 (143)
T ss_dssp             EEESTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHHC
Confidence            57999999999999988654


No 78 
>PRK07667 uridine kinase; Provisional
Probab=88.05  E-value=0.39  Score=33.01  Aligned_cols=22  Identities=18%  Similarity=0.164  Sum_probs=19.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.+|+|||-.+..+...|..
T Consensus        22 I~G~~gsGKStla~~L~~~l~~   43 (193)
T PRK07667         22 IDGLSRSGKTTFVANLKENMKQ   43 (193)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            6899999999999999888743


No 79 
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=87.98  E-value=0.29  Score=37.00  Aligned_cols=20  Identities=30%  Similarity=0.408  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|+||+|||.+.+.++.++
T Consensus       165 i~G~tgSGKTTll~aL~~~i  184 (332)
T PRK13900        165 ISGGTSTGKTTFTNAALREI  184 (332)
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            58999999999999888776


No 80 
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=87.97  E-value=0.46  Score=30.25  Aligned_cols=19  Identities=21%  Similarity=0.214  Sum_probs=17.0

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||...+.+...+
T Consensus         5 ~G~~G~GKt~l~~~la~~~   23 (139)
T PF07728_consen    5 VGPPGTGKTTLARELAALL   23 (139)
T ss_dssp             EESSSSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999998766


No 81 
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=87.89  E-value=0.24  Score=37.80  Aligned_cols=20  Identities=20%  Similarity=0.335  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||||||.+.+.++.++
T Consensus       167 I~G~tGSGKTTll~aLl~~i  186 (344)
T PRK13851        167 LCGPTGSGKTTMSKTLISAI  186 (344)
T ss_pred             EECCCCccHHHHHHHHHccc
Confidence            58999999999999988765


No 82 
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=87.68  E-value=0.64  Score=29.05  Aligned_cols=24  Identities=17%  Similarity=0.069  Sum_probs=20.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      |-|++|.|||-.++.+++.|....
T Consensus         3 i~G~~G~GKS~l~~~l~~~l~~~~   26 (107)
T PF00910_consen    3 IYGPPGIGKSTLAKELAKDLLKHI   26 (107)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHh
Confidence            359999999999999988887543


No 83 
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]
Probab=87.59  E-value=0.3  Score=39.42  Aligned_cols=21  Identities=24%  Similarity=0.226  Sum_probs=18.8

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -||||||||+++.-||+-|..
T Consensus        42 VGESGSGKSvTa~sim~LLp~   62 (534)
T COG4172          42 VGESGSGKSVTALSILGLLPS   62 (534)
T ss_pred             EecCCCCccHHHHHHHHhcCC
Confidence            499999999999999997755


No 84 
>PF01583 APS_kinase:  Adenylylsulphate kinase;  InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....
Probab=87.43  E-value=0.49  Score=32.54  Aligned_cols=24  Identities=17%  Similarity=0.163  Sum_probs=20.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      |.|.+|||||.+++.+-+.|-...
T Consensus         7 ltGlsGsGKtTlA~~L~~~L~~~g   30 (156)
T PF01583_consen    7 LTGLSGSGKTTLARALERRLFARG   30 (156)
T ss_dssp             EESSTTSSHHHHHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHHHHcC
Confidence            469999999999999999886543


No 85 
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=87.33  E-value=0.39  Score=31.47  Aligned_cols=20  Identities=15%  Similarity=0.149  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||.+.+.+...|
T Consensus         3 l~G~~GsGKSTla~~l~~~l   22 (163)
T TIGR01313         3 LMGVAGSGKSTIASALAHRL   22 (163)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            46999999999999887765


No 86 
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=87.21  E-value=0.29  Score=36.62  Aligned_cols=18  Identities=17%  Similarity=0.253  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.||||+|||-+.+.+++
T Consensus        44 lVGESG~GKSTlgr~i~~   61 (268)
T COG4608          44 LVGESGCGKSTLGRLILG   61 (268)
T ss_pred             EEecCCCCHHHHHHHHHc
Confidence            359999999999999987


No 87 
>PRK10436 hypothetical protein; Provisional
Probab=87.18  E-value=0.39  Score=38.05  Aligned_cols=22  Identities=27%  Similarity=0.152  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||||||-+-|-+|.++..
T Consensus       223 vtGpTGSGKTTtL~a~l~~~~~  244 (462)
T PRK10436        223 VTGPTGSGKTVTLYSALQTLNT  244 (462)
T ss_pred             EECCCCCChHHHHHHHHHhhCC
Confidence            5799999999999998888743


No 88 
>PRK06547 hypothetical protein; Provisional
Probab=87.16  E-value=0.45  Score=32.60  Aligned_cols=20  Identities=15%  Similarity=0.097  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.+..+...+
T Consensus        20 i~G~~GsGKTt~a~~l~~~~   39 (172)
T PRK06547         20 IDGRSGSGKTTLAGALAART   39 (172)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            57999999999999887753


No 89 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=86.94  E-value=0.41  Score=38.52  Aligned_cols=21  Identities=29%  Similarity=0.197  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||||||.+-|-++.++-
T Consensus       321 v~G~tGSGKTTtl~a~l~~~~  341 (564)
T TIGR02538       321 VTGPTGSGKTVSLYTALNILN  341 (564)
T ss_pred             EECCCCCCHHHHHHHHHHhhC
Confidence            579999999999999988873


No 90 
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=86.91  E-value=0.37  Score=33.10  Aligned_cols=20  Identities=20%  Similarity=0.235  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |||..|||||.+...++..+
T Consensus        20 ~aG~~GsGKSt~~~~~~~~~   39 (199)
T PF06414_consen   20 IAGQPGSGKSTLARQLLEEF   39 (199)
T ss_dssp             EES-TTSTTHHHHHHHHHHT
T ss_pred             EeCCCCCCHHHHHHHhhhhc
Confidence            58999999999999998865


No 91 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=86.88  E-value=0.29  Score=32.45  Aligned_cols=20  Identities=15%  Similarity=0.117  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-..+.+...+
T Consensus         6 l~G~~GsGKsTl~~~L~~~~   25 (180)
T TIGR03263         6 ISGPSGVGKSTLVKALLEED   25 (180)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            46999999999999998754


No 92 
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=86.74  E-value=0.51  Score=31.19  Aligned_cols=21  Identities=14%  Similarity=0.154  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||..++.+..++.
T Consensus         4 i~G~~GsGKSTla~~L~~~l~   24 (149)
T cd02027           4 LTGLSGSGKSTIARALEEKLF   24 (149)
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            469999999999999998874


No 93 
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=86.73  E-value=0.6  Score=30.46  Aligned_cols=23  Identities=22%  Similarity=0.225  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +-|++|+|||-...-++.++...
T Consensus        29 l~G~~G~GKT~ll~~~~~~~~~~   51 (185)
T PF13191_consen   29 LTGESGSGKTSLLRALLDRLAER   51 (185)
T ss_dssp             E-B-TTSSHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHhc
Confidence            46999999999999888887665


No 94 
>PRK14737 gmk guanylate kinase; Provisional
Probab=86.63  E-value=0.43  Score=33.02  Aligned_cols=20  Identities=10%  Similarity=0.013  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+||+.+.+.++..+
T Consensus         9 l~GpsG~GK~tl~~~l~~~~   28 (186)
T PRK14737          9 ISSVAGGGKSTIIQALLEEH   28 (186)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            47999999999999987754


No 95 
>PF07475 Hpr_kinase_C:  HPr Serine kinase C-terminal domain;  InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents the C-terminal kinase domain of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phosphorelay system in control of carbon catabolic repression in bacteria []. This kinase in unusual in that it recognises the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes []. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller [].; GO: 0000155 two-component sensor activity, 0004672 protein kinase activity, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0006109 regulation of carbohydrate metabolic process; PDB: 2QMH_C 1KKM_B 1KKL_C 1JB1_A 3TQF_B 1KNX_B 1KO7_A.
Probab=86.21  E-value=0.39  Score=33.76  Aligned_cols=18  Identities=17%  Similarity=0.301  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++.-+++
T Consensus        23 i~G~SG~GKS~lAl~Li~   40 (171)
T PF07475_consen   23 ITGPSGIGKSELALELIK   40 (171)
T ss_dssp             EEESTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999987776


No 96 
>PRK03846 adenylylsulfate kinase; Provisional
Probab=86.20  E-value=0.56  Score=32.14  Aligned_cols=22  Identities=14%  Similarity=0.057  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.+|+|||.+.+.+...|..
T Consensus        29 i~G~~GsGKSTla~~l~~~l~~   50 (198)
T PRK03846         29 FTGLSGSGKSTVAGALEEALHE   50 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999999887743


No 97 
>PRK00889 adenylylsulfate kinase; Provisional
Probab=86.12  E-value=0.59  Score=31.10  Aligned_cols=21  Identities=19%  Similarity=0.104  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||.+.+.+...|.
T Consensus         9 ~~G~~GsGKST~a~~la~~l~   29 (175)
T PRK00889          9 FTGLSGAGKTTIARALAEKLR   29 (175)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            469999999999999998874


No 98 
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=85.87  E-value=0.61  Score=31.33  Aligned_cols=21  Identities=14%  Similarity=0.077  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||...+.+...+.
T Consensus        23 i~G~~GsGKstla~~l~~~l~   43 (184)
T TIGR00455        23 LTGLSGSGKSTIANALEKKLE   43 (184)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            579999999999999988764


No 99 
>PRK05541 adenylylsulfate kinase; Provisional
Probab=85.87  E-value=0.61  Score=31.06  Aligned_cols=21  Identities=19%  Similarity=0.127  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||-..+.+...|.
T Consensus        12 i~G~~GsGKst~a~~l~~~l~   32 (176)
T PRK05541         12 ITGLAGSGKTTIAKALYERLK   32 (176)
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            469999999999999988875


No 100
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=85.86  E-value=0.61  Score=33.16  Aligned_cols=20  Identities=20%  Similarity=0.099  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|++|+|||-.++.+..||
T Consensus         5 IsG~pGsG~TTva~~lAe~~   24 (179)
T COG1102           5 ISGLPGSGKTTVARELAEHL   24 (179)
T ss_pred             eccCCCCChhHHHHHHHHHh
Confidence            68999999999999998876


No 101
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=85.85  E-value=0.52  Score=31.55  Aligned_cols=21  Identities=24%  Similarity=0.096  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|+.|+|||-..+.+++.|-
T Consensus        27 l~G~lGaGKTtl~~~l~~~lg   47 (133)
T TIGR00150        27 LKGDLGAGKTTLVQGLLQGLG   47 (133)
T ss_pred             EEcCCCCCHHHHHHHHHHHcC
Confidence            359999999999999999873


No 102
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=85.78  E-value=0.55  Score=37.95  Aligned_cols=24  Identities=25%  Similarity=0.178  Sum_probs=20.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      ++|+||||||.+-|-+|.++-...
T Consensus       263 vTGPTGSGKTTTLY~~L~~ln~~~  286 (500)
T COG2804         263 VTGPTGSGKTTTLYAALSELNTPE  286 (500)
T ss_pred             EeCCCCCCHHHHHHHHHHHhcCCC
Confidence            379999999999999999875543


No 103
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=85.66  E-value=0.4  Score=38.04  Aligned_cols=21  Identities=29%  Similarity=0.172  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||+|||-+-+.++.++-
T Consensus       247 itGptGSGKTTtL~a~L~~l~  267 (486)
T TIGR02533       247 VTGPTGSGKTTTLYAALSRLN  267 (486)
T ss_pred             EEcCCCCCHHHHHHHHHhccC
Confidence            579999999999998888764


No 104
>PRK07261 topology modulation protein; Provisional
Probab=85.63  E-value=0.58  Score=31.66  Aligned_cols=20  Identities=10%  Similarity=0.051  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+...+
T Consensus         5 i~G~~GsGKSTla~~l~~~~   24 (171)
T PRK07261          5 IIGYSGSGKSTLARKLSQHY   24 (171)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            46999999999999887654


No 105
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=85.44  E-value=0.66  Score=34.69  Aligned_cols=20  Identities=25%  Similarity=0.318  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |||.+|||||-+++++..-|
T Consensus        67 IaG~~GSGKSTlar~L~~ll   86 (290)
T TIGR00554        67 IAGSVAVGKSTTARILQALL   86 (290)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            68999999999998776544


No 106
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=85.36  E-value=0.7  Score=31.47  Aligned_cols=23  Identities=13%  Similarity=0.187  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.....++...+..
T Consensus        17 i~G~~GsGKT~l~~~~~~~~~~~   39 (209)
T TIGR02237        17 IYGPPGSGKTNICMILAVNAARQ   39 (209)
T ss_pred             EECCCCCCHHHHHHHHHHHHHhC
Confidence            47999999999998777665543


No 107
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=85.35  E-value=0.7  Score=30.60  Aligned_cols=23  Identities=22%  Similarity=0.140  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+...+...+...
T Consensus         5 ~~G~~G~GKTt~~~~la~~~~~~   27 (173)
T cd03115           5 LVGLQGVGKTTTAAKLALYLKKK   27 (173)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHC
Confidence            46999999999988887776554


No 108
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=85.08  E-value=0.68  Score=29.59  Aligned_cols=20  Identities=20%  Similarity=0.162  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+...|
T Consensus         4 l~G~~GsGKstla~~la~~l   23 (154)
T cd00464           4 LIGMMGAGKTTVGRLLAKAL   23 (154)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            46999999999999987664


No 109
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.
Probab=85.01  E-value=0.78  Score=29.56  Aligned_cols=23  Identities=17%  Similarity=0.176  Sum_probs=20.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|+.|+|||-++..+.+++...
T Consensus         4 ~~GkgG~GKTt~a~~la~~l~~~   26 (116)
T cd02034           4 ITGKGGVGKTTIAALLARYLAEK   26 (116)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHC
Confidence            47999999999999999988654


No 110
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=84.88  E-value=0.58  Score=32.80  Aligned_cols=21  Identities=24%  Similarity=0.143  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|++|+|||-+.+.++..+-
T Consensus        48 l~G~~G~GKTtl~~~l~~~l~   68 (269)
T TIGR03015        48 ITGEVGAGKTTLIRNLLKRLD   68 (269)
T ss_pred             EEcCCCCCHHHHHHHHHHhcC
Confidence            359999999999998877653


No 111
>TIGR00017 cmk cytidylate kinase. This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors.
Probab=84.75  E-value=0.68  Score=32.84  Aligned_cols=20  Identities=20%  Similarity=0.184  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||.+.+.+...|
T Consensus         7 i~G~~GsGKst~~~~la~~~   26 (217)
T TIGR00017         7 IDGPSGAGKSTVAKAVAEKL   26 (217)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999997654


No 112
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=84.71  E-value=0.68  Score=39.26  Aligned_cols=21  Identities=24%  Similarity=0.164  Sum_probs=19.1

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +|+||.||||++|-+..+|..
T Consensus       527 ~GPTGVGKTELAkaLA~~Lfg  547 (786)
T COG0542         527 LGPTGVGKTELAKALAEALFG  547 (786)
T ss_pred             eCCCcccHHHHHHHHHHHhcC
Confidence            799999999999999888864


No 113
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=84.63  E-value=0.43  Score=37.58  Aligned_cols=21  Identities=14%  Similarity=0.213  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|+||||||-+.+++++++-
T Consensus       360 iVG~sGsGKSTl~~LL~r~~~  380 (567)
T COG1132         360 IVGPSGSGKSTLIKLLLRLYD  380 (567)
T ss_pred             EECCCCCCHHHHHHHHhccCC
Confidence            359999999999999999763


No 114
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=84.52  E-value=0.72  Score=32.13  Aligned_cols=22  Identities=18%  Similarity=0.093  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.+|+|||-...-++..|..
T Consensus        11 ivG~sgsGKTTLi~~li~~l~~   32 (173)
T PRK10751         11 IAAWSGTGKTTLLKKLIPALCA   32 (173)
T ss_pred             EECCCCChHHHHHHHHHHHHhh
Confidence            4799999999998888888754


No 115
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=84.48  E-value=0.72  Score=29.36  Aligned_cols=20  Identities=35%  Similarity=0.195  Sum_probs=13.9

Q ss_pred             CCCCcCCchHH-HHHHHHHHH
Q psy17057          1 MAGSTMRDKTP-FKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte-~~k~~l~~l   20 (80)
                      +.|++|+|||. +..+++.++
T Consensus        29 i~~~~GsGKT~~~~~~~~~~~   49 (201)
T smart00487       29 LAAPTGSGKTLAALLPALEAL   49 (201)
T ss_pred             EECCCCCchhHHHHHHHHHHh
Confidence            35899999999 444444444


No 116
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=84.48  E-value=0.86  Score=26.94  Aligned_cols=20  Identities=20%  Similarity=0.258  Sum_probs=14.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||-+---+.--|
T Consensus        28 i~G~nGsGKSTllDAi~~~L   47 (62)
T PF13555_consen   28 ITGPNGSGKSTLLDAIQTVL   47 (62)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999998876554433


No 117
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=84.31  E-value=0.8  Score=31.73  Aligned_cols=23  Identities=22%  Similarity=0.248  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|.+|+|||.+...++..++..
T Consensus        18 I~G~~G~GKT~~~~~~~~~~~~~   40 (242)
T cd00984          18 IAARPSMGKTAFALNIAENIAKK   40 (242)
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHh
Confidence            58999999999988777666554


No 118
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=84.24  E-value=0.81  Score=30.19  Aligned_cols=20  Identities=10%  Similarity=-0.017  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-..+.+...+
T Consensus         8 i~G~~GsGKsTl~~~l~~~~   27 (188)
T TIGR01360         8 IVGGPGSGKGTQCEKIVEKY   27 (188)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999998887654


No 119
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. PRK catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=84.21  E-value=0.75  Score=34.59  Aligned_cols=22  Identities=18%  Similarity=0.188  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |||-||||||-...-+...|-.
T Consensus         4 ItG~SGSGKTTv~~~l~~~l~~   25 (277)
T cd02029           4 VTGSSGAGTTTVKRAFEHIFAR   25 (277)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            5899999999999988777643


No 120
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=84.18  E-value=0.71  Score=37.56  Aligned_cols=23  Identities=22%  Similarity=0.163  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |.|.||+|||...++++..+...
T Consensus       439 I~G~tGsGKS~~~~~l~~~~~~~  461 (785)
T TIGR00929       439 IFGPTGSGKTTLLNFLLAQMQKY  461 (785)
T ss_pred             EECCCCCCHHHHHHHHHHHhhcc
Confidence            57999999999999988766543


No 121
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=84.17  E-value=0.81  Score=31.64  Aligned_cols=21  Identities=29%  Similarity=0.186  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|++|+|||.+...++...+
T Consensus        25 i~G~~G~GKT~l~~~~~~~~~   45 (229)
T TIGR03881        25 VTGEPGTGKTIFCLHFAYKGL   45 (229)
T ss_pred             EECCCCCChHHHHHHHHHHHH
Confidence            479999999998887665444


No 122
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=83.89  E-value=0.77  Score=37.61  Aligned_cols=22  Identities=18%  Similarity=0.206  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+||+|||.+.+.++..+..
T Consensus       435 I~G~tGsGKS~~~~~l~~~~~~  456 (797)
T TIGR02746       435 VVGGSGAGKSFFMQELIVDNLS  456 (797)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999998876554


No 123
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=83.77  E-value=0.62  Score=34.75  Aligned_cols=20  Identities=15%  Similarity=0.297  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||.+.+.++..+
T Consensus        38 lvG~sGsGKSTL~~~l~Gll   57 (326)
T PRK11022         38 IVGESGSGKSVSSLAIMGLI   57 (326)
T ss_pred             EECCCCChHHHHHHHHHcCC
Confidence            36999999999999998754


No 124
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=83.71  E-value=0.74  Score=37.52  Aligned_cols=19  Identities=16%  Similarity=0.249  Sum_probs=16.7

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -||||||||-+.+.++..+
T Consensus       323 VGeSGsGKSTlar~i~gL~  341 (539)
T COG1123         323 VGESGSGKSTLARILAGLL  341 (539)
T ss_pred             ECCCCCCHHHHHHHHhCCC
Confidence            5999999999999997754


No 125
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=83.49  E-value=0.86  Score=32.89  Aligned_cols=22  Identities=9%  Similarity=0.045  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|++|+|||..+..++.+.+.
T Consensus        41 I~G~pGtGKT~l~~qf~~~~a~   62 (259)
T TIGR03878        41 ITGVSDTGKSLMVEQFAVTQAS   62 (259)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHh
Confidence            5899999999988876665443


No 126
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=83.24  E-value=0.67  Score=34.69  Aligned_cols=20  Identities=15%  Similarity=0.290  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-+.+.++..+
T Consensus        47 ivG~sGsGKSTL~~~l~Gl~   66 (330)
T PRK09473         47 IVGESGSGKSQTAFALMGLL   66 (330)
T ss_pred             EECCCCchHHHHHHHHHcCC
Confidence            46999999999999997654


No 127
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=82.90  E-value=0.84  Score=33.50  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|||||-..+.+...|
T Consensus         4 I~G~sGsGKSTl~~~L~~ll   23 (273)
T cd02026           4 VAGDSGCGKSTFLRRLTSLF   23 (273)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            57999999999999887655


No 128
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=82.86  E-value=0.86  Score=34.33  Aligned_cols=21  Identities=19%  Similarity=0.248  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||+|||-+.+.++.++.
T Consensus       153 I~G~tGSGKTTll~aL~~~~~  173 (319)
T PRK13894        153 VIGGTGSGKTTLVNAIINEMV  173 (319)
T ss_pred             EECCCCCCHHHHHHHHHHhhh
Confidence            579999999999998887753


No 129
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=82.81  E-value=1.1  Score=28.71  Aligned_cols=21  Identities=24%  Similarity=0.123  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.+.||+|||.+..+.+...+
T Consensus        19 i~aptGsGKT~~~~~~~l~~~   39 (169)
T PF00270_consen   19 ISAPTGSGKTLAYILPALNRL   39 (169)
T ss_dssp             EECSTTSSHHHHHHHHHHHHH
T ss_pred             EECCCCCccHHHHHHHHHhhh
Confidence            358999999999886655433


No 130
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.72  E-value=0.77  Score=30.80  Aligned_cols=18  Identities=11%  Similarity=0.122  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (178)
T cd03229          31 LLGPSGSGKSTLLRCIAG   48 (178)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 131
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=82.72  E-value=0.75  Score=34.39  Aligned_cols=20  Identities=10%  Similarity=0.235  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||...+.++..+
T Consensus        46 IvG~sGsGKSTLl~~l~gl~   65 (327)
T PRK11308         46 VVGESGCGKSTLARLLTMIE   65 (327)
T ss_pred             EECCCCCcHHHHHHHHHcCC
Confidence            46999999999999987643


No 132
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=82.61  E-value=1.2  Score=25.37  Aligned_cols=21  Identities=19%  Similarity=0.124  Sum_probs=18.3

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      .|+.|+|||.+...+...|..
T Consensus         5 ~g~~G~Gktt~~~~l~~~l~~   25 (99)
T cd01983           5 TGKGGVGKTTLAANLAAALAK   25 (99)
T ss_pred             ECCCCCCHHHHHHHHHHHHHH
Confidence            577899999999999998865


No 133
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=82.53  E-value=0.77  Score=34.20  Aligned_cols=20  Identities=15%  Similarity=0.134  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||-..+.|+.-+
T Consensus        38 ivG~sGsGKSTLl~~i~Gl~   57 (330)
T PRK15093         38 LVGESGSGKSLIAKAICGVT   57 (330)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            46999999999999987644


No 134
>PLN02796 D-glycerate 3-kinase
Probab=82.51  E-value=0.91  Score=35.04  Aligned_cols=21  Identities=10%  Similarity=0.184  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|+|||-+.+.+...|.
T Consensus       105 I~G~sGSGKSTLa~~L~~lL~  125 (347)
T PLN02796        105 ISAPQGCGKTTLVFALVYLFN  125 (347)
T ss_pred             EECCCCCcHHHHHHHHHHHhc
Confidence            579999999999998887764


No 135
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=82.40  E-value=1.1  Score=30.82  Aligned_cols=22  Identities=14%  Similarity=0.096  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.....++..++.
T Consensus        24 i~G~~GsGKT~l~~~~a~~~~~   45 (218)
T cd01394          24 VYGPPGTGKTNIAIQLAVETAG   45 (218)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4799999999999888776653


No 136
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=82.39  E-value=1.1  Score=30.97  Aligned_cols=22  Identities=18%  Similarity=0.123  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.....++...+.
T Consensus        28 i~G~~GsGKT~l~~~la~~~~~   49 (225)
T PRK09361         28 IYGPPGSGKTNICLQLAVEAAK   49 (225)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4799999999998877766544


No 137
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=82.33  E-value=1.7  Score=29.25  Aligned_cols=23  Identities=17%  Similarity=0.047  Sum_probs=20.5

Q ss_pred             CCCcCCchHHHHHHHHHHHhhhc
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      -|.||.||+-++++|.++|....
T Consensus        59 HG~tGtGKn~v~~liA~~ly~~G   81 (127)
T PF06309_consen   59 HGWTGTGKNFVSRLIAEHLYKSG   81 (127)
T ss_pred             ecCCCCcHHHHHHHHHHHHHhcc
Confidence            58999999999999999987654


No 138
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=82.08  E-value=1.1  Score=30.07  Aligned_cols=20  Identities=20%  Similarity=0.305  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-+++.+...+
T Consensus         7 l~G~~gsGKst~a~~l~~~~   26 (175)
T cd00227           7 LNGGSSAGKSSIARALQSVL   26 (175)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            46999999999999887653


No 139
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=81.94  E-value=0.91  Score=29.22  Aligned_cols=19  Identities=11%  Similarity=0.038  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|.+|+|||-+++.+...
T Consensus         4 l~G~~GsGKST~a~~l~~~   22 (150)
T cd02021           4 VMGVSGSGKSTVGKALAER   22 (150)
T ss_pred             EEcCCCCCHHHHHHHHHhh
Confidence            4699999999999988774


No 140
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=81.90  E-value=1  Score=31.14  Aligned_cols=20  Identities=25%  Similarity=0.243  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|+|||.....++...
T Consensus        24 i~G~~GsGKT~l~~q~l~~~   43 (226)
T PF06745_consen   24 ISGPPGSGKTTLALQFLYNG   43 (226)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCcHHHHHHHHHHh
Confidence            47999999999987665433


No 141
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=81.87  E-value=0.66  Score=34.31  Aligned_cols=20  Identities=25%  Similarity=0.295  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|.+|+|||-..+.++.++
T Consensus       149 i~G~tGsGKTTll~al~~~~  168 (308)
T TIGR02788       149 ISGGTGSGKTTFLKSLVDEI  168 (308)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            57999999999999887765


No 142
>PRK08118 topology modulation protein; Reviewed
Probab=81.81  E-value=1.1  Score=30.33  Aligned_cols=20  Identities=20%  Similarity=0.097  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||-.++.+...+
T Consensus         6 I~G~~GsGKSTlak~L~~~l   25 (167)
T PRK08118          6 LIGSGGSGKSTLARQLGEKL   25 (167)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            45999999999999887764


No 143
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=81.66  E-value=0.89  Score=30.62  Aligned_cols=18  Identities=17%  Similarity=0.130  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        23 i~G~nGsGKSTLl~~i~G   40 (190)
T TIGR01166        23 LLGANGAGKSTLLLHLNG   40 (190)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998754


No 144
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=81.58  E-value=1  Score=37.11  Aligned_cols=20  Identities=25%  Similarity=0.192  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||.|||++++.+-+.|
T Consensus       489 f~Gp~GvGKT~lA~~la~~l  508 (731)
T TIGR02639       489 FTGPTGVGKTELAKQLAEAL  508 (731)
T ss_pred             EECCCCccHHHHHHHHHHHh
Confidence            36999999999999998877


No 145
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=81.52  E-value=0.88  Score=31.33  Aligned_cols=19  Identities=11%  Similarity=0.190  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        35 i~G~nGsGKSTLl~~l~Gl   53 (220)
T cd03293          35 LVGPSGCGKSTLLRIIAGL   53 (220)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 146
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=81.21  E-value=1.2  Score=30.58  Aligned_cols=21  Identities=19%  Similarity=0.099  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|++|+|||.....++...+
T Consensus        24 I~G~~GsGKT~l~~~ia~~~~   44 (226)
T cd01393          24 IFGEFGSGKTQLCLQLAVEAQ   44 (226)
T ss_pred             EeCCCCCChhHHHHHHHHHhh
Confidence            579999999999988876543


No 147
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=81.10  E-value=1.5  Score=29.85  Aligned_cols=20  Identities=10%  Similarity=-0.054  Sum_probs=17.5

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|++|+|||-+.+.+.+++.
T Consensus        44 ~G~~G~GKT~la~~~~~~~~   63 (226)
T TIGR03420        44 WGESGSGKSHLLQAACAAAE   63 (226)
T ss_pred             ECCCCCCHHHHHHHHHHHHH
Confidence            59999999999999888764


No 148
>PRK10865 protein disaggregation chaperone; Provisional
Probab=81.00  E-value=1.1  Score=37.84  Aligned_cols=22  Identities=18%  Similarity=0.150  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||++++.+..++..
T Consensus       603 f~Gp~G~GKT~lA~aLa~~l~~  624 (857)
T PRK10865        603 FLGPTGVGKTELCKALANFMFD  624 (857)
T ss_pred             EECCCCCCHHHHHHHHHHHhhc
Confidence            3699999999999999888753


No 149
>PRK05439 pantothenate kinase; Provisional
Probab=80.90  E-value=1.3  Score=33.59  Aligned_cols=21  Identities=24%  Similarity=0.249  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||.+|+|||-++..+...|.
T Consensus        91 IaG~~gsGKSTla~~L~~~l~  111 (311)
T PRK05439         91 IAGSVAVGKSTTARLLQALLS  111 (311)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            689999999999998877553


No 150
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=80.89  E-value=0.99  Score=30.86  Aligned_cols=19  Identities=16%  Similarity=0.162  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        31 i~G~nGsGKSTLl~~l~G~   49 (213)
T cd03259          31 LLGPSGCGKTTLLRLIAGL   49 (213)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 151
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=80.83  E-value=1.4  Score=33.91  Aligned_cols=25  Identities=24%  Similarity=0.106  Sum_probs=21.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhcc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDF   25 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~   25 (80)
                      +-|++|.|||.+.+++++-+-..+.
T Consensus        47 iyG~~GTGKT~~~~~v~~~l~~~~~   71 (366)
T COG1474          47 IYGPTGTGKTATVKFVMEELEESSA   71 (366)
T ss_pred             EECCCCCCHhHHHHHHHHHHHhhhc
Confidence            3599999999999999998866644


No 152
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=80.78  E-value=1  Score=33.89  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||..+.-+.+.+
T Consensus         9 i~GptgsGKt~la~~la~~~   28 (307)
T PRK00091          9 IVGPTASGKTALAIELAKRL   28 (307)
T ss_pred             EECCCCcCHHHHHHHHHHhC
Confidence            57999999999999887765


No 153
>PRK15453 phosphoribulokinase; Provisional
Probab=80.58  E-value=1.2  Score=33.64  Aligned_cols=21  Identities=19%  Similarity=0.169  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||-||||||-.+..+..-+-
T Consensus        10 ItG~SGsGKTTva~~l~~if~   30 (290)
T PRK15453         10 VTGSSGAGTTTVKRAFEKIFR   30 (290)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            589999999999887765443


No 154
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=80.58  E-value=1  Score=32.29  Aligned_cols=20  Identities=10%  Similarity=-0.022  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-.++.+.+++
T Consensus         7 l~G~pGSGKSTla~~L~~~~   26 (300)
T PHA02530          7 TVGVPGSGKSTWAREFAAKN   26 (300)
T ss_pred             EEcCCCCCHHHHHHHHHHHC
Confidence            46999999999999988776


No 155
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=80.52  E-value=1  Score=30.64  Aligned_cols=19  Identities=11%  Similarity=0.125  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        32 l~G~nGsGKSTLl~~l~G~   50 (211)
T cd03225          32 IVGPNGSGKSTLLRLLNGL   50 (211)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988654


No 156
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=80.51  E-value=1  Score=30.78  Aligned_cols=19  Identities=16%  Similarity=0.191  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        33 l~G~nGsGKSTLl~~i~Gl   51 (214)
T TIGR02673        33 LTGPSGAGKTTLLKLLYGA   51 (214)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            3699999999999988654


No 157
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=80.47  E-value=0.7  Score=32.47  Aligned_cols=13  Identities=15%  Similarity=0.342  Sum_probs=11.6

Q ss_pred             CCCCcCCchHHHH
Q psy17057          1 MAGSTMRDKTPFK   13 (80)
Q Consensus         1 ~aG~sg~gKte~~   13 (80)
                      +.|+||||||...
T Consensus        26 l~G~sGsGKSTL~   38 (226)
T cd03270          26 ITGVSGSGKSSLA   38 (226)
T ss_pred             EEcCCCCCHHHHH
Confidence            4699999999995


No 158
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=80.46  E-value=0.99  Score=30.91  Aligned_cols=18  Identities=17%  Similarity=0.180  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (222)
T cd03224          31 LLGRNGAGKTTLLKTIMG   48 (222)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999987754


No 159
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=80.46  E-value=1  Score=33.82  Aligned_cols=20  Identities=15%  Similarity=0.315  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-..+.|+..+
T Consensus        52 lvG~sGsGKSTLlk~i~Gl~   71 (331)
T PRK15079         52 VVGESGCGKSTFARAIIGLV   71 (331)
T ss_pred             EECCCCCCHHHHHHHHHCCC
Confidence            46999999999999997643


No 160
>PLN02348 phosphoribulokinase
Probab=80.41  E-value=1.2  Score=34.94  Aligned_cols=21  Identities=19%  Similarity=0.124  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||.||||||-+++.+...|-
T Consensus        54 IaG~SGSGKSTfA~~L~~~Lg   74 (395)
T PLN02348         54 LAADSGCGKSTFMRRLTSVFG   74 (395)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            689999999999999988773


No 161
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=80.40  E-value=0.99  Score=33.65  Aligned_cols=20  Identities=10%  Similarity=0.144  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-||||+|||-..+.++-+.
T Consensus        38 ivGeSGsGKSTL~r~l~Gl~   57 (252)
T COG1124          38 IVGESGSGKSTLARLLAGLE   57 (252)
T ss_pred             EEcCCCCCHHHHHHHHhccc
Confidence            46999999999999886643


No 162
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB. This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.
Probab=80.39  E-value=1.4  Score=29.70  Aligned_cols=23  Identities=17%  Similarity=0.167  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|.+|+|||-....++..|...
T Consensus         4 i~G~~gsGKTtl~~~l~~~l~~~   26 (155)
T TIGR00176         4 IVGPKNSGKTTLIERLVKALKAR   26 (155)
T ss_pred             EECCCCCCHHHHHHHHHHHHHhc
Confidence            46999999999999998887644


No 163
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=80.25  E-value=0.71  Score=35.96  Aligned_cols=20  Identities=15%  Similarity=0.291  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||+|||-..++++..+
T Consensus       366 IvG~SGsGKSTLl~lL~g~~  385 (529)
T TIGR02868       366 ILGPSGSGKSTLLMLLTGLL  385 (529)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            46999999999999998754


No 164
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=80.18  E-value=1.2  Score=37.49  Aligned_cols=22  Identities=23%  Similarity=0.160  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+||+|||...++++..+..
T Consensus       493 I~G~tGsGKS~l~~~L~~~~~k  514 (852)
T PRK13891        493 MFGPTGAGKSTHLGIIAAQLRR  514 (852)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999998876543


No 165
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=80.18  E-value=1.1  Score=30.85  Aligned_cols=19  Identities=16%  Similarity=0.088  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||.....++..
T Consensus        24 i~G~~GsGKT~l~~~l~~~   42 (235)
T cd01123          24 IFGEFGSGKTQLCHQLAVT   42 (235)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            4799999999999887654


No 166
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=79.99  E-value=1.2  Score=29.99  Aligned_cols=20  Identities=10%  Similarity=0.222  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+||+.+.+.++..+
T Consensus         7 l~Gpsg~GK~~l~~~L~~~~   26 (183)
T PF00625_consen    7 LVGPSGSGKSTLAKRLIQEF   26 (183)
T ss_dssp             EESSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            46999999999999887743


No 167
>PF13245 AAA_19:  Part of AAA domain
Probab=79.96  E-value=1.7  Score=26.04  Aligned_cols=21  Identities=24%  Similarity=0.139  Sum_probs=16.9

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -|..|+|||.+..-++.+++.
T Consensus        16 ~g~pGtGKT~~~~~~i~~l~~   36 (76)
T PF13245_consen   16 QGPPGTGKTTTLAARIAELLA   36 (76)
T ss_pred             ECCCCCCHHHHHHHHHHHHHH
Confidence            588999999777777777764


No 168
>PRK05428 HPr kinase/phosphorylase; Provisional
Probab=79.94  E-value=1.1  Score=34.02  Aligned_cols=19  Identities=16%  Similarity=0.174  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|+||+||||++--.+..
T Consensus       151 i~G~SG~GKSelALeLi~r  169 (308)
T PRK05428        151 ITGESGIGKSETALELIKR  169 (308)
T ss_pred             EEcCCCCCHHHHHHHHHHc
Confidence            4699999999999866653


No 169
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=79.93  E-value=0.88  Score=28.65  Aligned_cols=19  Identities=11%  Similarity=0.128  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||..-+.+...
T Consensus        16 i~G~nGsGKStLl~~l~g~   34 (137)
T PF00005_consen   16 IVGPNGSGKSTLLKALAGL   34 (137)
T ss_dssp             EEESTTSSHHHHHHHHTTS
T ss_pred             EEccCCCccccceeeeccc
Confidence            4699999999998877543


No 170
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=79.92  E-value=0.9  Score=30.76  Aligned_cols=20  Identities=10%  Similarity=0.046  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-+.+++...+
T Consensus         7 l~G~sGsGKsTl~~~l~~~~   26 (186)
T PRK10078          7 LMGPSGSGKDSLLAALRQRE   26 (186)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            36999999999999986643


No 171
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=79.80  E-value=1.7  Score=34.62  Aligned_cols=21  Identities=29%  Similarity=0.181  Sum_probs=16.4

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -|.||+||||+.-.++.+++.
T Consensus         3 ~g~TGsGKT~v~l~~i~~~l~   23 (505)
T TIGR00595         3 FGVTGSGKTEVYLQAIEKVLA   23 (505)
T ss_pred             cCCCCCCHHHHHHHHHHHHHH
Confidence            489999999998666665544


No 172
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.80  E-value=1.1  Score=30.72  Aligned_cols=19  Identities=11%  Similarity=0.128  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        28 i~G~nGsGKSTLl~~l~G~   46 (214)
T cd03297          28 IFGASGAGKSTLLRCIAGL   46 (214)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999987653


No 173
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=79.59  E-value=1.3  Score=29.52  Aligned_cols=22  Identities=27%  Similarity=0.309  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.+|+|||.....++.+++.
T Consensus        37 i~g~~g~GKT~~~~~l~~~~~~   58 (193)
T PF13481_consen   37 IAGPPGSGKTTLALQLAAALAT   58 (193)
T ss_dssp             EEECSTSSHHHHHHHHHHHHHT
T ss_pred             EEeCCCCCHHHHHHHHHHHHHh
Confidence            4789999999999988887764


No 174
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=79.59  E-value=1.1  Score=30.69  Aligned_cols=19  Identities=21%  Similarity=0.387  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~l~Gl   52 (216)
T TIGR00960        34 LVGHSGAGKSTFLKLILGI   52 (216)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 175
>PLN02318 phosphoribulokinase/uridine kinase
Probab=79.56  E-value=1  Score=37.52  Aligned_cols=20  Identities=35%  Similarity=0.373  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||||||-..+.+...+
T Consensus        70 IaGpSGSGKTTLAk~LaglL   89 (656)
T PLN02318         70 VAGPSGAGKTVFTEKVLNFM   89 (656)
T ss_pred             EECCCCCcHHHHHHHHHhhC
Confidence            68999999999999998765


No 176
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=79.56  E-value=1.2  Score=37.29  Aligned_cols=22  Identities=18%  Similarity=0.243  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.||+|||.+.+.++..+..
T Consensus       454 I~G~sGsGKS~l~k~l~~~~~~  475 (844)
T PRK13721        454 VCGTSGAGKTGLIQPLIRSVLD  475 (844)
T ss_pred             EEcCCCCCHHHHHHHHHHhhhc
Confidence            4699999999999999876543


No 177
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=79.53  E-value=1.2  Score=29.09  Aligned_cols=20  Identities=15%  Similarity=0.172  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||-+...|...|
T Consensus        24 i~G~Ng~GKStil~ai~~~L   43 (202)
T PF13476_consen   24 IYGPNGSGKSTILEAIRYAL   43 (202)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999999997764444


No 178
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=79.47  E-value=1.7  Score=31.02  Aligned_cols=21  Identities=14%  Similarity=0.120  Sum_probs=18.3

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      .|++|.|||-+++.+.+.|..
T Consensus        48 ~GppGtGKTtlA~~ia~~l~~   68 (261)
T TIGR02881        48 KGNPGTGKTTVARILGKLFKE   68 (261)
T ss_pred             EcCCCCCHHHHHHHHHHHHHh
Confidence            599999999999999887643


No 179
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.44  E-value=1.2  Score=30.40  Aligned_cols=18  Identities=22%  Similarity=0.163  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (210)
T cd03269          31 LLGPNGAGKTTTIRMILG   48 (210)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 180
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=79.42  E-value=1.2  Score=30.54  Aligned_cols=19  Identities=11%  Similarity=0.127  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        35 l~G~nGsGKSTLl~~i~Gl   53 (218)
T cd03255          35 IVGPSGSGKSTLLNILGGL   53 (218)
T ss_pred             EEcCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 181
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=79.40  E-value=1.1  Score=31.13  Aligned_cols=18  Identities=17%  Similarity=0.102  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 l~G~nGsGKSTLl~~l~G   48 (236)
T cd03219          31 LIGPNGAGKTTLFNLISG   48 (236)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999998864


No 182
>PRK05973 replicative DNA helicase; Provisional
Probab=79.37  E-value=1.5  Score=31.97  Aligned_cols=22  Identities=14%  Similarity=0.153  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.+|+|||...-.++...+.
T Consensus        69 IaG~PG~GKT~lalqfa~~~a~   90 (237)
T PRK05973         69 LGARPGHGKTLLGLELAVEAMK   90 (237)
T ss_pred             EEeCCCCCHHHHHHHHHHHHHh
Confidence            5899999999998887776654


No 183
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=79.26  E-value=1.6  Score=30.16  Aligned_cols=21  Identities=33%  Similarity=0.314  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|++|+|||.....++...+
T Consensus        21 i~G~~G~GKt~~~~~~~~~~~   41 (224)
T TIGR03880        21 VIGEYGTGKTTFSLQFLYQGL   41 (224)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            479999999998776665443


No 184
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=79.23  E-value=1.4  Score=30.67  Aligned_cols=21  Identities=24%  Similarity=0.173  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|..|+|||-..+.++..+.
T Consensus         6 i~G~~GsGKTTll~~l~~~l~   26 (199)
T TIGR00101         6 VAGPVGSGKTALIEALTRALR   26 (199)
T ss_pred             EECCCCCCHHHHHHHHHHhhC
Confidence            479999999999999988764


No 185
>PRK07429 phosphoribulokinase; Provisional
Probab=79.09  E-value=1.3  Score=33.44  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||||||-..+.+...|
T Consensus        13 I~G~SGSGKSTla~~L~~ll   32 (327)
T PRK07429         13 VAGDSGCGKTTFLRGLADLL   32 (327)
T ss_pred             EECCCCCCHHHHHHHHHhHh
Confidence            58999999999999887765


No 186
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.06  E-value=1.2  Score=30.64  Aligned_cols=18  Identities=17%  Similarity=0.100  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKSTLl~~i~G   48 (220)
T cd03265          31 LLGPNGAGKTTTIKMLTT   48 (220)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 187
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=78.99  E-value=1.9  Score=28.90  Aligned_cols=19  Identities=21%  Similarity=0.113  Sum_probs=16.5

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|.||+|||-+.+.+...|
T Consensus         1 ~G~sGsGKSTla~~la~~l   19 (163)
T PRK11545          1 MGVSGSGKSAVASEVAHQL   19 (163)
T ss_pred             CCCCCCcHHHHHHHHHHHh
Confidence            4899999999999887765


No 188
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=78.97  E-value=1.1  Score=30.64  Aligned_cols=19  Identities=16%  Similarity=0.235  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        30 l~G~nGsGKSTLl~~l~G~   48 (213)
T cd03235          30 IVGPNGAGKSTLLKAILGL   48 (213)
T ss_pred             EECCCCCCHHHHHHHHcCC
Confidence            4699999999999987553


No 189
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=78.96  E-value=1.2  Score=31.26  Aligned_cols=19  Identities=11%  Similarity=0.083  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-.-+++.-.
T Consensus        32 i~G~nGsGKSTLl~~l~G~   50 (247)
T TIGR00972        32 LIGPSGCGKSTLLRSLNRM   50 (247)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988643


No 190
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves.
Probab=78.87  E-value=1.5  Score=37.13  Aligned_cols=22  Identities=18%  Similarity=0.227  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.||||||.+.+.++..+..
T Consensus       480 I~G~TGSGKS~l~~~li~q~~~  501 (893)
T TIGR03744       480 ILGPTGAGKSATLTNLLMQVMA  501 (893)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999988776543


No 191
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=78.87  E-value=1.2  Score=30.86  Aligned_cols=19  Identities=11%  Similarity=0.093  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-..+++.-.
T Consensus        32 i~G~nGsGKSTLl~~l~Gl   50 (241)
T cd03256          32 LIGPSGAGKSTLLRCLNGL   50 (241)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 192
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=78.74  E-value=1.5  Score=29.04  Aligned_cols=20  Identities=10%  Similarity=-0.002  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||..++.+...+
T Consensus         4 i~G~pGsGKst~a~~la~~~   23 (183)
T TIGR01359         4 VLGGPGSGKGTQCAKIVENF   23 (183)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            46999999999988877654


No 193
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=78.71  E-value=1.6  Score=31.97  Aligned_cols=23  Identities=22%  Similarity=0.125  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|.+|+|||-+..-+..++...
T Consensus       199 ~vGptGvGKTTt~~kLa~~~~~~  221 (282)
T TIGR03499       199 LVGPTGVGKTTTLAKLAARFVLE  221 (282)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHH
Confidence            46999999998888777777543


No 194
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms]
Probab=78.70  E-value=1.3  Score=33.91  Aligned_cols=19  Identities=16%  Similarity=0.282  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|+||+||||++-=+++.
T Consensus       150 ItG~SG~GKSElALeLi~r  168 (308)
T COG1493         150 ITGPSGAGKSELALELIKR  168 (308)
T ss_pred             EECCCCCCHhHHHHHHHHh
Confidence            5699999999999877663


No 195
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=78.67  E-value=1.3  Score=30.83  Aligned_cols=19  Identities=11%  Similarity=0.083  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-++++-.
T Consensus        18 l~G~NGsGKSTLlk~i~Gl   36 (213)
T PRK15177         18 ILAAPGSGKTTLTRLLCGL   36 (213)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 196
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=78.59  E-value=1.4  Score=32.31  Aligned_cols=19  Identities=11%  Similarity=0.162  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|.||||||-.-|+|+.-
T Consensus        33 l~GpSGAGKSTllkLi~~~   51 (223)
T COG2884          33 LTGPSGAGKSTLLKLIYGE   51 (223)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            4699999999999999763


No 197
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=78.59  E-value=1.3  Score=30.76  Aligned_cols=19  Identities=11%  Similarity=0.100  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        36 l~G~nGsGKSTLl~~l~G~   54 (233)
T cd03258          36 IIGRSGAGKSTLIRCINGL   54 (233)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988654


No 198
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=78.58  E-value=1.3  Score=30.20  Aligned_cols=19  Identities=11%  Similarity=0.193  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        32 i~G~nGsGKSTLl~~l~G~   50 (214)
T cd03292          32 LVGPSGAGKSTLLKLIYKE   50 (214)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988664


No 199
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=78.55  E-value=1.3  Score=30.27  Aligned_cols=18  Identities=17%  Similarity=0.218  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        30 i~G~nGsGKSTLl~~l~G   47 (211)
T cd03264          30 LLGPNGAGKTTLMRILAT   47 (211)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 200
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=78.49  E-value=1.3  Score=30.22  Aligned_cols=19  Identities=16%  Similarity=0.085  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        31 l~G~nGsGKSTLl~~l~G~   49 (213)
T cd03301          31 LLGPSGCGKTTTLRMIAGL   49 (213)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988764


No 201
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional
Probab=78.47  E-value=1.3  Score=35.65  Aligned_cols=20  Identities=20%  Similarity=0.187  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.||+|||-+++.+.++|
T Consensus       289 i~G~sgsGKst~a~~la~~l  308 (512)
T PRK13477        289 IDGPAGAGKSTVTRAVAKKL  308 (512)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            57999999999999998877


No 202
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=78.41  E-value=1.3  Score=30.25  Aligned_cols=19  Identities=16%  Similarity=0.193  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||..-+++.-.
T Consensus        32 l~G~nGsGKSTLl~~l~G~   50 (204)
T PRK13538         32 IEGPNGAGKTSLLRILAGL   50 (204)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 203
>PLN02840 tRNA dimethylallyltransferase
Probab=78.30  E-value=1.3  Score=34.94  Aligned_cols=20  Identities=25%  Similarity=0.287  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||.+++.+.+.+
T Consensus        26 I~GptgsGKTtla~~La~~~   45 (421)
T PLN02840         26 ISGPTGAGKSRLALELAKRL   45 (421)
T ss_pred             EECCCCCCHHHHHHHHHHHC
Confidence            58999999999999888876


No 204
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=78.26  E-value=0.94  Score=37.09  Aligned_cols=16  Identities=19%  Similarity=0.160  Sum_probs=13.3

Q ss_pred             CCCCcCCchHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVV   16 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~   16 (80)
                      +.||||||||.+---+
T Consensus        27 lTGETGAGKSIiidAl   42 (557)
T COG0497          27 LTGETGAGKSIIIDAL   42 (557)
T ss_pred             EecCCCCcHhHHHHHH
Confidence            4799999999887655


No 205
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=78.20  E-value=1.3  Score=30.28  Aligned_cols=18  Identities=11%  Similarity=0.097  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        35 i~G~nGsGKSTLl~~i~G   52 (220)
T cd03245          35 IIGRVGSGKSTLLKLLAG   52 (220)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998854


No 206
>PRK03839 putative kinase; Provisional
Probab=78.20  E-value=1.7  Score=28.97  Aligned_cols=20  Identities=20%  Similarity=0.197  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|-+|+|||-..+.+.+.+
T Consensus         5 l~G~pGsGKsT~~~~La~~~   24 (180)
T PRK03839          5 ITGTPGVGKTTVSKLLAEKL   24 (180)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999887764


No 207
>PRK02496 adk adenylate kinase; Provisional
Probab=78.16  E-value=1.7  Score=29.04  Aligned_cols=20  Identities=20%  Similarity=0.130  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||..++.+...+
T Consensus         6 i~G~pGsGKst~a~~la~~~   25 (184)
T PRK02496          6 FLGPPGAGKGTQAVVLAEHL   25 (184)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999987754


No 208
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=78.13  E-value=1.7  Score=31.81  Aligned_cols=22  Identities=23%  Similarity=0.212  Sum_probs=18.6

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      -|++|.|||.+++.+.+.+...
T Consensus        64 ~G~pGTGKT~lA~~ia~~l~~~   85 (284)
T TIGR02880        64 TGNPGTGKTTVALRMAQILHRL   85 (284)
T ss_pred             EcCCCCCHHHHHHHHHHHHHHc
Confidence            5999999999998888877543


No 209
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=78.06  E-value=1.4  Score=30.29  Aligned_cols=19  Identities=11%  Similarity=0.132  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        29 i~G~nGsGKSTLl~~l~G~   47 (213)
T TIGR01277        29 IMGPSGAGKSTLLNLIAGF   47 (213)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999998664


No 210
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=77.96  E-value=1.4  Score=30.09  Aligned_cols=19  Identities=11%  Similarity=0.153  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++...
T Consensus        29 l~G~nGsGKSTLl~~l~gl   47 (211)
T cd03298          29 IVGPSGSGKSTLLNLIAGF   47 (211)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 211
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=77.95  E-value=1.4  Score=30.78  Aligned_cols=18  Identities=11%  Similarity=0.124  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        32 i~G~nGsGKSTLl~~l~G   49 (236)
T TIGR03864        32 LLGPNGAGKSTLFSLLTR   49 (236)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 212
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=77.90  E-value=0.91  Score=35.80  Aligned_cols=20  Identities=25%  Similarity=0.268  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||+|||-..++++.++
T Consensus       381 IvG~SGsGKSTL~~lL~g~~  400 (588)
T PRK11174        381 LVGPSGAGKTSLLNALLGFL  400 (588)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            45999999999999999976


No 213
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=77.85  E-value=1.4  Score=30.42  Aligned_cols=20  Identities=10%  Similarity=0.079  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-.-+++.-.+
T Consensus        31 i~G~nGsGKSTLl~~i~G~~   50 (227)
T cd03260          31 LIGPSGCGKSTLLRLLNRLN   50 (227)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            46999999999999887654


No 214
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=77.73  E-value=1.8  Score=30.52  Aligned_cols=20  Identities=20%  Similarity=0.174  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|+|||..+..++...
T Consensus        26 I~G~pGsGKT~la~~~l~~~   45 (237)
T TIGR03877        26 LSGGPGTGKSIFSQQFLWNG   45 (237)
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            57999999999877665543


No 215
>PRK13873 conjugal transfer ATPase TrbE; Provisional
Probab=77.71  E-value=1.7  Score=36.33  Aligned_cols=22  Identities=18%  Similarity=0.212  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.||+|||...++++..+..
T Consensus       446 I~G~tGsGKS~l~~~l~~~~~~  467 (811)
T PRK13873        446 VVGPTGAGKSVLLALMALQFRR  467 (811)
T ss_pred             EECCCCCCHHHHHHHHHHHhhh
Confidence            4699999999999998775543


No 216
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=77.70  E-value=1.4  Score=30.51  Aligned_cols=20  Identities=20%  Similarity=0.105  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||...+++.-.+
T Consensus        38 l~G~nGsGKSTLlk~l~G~~   57 (226)
T cd03234          38 ILGSSGSGKTTLLDAISGRV   57 (226)
T ss_pred             EECCCCCCHHHHHHHHhCcc
Confidence            46999999999999887654


No 217
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=77.70  E-value=1.4  Score=31.00  Aligned_cols=19  Identities=16%  Similarity=0.137  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||...+++.-.
T Consensus        36 I~G~nGsGKSTLl~~i~G~   54 (251)
T PRK14244         36 FIGPSGCGKSTFLRCFNRM   54 (251)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            4699999999999988653


No 218
>PLN02165 adenylate isopentenyltransferase
Probab=77.62  E-value=1.5  Score=33.73  Aligned_cols=20  Identities=15%  Similarity=0.210  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.||+|||..+..+.+.+
T Consensus        48 IiGPTGSGKStLA~~LA~~l   67 (334)
T PLN02165         48 IMGATGSGKSRLSVDLATRF   67 (334)
T ss_pred             EECCCCCcHHHHHHHHHHHc
Confidence            57999999999998876654


No 219
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=77.58  E-value=1.8  Score=29.56  Aligned_cols=18  Identities=17%  Similarity=0.137  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |-||+|+||+.+++.|-.
T Consensus        27 I~GE~GtGK~~lA~~IH~   44 (168)
T PF00158_consen   27 ITGETGTGKELLARAIHN   44 (168)
T ss_dssp             EECSTTSSHHHHHHHHHH
T ss_pred             EEcCCCCcHHHHHHHHHH
Confidence            359999999999998833


No 220
>PRK08356 hypothetical protein; Provisional
Probab=77.54  E-value=1.4  Score=30.11  Aligned_cols=18  Identities=17%  Similarity=0.087  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|.+||||+..++++-.
T Consensus        10 ~~G~~gsGK~t~a~~l~~   27 (195)
T PRK08356         10 VVGKIAAGKTTVAKFFEE   27 (195)
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999998854


No 221
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=77.46  E-value=1.5  Score=29.82  Aligned_cols=19  Identities=16%  Similarity=0.151  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        31 i~G~nGsGKSTLl~~l~G~   49 (198)
T TIGR01189        31 VTGPNGIGKTTLLRILAGL   49 (198)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999987653


No 222
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=77.40  E-value=1.4  Score=30.90  Aligned_cols=19  Identities=16%  Similarity=0.170  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~i~G~   52 (250)
T PRK14247         34 LMGPSGSGKSTLLRVFNRL   52 (250)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988653


No 223
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=77.30  E-value=2.3  Score=29.36  Aligned_cols=19  Identities=5%  Similarity=0.003  Sum_probs=16.9

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|+|||-..+.+.+.+
T Consensus        48 ~G~~G~GKT~La~ai~~~~   66 (227)
T PRK08903         48 WGEAGSGRSHLLQALVADA   66 (227)
T ss_pred             ECCCCCCHHHHHHHHHHHH
Confidence            5999999999999888765


No 224
>CHL00095 clpC Clp protease ATP binding subunit
Probab=77.25  E-value=1.7  Score=36.46  Aligned_cols=22  Identities=18%  Similarity=0.185  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|+||.|||++++.+.++|..
T Consensus       544 f~Gp~GvGKt~lA~~LA~~l~~  565 (821)
T CHL00095        544 FSGPTGVGKTELTKALASYFFG  565 (821)
T ss_pred             EECCCCCcHHHHHHHHHHHhcC
Confidence            3699999999999999998853


No 225
>PRK06761 hypothetical protein; Provisional
Probab=77.22  E-value=1.6  Score=32.67  Aligned_cols=22  Identities=14%  Similarity=0.051  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.+|+|||-+.+.+..+|..
T Consensus         8 I~G~~GsGKTTla~~L~~~L~~   29 (282)
T PRK06761          8 IEGLPGFGKSTTAKMLNDILSQ   29 (282)
T ss_pred             EECCCCCCHHHHHHHHHHhcCc
Confidence            4799999999999999998853


No 226
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=77.22  E-value=1.4  Score=30.57  Aligned_cols=19  Identities=11%  Similarity=0.107  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-.-+++.-.
T Consensus        31 i~G~nGsGKSTLl~~l~Gl   49 (243)
T TIGR01978        31 IMGPNGSGKSTLSKTIAGH   49 (243)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988654


No 227
>PRK06217 hypothetical protein; Validated
Probab=77.19  E-value=1.7  Score=29.30  Aligned_cols=20  Identities=15%  Similarity=0.185  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|-+|||||-.++.+...|
T Consensus         6 i~G~~GsGKSTla~~L~~~l   25 (183)
T PRK06217          6 ITGASGSGTTTLGAALAERL   25 (183)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            46999999999999887754


No 228
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=77.17  E-value=1.5  Score=29.83  Aligned_cols=18  Identities=22%  Similarity=0.198  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        32 l~G~nGsGKSTLl~~i~G   49 (200)
T PRK13540         32 LKGSNGAGKTTLLKLIAG   49 (200)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998865


No 229
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=77.16  E-value=1.5  Score=29.81  Aligned_cols=19  Identities=16%  Similarity=0.265  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        31 l~G~nGsGKSTLl~~l~G~   49 (213)
T cd03262          31 IIGPSGSGKSTLLRCINLL   49 (213)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999998888653


No 230
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=77.11  E-value=1.5  Score=30.24  Aligned_cols=19  Identities=11%  Similarity=0.149  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        39 l~G~nGsGKSTLl~~i~G~   57 (224)
T TIGR02324        39 LSGPSGAGKSTLLKSLYAN   57 (224)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988664


No 231
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=77.10  E-value=1.5  Score=30.61  Aligned_cols=19  Identities=11%  Similarity=0.111  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        16 i~G~nGsGKSTLl~~l~Gl   34 (230)
T TIGR01184        16 LIGHSGCGKSTLLNLISGL   34 (230)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988654


No 232
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=76.98  E-value=1.9  Score=31.71  Aligned_cols=22  Identities=27%  Similarity=0.194  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|++|.|||-+.+.++..|..
T Consensus        45 I~G~~GtGKT~l~~~~~~~l~~   66 (365)
T TIGR02928        45 IYGKTGTGKTAVTKYVMKELEE   66 (365)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999999998754


No 233
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=76.95  E-value=1.5  Score=30.08  Aligned_cols=19  Identities=16%  Similarity=0.289  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        36 i~G~nGsGKSTLl~~l~G~   54 (228)
T cd03257          36 LVGESGSGKSTLARAILGL   54 (228)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 234
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=76.87  E-value=1.7  Score=36.48  Aligned_cols=19  Identities=32%  Similarity=0.246  Sum_probs=17.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|+||.|||++++.+-+.|
T Consensus       494 ~GP~GvGKT~lAk~LA~~l  512 (758)
T PRK11034        494 AGPTGVGKTEVTVQLSKAL  512 (758)
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            6999999999999988876


No 235
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=76.85  E-value=1.5  Score=30.53  Aligned_cols=19  Identities=21%  Similarity=0.240  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||..-+++.--
T Consensus        17 i~G~nGsGKSTLl~~l~Gl   35 (230)
T TIGR02770        17 LVGESGSGKSLTCLAILGL   35 (230)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988653


No 236
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=76.73  E-value=2.2  Score=30.70  Aligned_cols=18  Identities=22%  Similarity=0.185  Sum_probs=15.7

Q ss_pred             CCCcCCchHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~   19 (80)
                      -|++|.|||.+++.+-+.
T Consensus        27 ~G~~GtGKT~lA~~la~~   44 (262)
T TIGR02640        27 RGPAGTGKTTLAMHVARK   44 (262)
T ss_pred             EcCCCCCHHHHHHHHHHH
Confidence            599999999999988664


No 237
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=76.71  E-value=3.4  Score=36.92  Aligned_cols=20  Identities=30%  Similarity=0.227  Sum_probs=13.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|+||+|||..   +=+++...
T Consensus        94 I~GeTGSGKTTq---lPq~lle~  113 (1294)
T PRK11131         94 VAGETGSGKTTQ---LPKICLEL  113 (1294)
T ss_pred             EECCCCCCHHHH---HHHHHHHc
Confidence            479999999983   34444443


No 238
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=76.70  E-value=1.9  Score=28.55  Aligned_cols=24  Identities=17%  Similarity=0.155  Sum_probs=20.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      +.|.+++|||-....++.+|....
T Consensus         5 VvG~~~sGKTTl~~~Li~~l~~~g   28 (140)
T PF03205_consen    5 VVGPKNSGKTTLIRKLINELKRRG   28 (140)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHHhHcC
Confidence            358999999999999999997544


No 239
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=76.67  E-value=1.5  Score=30.53  Aligned_cols=19  Identities=11%  Similarity=0.158  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        32 l~G~nGsGKSTLl~~l~G~   50 (240)
T PRK09493         32 IIGPSGSGKSTLLRCINKL   50 (240)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988764


No 240
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=76.61  E-value=1.5  Score=30.80  Aligned_cols=18  Identities=11%  Similarity=0.276  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (252)
T TIGR03005        31 LIGPSGSGKSTILRILMT   48 (252)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 241
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=76.61  E-value=1.6  Score=29.71  Aligned_cols=18  Identities=22%  Similarity=0.183  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (208)
T cd03268          31 FLGPNGAGKTTTMKIILG   48 (208)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 242
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=76.61  E-value=1.6  Score=30.37  Aligned_cols=19  Identities=16%  Similarity=0.155  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        40 l~G~nGsGKSTLl~~l~Gl   58 (233)
T PRK11629         40 IVGSSGSGKSTLLHLLGGL   58 (233)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988653


No 243
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=76.55  E-value=1.6  Score=29.49  Aligned_cols=18  Identities=17%  Similarity=0.259  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +-|++|+|||-.-+++.-
T Consensus        29 i~G~nGsGKSTLl~~l~G   46 (206)
T TIGR03608        29 IIGESGSGKSTLLNIIGL   46 (206)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            359999999999998865


No 244
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=76.47  E-value=1.6  Score=29.56  Aligned_cols=18  Identities=11%  Similarity=0.124  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-..+++.-
T Consensus        31 l~G~nGsGKSTLl~~l~G   48 (195)
T PRK13541         31 IKGANGCGKSSLLRMIAG   48 (195)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            369999999999998865


No 245
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=76.46  E-value=1.4  Score=34.70  Aligned_cols=20  Identities=10%  Similarity=0.165  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||-..++++..+
T Consensus       374 IvG~sGsGKSTLl~ll~gl~  393 (582)
T PRK11176        374 LVGRSGSGKSTIANLLTRFY  393 (582)
T ss_pred             EECCCCCCHHHHHHHHHhcc
Confidence            46999999999999998854


No 246
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=76.46  E-value=1.6  Score=30.58  Aligned_cols=19  Identities=21%  Similarity=0.282  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~l~G~   52 (250)
T PRK11264         34 IIGPSGSGKTTLLRCINLL   52 (250)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988653


No 247
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=76.43  E-value=1.6  Score=31.45  Aligned_cols=19  Identities=21%  Similarity=0.064  Sum_probs=16.1

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|+.|.||||+.|-+-+.|
T Consensus        38 ~GpagtGKtetik~La~~l   56 (231)
T PF12774_consen   38 SGPAGTGKTETIKDLARAL   56 (231)
T ss_dssp             ESSTTSSHHHHHHHHHHCT
T ss_pred             cCCCCCCchhHHHHHHHHh
Confidence            5999999999999876644


No 248
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=76.42  E-value=1.6  Score=30.35  Aligned_cols=18  Identities=11%  Similarity=0.124  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 l~G~nGsGKSTLl~~l~G   50 (243)
T TIGR02315        33 IIGPSGAGKSTLLRCINR   50 (243)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999988754


No 249
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=76.39  E-value=1.6  Score=29.76  Aligned_cols=18  Identities=17%  Similarity=0.209  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (205)
T cd03226          31 LTGKNGAGKTTLAKILAG   48 (205)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998755


No 250
>PRK04040 adenylate kinase; Provisional
Probab=76.37  E-value=1.8  Score=29.88  Aligned_cols=20  Identities=25%  Similarity=0.089  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+...|
T Consensus         7 v~G~pG~GKtt~~~~l~~~l   26 (188)
T PRK04040          7 VTGVPGVGKTTVLNKALEKL   26 (188)
T ss_pred             EEeCCCCCHHHHHHHHHHHh
Confidence            46999999999999988876


No 251
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=76.34  E-value=1.9  Score=29.42  Aligned_cols=20  Identities=10%  Similarity=0.145  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|.+|+|||-+.+.+...+
T Consensus         8 l~G~sGsGKSTl~~~la~~l   27 (176)
T PRK09825          8 LMGVSGSGKSLIGSKIAALF   27 (176)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            35899999999999887754


No 252
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=76.33  E-value=1.6  Score=30.88  Aligned_cols=19  Identities=16%  Similarity=0.118  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        37 i~G~nGsGKSTLl~~l~Gl   55 (258)
T PRK11701         37 IVGESGSGKTTLLNALSAR   55 (258)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 253
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene of Enterococcus faecalis encodes a bifunctional enzyme: the HPr kinase/phosphatase
Probab=76.30  E-value=1.6  Score=33.22  Aligned_cols=19  Identities=16%  Similarity=0.163  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|+||+|||+++--++..
T Consensus       151 i~G~sg~GKS~lal~Li~r  169 (304)
T TIGR00679       151 ITGKSGVGKSETALELINR  169 (304)
T ss_pred             EEcCCCCCHHHHHHHHHHc
Confidence            5799999999998866653


No 254
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=76.30  E-value=1.7  Score=32.86  Aligned_cols=17  Identities=12%  Similarity=0.061  Sum_probs=14.7

Q ss_pred             CCCcCCchHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~   18 (80)
                      -||||+||+-++|.|.-
T Consensus        39 VGESGSGKSLiAK~Ic~   55 (330)
T COG4170          39 VGESGSGKSLIAKAICG   55 (330)
T ss_pred             eccCCCchhHHHHHHhc
Confidence            59999999999998743


No 255
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=76.25  E-value=1.6  Score=30.44  Aligned_cols=19  Identities=16%  Similarity=0.197  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        33 i~G~nGsGKSTLl~~l~Gl   51 (239)
T cd03296          33 LLGPSGSGKTTLLRLIAGL   51 (239)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 256
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=76.23  E-value=1.4  Score=31.42  Aligned_cols=18  Identities=11%  Similarity=0.089  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||...+++.-
T Consensus        42 i~G~nGsGKSTLl~~l~G   59 (265)
T PRK10575         42 LIGHNGSGKSTLLKMLGR   59 (265)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999998865


No 257
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=76.21  E-value=1.6  Score=29.24  Aligned_cols=18  Identities=11%  Similarity=0.069  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        30 l~G~nGsGKStLl~~i~G   47 (180)
T cd03214          30 ILGPNGAGKSTLLKTLAG   47 (180)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999998888755


No 258
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=76.18  E-value=1.7  Score=30.38  Aligned_cols=18  Identities=22%  Similarity=0.281  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-..+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (242)
T PRK11124         33 LLGPSGAGKSSLLRVLNL   50 (242)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 259
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=76.17  E-value=1.6  Score=30.19  Aligned_cols=19  Identities=16%  Similarity=0.134  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        31 l~G~nGsGKSTLl~~l~G~   49 (230)
T TIGR03410        31 VLGRNGVGKTTLLKTLMGL   49 (230)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999987653


No 260
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=76.07  E-value=1.7  Score=31.66  Aligned_cols=17  Identities=18%  Similarity=0.274  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      |.|+||+||+...|.+-
T Consensus        34 itGPSG~GKStllk~va   50 (223)
T COG4619          34 ITGPSGCGKSTLLKIVA   50 (223)
T ss_pred             EeCCCCccHHHHHHHHH
Confidence            56999999999999773


No 261
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=76.04  E-value=2.2  Score=29.72  Aligned_cols=22  Identities=14%  Similarity=0.147  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.+|+|||..+..++...+.
T Consensus        30 i~G~~GsGKt~l~~~~~~~~~~   51 (234)
T PRK06067         30 IEGDHGTGKSVLSQQFVYGALK   51 (234)
T ss_pred             EECCCCCChHHHHHHHHHHHHh
Confidence            4799999999999888665443


No 262
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=75.87  E-value=1.7  Score=29.78  Aligned_cols=18  Identities=17%  Similarity=0.189  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (207)
T PRK13539         33 LTGPNGSGKTTLLRLIAG   50 (207)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 263
>PRK10908 cell division protein FtsE; Provisional
Probab=75.84  E-value=1.7  Score=29.97  Aligned_cols=18  Identities=11%  Similarity=0.167  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (222)
T PRK10908         33 LTGHSGAGKSTLLKLICG   50 (222)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            459999999999998864


No 264
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=75.83  E-value=1.7  Score=29.70  Aligned_cols=19  Identities=16%  Similarity=0.190  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        31 i~G~nGsGKSTLl~~l~G~   49 (201)
T cd03231          31 VTGPNGSGKTTLLRILAGL   49 (201)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999987653


No 265
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=75.83  E-value=2.1  Score=30.83  Aligned_cols=23  Identities=17%  Similarity=0.098  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +-|++|+|||.+...+.+.+...
T Consensus        41 l~Gp~GtGKT~la~~~~~~l~~~   63 (337)
T PRK12402         41 VQGPPGSGKTAAVRALARELYGD   63 (337)
T ss_pred             EECCCCCCHHHHHHHHHHHhcCc
Confidence            35999999999999998887543


No 266
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=75.76  E-value=1.7  Score=30.18  Aligned_cols=19  Identities=11%  Similarity=0.233  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +-|++|+|||-.-+++.-.
T Consensus        31 l~G~nGsGKSTLl~~l~G~   49 (235)
T cd03261          31 IIGPSGSGKSTLLRLIVGL   49 (235)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            3599999999999988653


No 267
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=75.72  E-value=1.7  Score=30.54  Aligned_cols=18  Identities=17%  Similarity=0.150  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (246)
T PRK14269         33 LIGASGCGKSTFLRCFNR   50 (246)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998865


No 268
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=75.66  E-value=1.8  Score=29.91  Aligned_cols=19  Identities=11%  Similarity=0.200  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        41 i~G~nGsGKSTLl~~i~Gl   59 (228)
T PRK10584         41 LIGESGSGKSTLLAILAGL   59 (228)
T ss_pred             EECCCCCCHHHHHHHHHcC
Confidence            4699999999999988654


No 269
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=75.61  E-value=1.7  Score=30.86  Aligned_cols=19  Identities=11%  Similarity=0.050  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        44 i~G~nGsGKSTLl~~l~Gl   62 (260)
T PRK10744         44 FIGPSGCGKSTLLRTFNRM   62 (260)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999998654


No 270
>PLN02200 adenylate kinase family protein
Probab=75.59  E-value=2.1  Score=30.64  Aligned_cols=20  Identities=10%  Similarity=0.008  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||..++.+.+.+
T Consensus        48 I~G~PGSGKsT~a~~La~~~   67 (234)
T PLN02200         48 VLGGPGSGKGTQCEKIVETF   67 (234)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999988777654


No 271
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=75.52  E-value=1.8  Score=29.00  Aligned_cols=18  Identities=11%  Similarity=0.130  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKStLl~~l~G   50 (178)
T cd03247          33 LLGRSGSGKSTLLQLLTG   50 (178)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999998888754


No 272
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=75.42  E-value=2.3  Score=30.20  Aligned_cols=21  Identities=14%  Similarity=0.191  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|+|||..+..++..++
T Consensus        29 i~G~~G~GKTtl~~~~~~~~~   49 (230)
T PRK08533         29 IEGDESTGKSILSQRLAYGFL   49 (230)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            469999999999644433343


No 273
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=75.36  E-value=1.8  Score=30.12  Aligned_cols=19  Identities=21%  Similarity=0.233  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||...+++...
T Consensus        11 l~G~nGsGKSTLl~~l~G~   29 (223)
T TIGR03771        11 LLGPNGAGKTTLLRAILGL   29 (223)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 274
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=75.34  E-value=1.8  Score=30.44  Aligned_cols=19  Identities=11%  Similarity=0.034  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~l~G~   52 (253)
T TIGR02323        34 IVGESGSGKSTLLGCLAGR   52 (253)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999998877653


No 275
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=75.29  E-value=2.1  Score=33.22  Aligned_cols=22  Identities=14%  Similarity=0.042  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+.|+|||.++..+.+.|-.
T Consensus        83 L~GPPGsGKStla~~La~~l~~  104 (361)
T smart00763       83 LLGPVGGGKSSLVECLKRGLEE  104 (361)
T ss_pred             EECCCCCCHHHHHHHHHHHHhh
Confidence            4799999999999999887744


No 276
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=75.28  E-value=1.8  Score=30.43  Aligned_cols=18  Identities=17%  Similarity=0.169  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        37 i~G~nGsGKSTLl~~l~G   54 (253)
T PRK14242         37 LIGPSGCGKSTFLRCLNR   54 (253)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            469999999999998865


No 277
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=75.24  E-value=1.9  Score=31.62  Aligned_cols=18  Identities=22%  Similarity=0.224  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||.+.+-.++
T Consensus        38 l~G~~GtGKT~li~~~l~   55 (272)
T PF12775_consen   38 LVGPSGTGKTSLIQNFLS   55 (272)
T ss_dssp             EESSTTSSHHHHHHHHHH
T ss_pred             EECCCCCchhHHHHhhhc
Confidence            369999999998887665


No 278
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=75.13  E-value=2  Score=36.12  Aligned_cols=22  Identities=23%  Similarity=0.208  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|.|||++++.+-.++..
T Consensus       600 f~Gp~GvGKt~lA~~La~~l~~  621 (852)
T TIGR03346       600 FLGPTGVGKTELAKALAEFLFD  621 (852)
T ss_pred             EEcCCCCCHHHHHHHHHHHhcC
Confidence            3699999999999999887753


No 279
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=75.12  E-value=1.8  Score=30.09  Aligned_cols=19  Identities=11%  Similarity=0.228  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        33 i~G~nGsGKSTLl~~l~Gl   51 (237)
T cd03252          33 IVGRSGSGKSTLTKLIQRF   51 (237)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999998888643


No 280
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=75.12  E-value=2.1  Score=36.26  Aligned_cols=21  Identities=24%  Similarity=0.260  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|.|||++++.+-..|.
T Consensus       601 f~Gp~GvGKT~lA~~La~~l~  621 (852)
T TIGR03345       601 LVGPSGVGKTETALALAELLY  621 (852)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            369999999999999888774


No 281
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=75.11  E-value=1.8  Score=30.33  Aligned_cols=18  Identities=11%  Similarity=0.119  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        36 i~G~nGsGKSTLl~~l~G   53 (252)
T PRK14239         36 LIGPSGSGKSTLLRSINR   53 (252)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998854


No 282
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=75.08  E-value=1.9  Score=30.24  Aligned_cols=19  Identities=11%  Similarity=0.202  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+.+.-.
T Consensus        31 l~G~nGsGKSTLl~~i~G~   49 (237)
T TIGR00968        31 LLGPSGSGKSTLLRIIAGL   49 (237)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4799999999999988653


No 283
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=75.07  E-value=1.8  Score=28.83  Aligned_cols=18  Identities=22%  Similarity=0.270  Sum_probs=15.0

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKStLl~~l~G   48 (173)
T cd03230          31 LLGPNGAGKTTLIKIILG   48 (173)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999998887744


No 284
>PF02367 UPF0079:  Uncharacterised P-loop hydrolase UPF0079;  InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements [].; PDB: 1HTW_A 1FL9_A.
Probab=75.06  E-value=2.3  Score=28.10  Aligned_cols=18  Identities=28%  Similarity=0.185  Sum_probs=16.6

Q ss_pred             CCcCCchHHHHHHHHHHH
Q psy17057          3 GSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         3 G~sg~gKte~~k~~l~~l   20 (80)
                      |+=|||||..++-+++.|
T Consensus        22 GdLGaGKTtf~r~l~~~l   39 (123)
T PF02367_consen   22 GDLGAGKTTFVRGLARAL   39 (123)
T ss_dssp             ESTTSSHHHHHHHHHHHT
T ss_pred             CCCCCCHHHHHHHHHHHc
Confidence            788999999999999987


No 285
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=75.04  E-value=1.9  Score=26.86  Aligned_cols=17  Identities=18%  Similarity=0.206  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      +.|.+|+|||-..+.+.
T Consensus         4 l~G~~g~GKTtL~~~l~   20 (170)
T cd01876           4 FAGRSNVGKSSLINALT   20 (170)
T ss_pred             EEcCCCCCHHHHHHHHh
Confidence            46999999999999887


No 286
>TIGR00174 miaA tRNA isopentenyltransferase (miaA). Catalyzes the first step in the modification of an adenosine near the anticodon to 2-methylthio-N6-isopentyladenosine.
Probab=75.01  E-value=1.8  Score=32.36  Aligned_cols=20  Identities=20%  Similarity=0.283  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||..+.-+.+.+
T Consensus         4 i~G~t~~GKs~la~~l~~~~   23 (287)
T TIGR00174         4 IMGPTAVGKSQLAIQLAKKL   23 (287)
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            57999999999998887754


No 287
>PRK14530 adenylate kinase; Provisional
Probab=74.97  E-value=2.3  Score=29.38  Aligned_cols=20  Identities=10%  Similarity=-0.019  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|||||-..+.+.+.+
T Consensus         8 i~G~pGsGKsT~~~~La~~~   27 (215)
T PRK14530          8 LLGAPGAGKGTQSSNLAEEF   27 (215)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999987765


No 288
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=74.85  E-value=2.3  Score=30.01  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|||||-.++.+.++|-
T Consensus         4 l~G~pGSGKST~a~~La~~l~   24 (249)
T TIGR03574         4 LTGLPGVGKSTFSKELAKKLS   24 (249)
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            479999999999999988874


No 289
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Probab=74.82  E-value=1.7  Score=34.13  Aligned_cols=20  Identities=15%  Similarity=0.248  Sum_probs=17.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||-..++++..+
T Consensus       371 IvG~sGsGKSTLlklL~gl~  390 (576)
T TIGR02204       371 LVGPSGAGKSTLFQLLLRFY  390 (576)
T ss_pred             EECCCCCCHHHHHHHHHhcc
Confidence            46999999999999998754


No 290
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=74.78  E-value=1.9  Score=29.77  Aligned_cols=18  Identities=17%  Similarity=0.141  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 l~G~nGsGKSTLl~~l~G   48 (232)
T cd03218          31 LLGPNGAGKTTTFYMIVG   48 (232)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999888854


No 291
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=74.77  E-value=1.8  Score=30.66  Aligned_cols=19  Identities=16%  Similarity=0.188  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||..-+++.-.
T Consensus        43 i~G~nGsGKSTLl~~i~Gl   61 (258)
T PRK14268         43 LIGPSGCGKSTFIRCLNRM   61 (258)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988653


No 292
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=74.69  E-value=1.9  Score=30.31  Aligned_cols=19  Identities=11%  Similarity=0.076  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        35 l~G~nGsGKSTLl~~l~G~   53 (253)
T PRK14267         35 LMGPSGCGKSTLLRTFNRL   53 (253)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988654


No 293
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=74.66  E-value=1.9  Score=29.96  Aligned_cols=18  Identities=17%  Similarity=0.220  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        38 i~G~nGsGKSTLl~~l~G   55 (225)
T PRK10247         38 ITGPSGCGKSTLLKIVAS   55 (225)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998765


No 294
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=74.66  E-value=1.9  Score=29.49  Aligned_cols=18  Identities=17%  Similarity=0.032  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +-|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (220)
T cd03263          33 LLGHNGAGKTTTLKMLTG   50 (220)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 295
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=74.61  E-value=1.8  Score=30.34  Aligned_cols=19  Identities=16%  Similarity=0.025  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        36 l~G~nGsGKSTLl~~l~Gl   54 (255)
T PRK11300         36 LIGPNGAGKTTVFNCLTGF   54 (255)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 296
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=74.55  E-value=1.9  Score=31.20  Aligned_cols=18  Identities=28%  Similarity=0.244  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||..-+++.-
T Consensus        52 I~G~nGsGKSTLl~~l~G   69 (276)
T PRK14271         52 LMGPTGSGKTTFLRTLNR   69 (276)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998865


No 297
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=74.53  E-value=1.9  Score=30.52  Aligned_cols=20  Identities=10%  Similarity=0.012  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||-.-+++.-.+
T Consensus        35 i~G~nGsGKSTLl~~laGl~   54 (258)
T PRK14241         35 FIGPSGCGKSTVLRTLNRMH   54 (258)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            46999999999999986643


No 298
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=74.49  E-value=1.9  Score=30.26  Aligned_cols=18  Identities=17%  Similarity=0.169  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        34 i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14240         34 LIGPSGCGKSTFLRTLNR   51 (250)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999999865


No 299
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=74.46  E-value=2  Score=28.65  Aligned_cols=19  Identities=16%  Similarity=0.301  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+.+.-.
T Consensus        33 i~G~nGsGKStLl~~l~G~   51 (173)
T cd03246          33 IIGPSGSGKSTLARLILGL   51 (173)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            4699999999999988653


No 300
>PRK10646 ADP-binding protein; Provisional
Probab=74.37  E-value=2.7  Score=28.80  Aligned_cols=20  Identities=30%  Similarity=0.155  Sum_probs=18.1

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      .|.=|||||..++-+++.|-
T Consensus        34 ~GdLGaGKTtf~rgl~~~Lg   53 (153)
T PRK10646         34 YGDLGAGKTTFSRGFLQALG   53 (153)
T ss_pred             ECCCCCCHHHHHHHHHHHcC
Confidence            48889999999999999884


No 301
>PRK13764 ATPase; Provisional
Probab=74.37  E-value=2.2  Score=35.15  Aligned_cols=22  Identities=18%  Similarity=0.240  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.||+|||-+.+-++.++..
T Consensus       262 IsG~TGSGKTTll~AL~~~i~~  283 (602)
T PRK13764        262 IAGAPGAGKSTFAQALAEFYAD  283 (602)
T ss_pred             EECCCCCCHHHHHHHHHHHHhh
Confidence            5899999999999998888753


No 302
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=74.32  E-value=2  Score=28.57  Aligned_cols=18  Identities=11%  Similarity=0.124  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 l~G~nGsGKSTLl~~i~G   48 (163)
T cd03216          31 LLGENGAGKSTLMKILSG   48 (163)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 303
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=74.16  E-value=1.9  Score=30.00  Aligned_cols=19  Identities=16%  Similarity=0.132  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 l~G~nGsGKSTLl~~i~G~   52 (238)
T cd03249          34 LVGSSGCGKSTVVSLLERF   52 (238)
T ss_pred             EEeCCCCCHHHHHHHHhcc
Confidence            4699999999999988654


No 304
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=74.11  E-value=2  Score=30.26  Aligned_cols=18  Identities=11%  Similarity=0.045  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-..+++.-
T Consensus        37 i~G~nGsGKSTLl~~l~G   54 (253)
T PRK14261         37 LIGPSGCGKSTLLRCFNR   54 (253)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999999864


No 305
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=74.04  E-value=2.8  Score=30.24  Aligned_cols=20  Identities=15%  Similarity=-0.037  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|.|||...+.+.+.+
T Consensus        48 l~G~~G~GKT~la~~l~~~~   67 (316)
T PHA02544         48 HSPSPGTGKTTVAKALCNEV   67 (316)
T ss_pred             eeCcCCCCHHHHHHHHHHHh
Confidence            36999999999999887764


No 306
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=74.02  E-value=1.9  Score=32.15  Aligned_cols=16  Identities=13%  Similarity=0.052  Sum_probs=14.3

Q ss_pred             CCCCcCCchHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVV   16 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~   16 (80)
                      |.|.+|+|||.+.+.+
T Consensus        11 i~G~~GsGKtt~~~~l   26 (288)
T PRK05416         11 VTGLSGAGKSVALRAL   26 (288)
T ss_pred             EECCCCCcHHHHHHHH
Confidence            4699999999999977


No 307
>PRK04328 hypothetical protein; Provisional
Probab=74.01  E-value=2.7  Score=30.10  Aligned_cols=20  Identities=20%  Similarity=0.174  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|+|||.....++..-
T Consensus        28 i~G~pGsGKT~l~~~fl~~~   47 (249)
T PRK04328         28 LSGGPGTGKSIFSQQFLWNG   47 (249)
T ss_pred             EEcCCCCCHHHHHHHHHHHH
Confidence            47999999999877665543


No 308
>PRK13768 GTPase; Provisional
Probab=74.01  E-value=2.6  Score=30.32  Aligned_cols=23  Identities=17%  Similarity=0.115  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|+.|+|||-+..-+..+|...
T Consensus         7 v~G~~G~GKTt~~~~~~~~l~~~   29 (253)
T PRK13768          7 FLGTAGSGKTTLTKALSDWLEEQ   29 (253)
T ss_pred             EECCCCccHHHHHHHHHHHHHhc
Confidence            47999999999999888888653


No 309
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=73.99  E-value=1.9  Score=31.17  Aligned_cols=19  Identities=16%  Similarity=0.120  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        42 l~G~nGsGKSTLl~~l~Gl   60 (289)
T PRK13645         42 VIGTTGSGKSTMIQLTNGL   60 (289)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988664


No 310
>PF08423 Rad51:  Rad51;  InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51. It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....
Probab=73.97  E-value=1.8  Score=31.37  Aligned_cols=17  Identities=24%  Similarity=0.298  Sum_probs=13.8

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      |.|++|+|||.....+.
T Consensus        43 i~G~~gsGKTql~l~l~   59 (256)
T PF08423_consen   43 IVGESGSGKTQLCLQLA   59 (256)
T ss_dssp             EEESTTSSHHHHHHHHH
T ss_pred             EEEecccccchHHHHHH
Confidence            57999999999886543


No 311
>PRK13947 shikimate kinase; Provisional
Probab=73.96  E-value=2.6  Score=27.57  Aligned_cols=20  Identities=25%  Similarity=0.122  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+.+.+...|
T Consensus         6 l~G~~GsGKst~a~~La~~l   25 (171)
T PRK13947          6 LIGFMGTGKTTVGKRVATTL   25 (171)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            35999999999999887654


No 312
>PRK13946 shikimate kinase; Provisional
Probab=73.85  E-value=2.4  Score=28.74  Aligned_cols=20  Identities=15%  Similarity=0.124  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|-+|+|||.+.+.+-+.|
T Consensus        15 l~G~~GsGKsti~~~LA~~L   34 (184)
T PRK13946         15 LVGLMGAGKSTVGRRLATML   34 (184)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            35899999999999998765


No 313
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=73.84  E-value=2.1  Score=29.35  Aligned_cols=18  Identities=17%  Similarity=0.130  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        36 i~G~nGsGKSTLl~~i~G   53 (221)
T TIGR02211        36 IVGSSGSGKSTLLHLLGG   53 (221)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 314
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=73.76  E-value=2.1  Score=30.15  Aligned_cols=19  Identities=16%  Similarity=0.188  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        35 i~G~nGsGKSTLl~~l~G~   53 (251)
T PRK14270         35 LIGPSGCGKSTFLRCLNRM   53 (251)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            4699999999999998653


No 315
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=73.59  E-value=2.1  Score=28.49  Aligned_cols=19  Identities=11%  Similarity=0.137  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-..+++.-.
T Consensus        32 i~G~nGsGKSTLl~~l~G~   50 (166)
T cd03223          32 ITGPSGTGKSSLFRALAGL   50 (166)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988653


No 316
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=73.59  E-value=2  Score=30.07  Aligned_cols=18  Identities=17%  Similarity=0.041  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        52 i~G~NGsGKSTLl~~i~G   69 (236)
T cd03267          52 FIGPNGAGKTTTLKILSG   69 (236)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998864


No 317
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=73.56  E-value=3  Score=28.18  Aligned_cols=19  Identities=16%  Similarity=0.090  Sum_probs=16.5

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|.+|+|||.+.+.+...+
T Consensus        10 iG~~GaGKStl~~~La~~l   28 (172)
T PRK05057         10 VGPMGAGKSTIGRQLAQQL   28 (172)
T ss_pred             ECCCCcCHHHHHHHHHHHc
Confidence            5899999999999987754


No 318
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=73.47  E-value=2.1  Score=30.76  Aligned_cols=20  Identities=10%  Similarity=0.174  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-.-++|.-.+
T Consensus        55 I~G~nGsGKSTLl~~i~Gl~   74 (271)
T PRK14238         55 IIGPSGCGKSTYIKTLNRMV   74 (271)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            46999999999999997654


No 319
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=73.45  E-value=2.2  Score=33.50  Aligned_cols=19  Identities=26%  Similarity=0.247  Sum_probs=16.6

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|+||.|||++++.+...+
T Consensus       122 ~GP~GsGKT~lAraLA~~l  140 (413)
T TIGR00382       122 IGPTGSGKTLLAQTLARIL  140 (413)
T ss_pred             ECCCCcCHHHHHHHHHHhc
Confidence            5999999999999887654


No 320
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=73.41  E-value=2.6  Score=31.32  Aligned_cols=22  Identities=23%  Similarity=0.066  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|++|.|||-+.+.+++.+-.
T Consensus        60 I~G~~GtGKT~l~~~v~~~l~~   81 (394)
T PRK00411         60 IYGPPGTGKTTTVKKVFEELEE   81 (394)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999999988744


No 321
>PRK07952 DNA replication protein DnaC; Validated
Probab=73.39  E-value=2.9  Score=30.41  Aligned_cols=23  Identities=17%  Similarity=0.179  Sum_probs=19.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|.|||-++.-|..+|...
T Consensus       104 l~G~~GtGKThLa~aia~~l~~~  126 (244)
T PRK07952        104 FSGKPGTGKNHLAAAICNELLLR  126 (244)
T ss_pred             EECCCCCCHHHHHHHHHHHHHhc
Confidence            36999999999999999988653


No 322
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=73.38  E-value=2.1  Score=30.08  Aligned_cols=18  Identities=17%  Similarity=0.148  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|.+|+|||-..+++.-
T Consensus        34 i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14245         34 FIGPSGCGKSTFLRLFNR   51 (250)
T ss_pred             EECCCCCCHHHHHHHHhh
Confidence            469999999999999864


No 323
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=73.37  E-value=2.1  Score=29.47  Aligned_cols=19  Identities=16%  Similarity=0.188  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||..-+++.-.
T Consensus        36 I~G~nGsGKStLl~~l~G~   54 (220)
T TIGR02982        36 LTGPSGSGKTTLLTLIGGL   54 (220)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999998888653


No 324
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=73.35  E-value=2.1  Score=30.74  Aligned_cols=18  Identities=11%  Similarity=0.170  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-..+++.-
T Consensus        43 i~G~nGsGKSTLl~~l~G   60 (268)
T PRK10419         43 LLGRSGCGKSTLARLLVG   60 (268)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998754


No 325
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=73.24  E-value=2.3  Score=26.33  Aligned_cols=18  Identities=11%  Similarity=0.113  Sum_probs=14.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|.+|+|||-+...++.
T Consensus         8 ~~G~~g~GKttl~~~l~~   25 (168)
T cd04163           8 IVGRPNVGKSTLLNALVG   25 (168)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            479999999987776543


No 326
>PRK08727 hypothetical protein; Validated
Probab=73.22  E-value=3  Score=29.50  Aligned_cols=22  Identities=18%  Similarity=0.223  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||-....+...+..
T Consensus        46 l~G~~G~GKThL~~a~~~~~~~   67 (233)
T PRK08727         46 LSGPAGTGKTHLALALCAAAEQ   67 (233)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4699999999888877666544


No 327
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=73.17  E-value=2  Score=29.43  Aligned_cols=19  Identities=5%  Similarity=-0.074  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        38 i~G~nGsGKSTLl~~l~G~   56 (202)
T cd03233          38 VLGRPGSGCSTLLKALANR   56 (202)
T ss_pred             EECCCCCCHHHHHHHhccc
Confidence            4699999999999987554


No 328
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=73.12  E-value=2.2  Score=30.52  Aligned_cols=18  Identities=11%  Similarity=0.205  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        40 I~G~nGsGKSTLl~~i~G   57 (269)
T PRK13648         40 IVGHNGSGKSTIAKLMIG   57 (269)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998865


No 329
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=73.10  E-value=2.1  Score=30.01  Aligned_cols=18  Identities=11%  Similarity=0.176  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        34 i~G~nGsGKSTLl~~l~G   51 (241)
T PRK14250         34 IVGPSGAGKSTLIKLINR   51 (241)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999988865


No 330
>KOG0057|consensus
Probab=73.09  E-value=2.5  Score=34.94  Aligned_cols=21  Identities=19%  Similarity=0.213  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||-+-+++++++=
T Consensus       383 IvG~nGsGKSTilr~LlrF~d  403 (591)
T KOG0057|consen  383 IVGSNGSGKSTILRLLLRFFD  403 (591)
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            579999999999999999875


No 331
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=73.00  E-value=2.2  Score=30.46  Aligned_cols=19  Identities=16%  Similarity=0.231  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        42 i~G~nGsGKSTLl~~l~Gl   60 (265)
T TIGR02769        42 LLGRSGCGKSTLARLLLGL   60 (265)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 332
>PRK14738 gmk guanylate kinase; Provisional
Probab=73.00  E-value=2.1  Score=29.69  Aligned_cols=18  Identities=11%  Similarity=0.032  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|.||+|||.+.+.+..
T Consensus        18 i~GpsG~GK~tl~~~L~~   35 (206)
T PRK14738         18 ISGPSGVGKDAVLARMRE   35 (206)
T ss_pred             EECcCCCCHHHHHHHHHh
Confidence            369999999998887765


No 333
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.97  E-value=2.2  Score=30.06  Aligned_cols=19  Identities=16%  Similarity=0.188  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        38 i~G~nGsGKSTLl~~l~Gl   56 (254)
T PRK14273         38 LIGPSGCGKSTFLRTLNRM   56 (254)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988654


No 334
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.90  E-value=2.2  Score=29.88  Aligned_cols=19  Identities=11%  Similarity=0.100  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~l~Gl   52 (249)
T PRK14253         34 LIGPSGCGKSTLLRCLNRM   52 (249)
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            4699999999999988653


No 335
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=72.88  E-value=3.4  Score=29.23  Aligned_cols=20  Identities=20%  Similarity=0.240  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|++|+|||-+...|.--|
T Consensus        30 IvG~NGsGKStll~Ai~~ll   49 (251)
T cd03273          30 ITGLNGSGKSNILDAICFVL   49 (251)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999988765443


No 336
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=72.83  E-value=2.3  Score=29.11  Aligned_cols=18  Identities=17%  Similarity=0.043  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        36 i~G~nGsGKSTLl~~l~G   53 (218)
T cd03266          36 LLGPNGAGKTTTLRMLAG   53 (218)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 337
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.70  E-value=2.2  Score=27.81  Aligned_cols=18  Identities=11%  Similarity=0.130  Sum_probs=14.9

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+.+.-
T Consensus        30 i~G~nGsGKStll~~l~g   47 (157)
T cd00267          30 LVGPNGSGKSTLLRAIAG   47 (157)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999998887744


No 338
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.70  E-value=2.2  Score=29.89  Aligned_cols=20  Identities=15%  Similarity=0.129  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-.-+++.-.+
T Consensus        35 i~G~nGsGKSTLl~~l~Gl~   54 (251)
T PRK14251         35 LIGPSGCGKSTFLRCLNRMN   54 (251)
T ss_pred             EECCCCCCHHHHHHHHhhcc
Confidence            46999999999999887643


No 339
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=72.69  E-value=2.2  Score=30.68  Aligned_cols=19  Identities=11%  Similarity=0.113  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        43 I~G~NGsGKSTLlk~l~Gl   61 (257)
T PRK11247         43 VVGRSGCGKSTLLRLLAGL   61 (257)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988654


No 340
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=72.59  E-value=2.5  Score=32.31  Aligned_cols=24  Identities=21%  Similarity=0.189  Sum_probs=18.5

Q ss_pred             CCCcCCchHHHHHHHHHHHhhhccC
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHEDFG   26 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~~~~   26 (80)
                      -|+||+|||-+-|+|-+ |...+.|
T Consensus        33 iGpSGsGKTTtLkMINr-Liept~G   56 (309)
T COG1125          33 IGPSGSGKTTTLKMINR-LIEPTSG   56 (309)
T ss_pred             ECCCCCcHHHHHHHHhc-ccCCCCc
Confidence            38999999999999976 4444443


No 341
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=72.58  E-value=3.5  Score=29.78  Aligned_cols=24  Identities=13%  Similarity=0.115  Sum_probs=19.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      +.|-||||||-++..+-+-|....
T Consensus        28 ~TGLSGsGKSTiA~ale~~L~~~G   51 (197)
T COG0529          28 FTGLSGSGKSTIANALEEKLFAKG   51 (197)
T ss_pred             eecCCCCCHHHHHHHHHHHHHHcC
Confidence            469999999999999888776543


No 342
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.52  E-value=2.3  Score=30.25  Aligned_cols=20  Identities=15%  Similarity=0.125  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||..-+++...+
T Consensus        38 I~G~nGsGKSTLl~~l~Gl~   57 (261)
T PRK14258         38 IIGPSGCGKSTFLKCLNRMN   57 (261)
T ss_pred             EECCCCCCHHHHHHHHhccc
Confidence            47999999999999887644


No 343
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=72.45  E-value=2.2  Score=29.67  Aligned_cols=18  Identities=17%  Similarity=0.065  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        36 i~G~nGsGKSTLl~~l~G   53 (237)
T PRK11614         36 LIGANGAGKTTLLGTLCG   53 (237)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999998887743


No 344
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=72.44  E-value=2.2  Score=29.69  Aligned_cols=18  Identities=11%  Similarity=0.102  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-..+++.-
T Consensus        53 i~G~nGsGKSTLl~~l~G   70 (224)
T cd03220          53 LIGRNGAGKSTLLRLLAG   70 (224)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 345
>PRK14528 adenylate kinase; Provisional
Probab=72.39  E-value=2.9  Score=28.49  Aligned_cols=20  Identities=15%  Similarity=0.064  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+..++
T Consensus         6 i~G~pGsGKtt~a~~la~~~   25 (186)
T PRK14528          6 FMGPPGAGKGTQAKILCERL   25 (186)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999987654


No 346
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.38  E-value=2.4  Score=30.11  Aligned_cols=20  Identities=15%  Similarity=0.165  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-.-+++.-.+
T Consensus        38 l~G~nGsGKSTLlk~l~Gl~   57 (259)
T PRK14260         38 IIGPSGCGKSTFIKTLNRIS   57 (259)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            46999999999999987643


No 347
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=72.36  E-value=2.4  Score=29.05  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-.-+++.-.
T Consensus        35 i~G~nGsGKSTLl~~l~G~   53 (221)
T cd03244          35 IVGRTGSGKSSLLLALFRL   53 (221)
T ss_pred             EECCCCCCHHHHHHHHHcC
Confidence            4699999999999988653


No 348
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=72.34  E-value=3.1  Score=27.37  Aligned_cols=20  Identities=20%  Similarity=0.262  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|-+|+|||.+.+.+-..|
T Consensus         7 ~~G~~GsGKst~~~~la~~l   26 (171)
T PRK03731          7 LVGARGCGKTTVGMALAQAL   26 (171)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35899999999999887754


No 349
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=72.28  E-value=2.7  Score=32.80  Aligned_cols=20  Identities=25%  Similarity=0.282  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|.|||.+++.+.+.+
T Consensus       113 l~Gp~GtGKT~lAr~lA~~l  132 (412)
T PRK05342        113 LIGPTGSGKTLLAQTLARIL  132 (412)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            35999999999999987654


No 350
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.21  E-value=2.3  Score=30.46  Aligned_cols=19  Identities=11%  Similarity=0.114  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        55 l~G~nGsGKSTLl~~L~Gl   73 (269)
T cd03294          55 IMGLSGSGKSTLLRCINRL   73 (269)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988653


No 351
>PRK14527 adenylate kinase; Provisional
Probab=72.18  E-value=2.9  Score=28.30  Aligned_cols=20  Identities=15%  Similarity=-0.014  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||-.++.+...+
T Consensus        11 i~G~pGsGKsT~a~~La~~~   30 (191)
T PRK14527         11 FLGPPGAGKGTQAERLAQEL   30 (191)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999998776543


No 352
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=72.16  E-value=2.4  Score=29.19  Aligned_cols=18  Identities=11%  Similarity=0.126  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (223)
T TIGR03740        31 LLGPNGAGKSTLLKMITG   48 (223)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998764


No 353
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=72.14  E-value=2.3  Score=28.97  Aligned_cols=18  Identities=11%  Similarity=0.082  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        40 l~G~nGsGKStLl~~i~G   57 (194)
T cd03213          40 IMGPSGAGKSTLLNALAG   57 (194)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999888854


No 354
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=72.10  E-value=2.3  Score=30.31  Aligned_cols=19  Identities=16%  Similarity=0.097  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        32 i~G~nGsGKSTLl~~l~Gl   50 (255)
T PRK11248         32 VLGPSGCGKTTLLNLIAGF   50 (255)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 355
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=72.03  E-value=1.8  Score=35.12  Aligned_cols=20  Identities=10%  Similarity=0.220  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|+||+|||-..++++..+
T Consensus       505 IvG~SGsGKSTLlklL~gl~  524 (708)
T TIGR01193       505 IVGMSGSGKSTLAKLLVGFF  524 (708)
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            46999999999999998754


No 356
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=72.03  E-value=2.8  Score=31.72  Aligned_cols=20  Identities=10%  Similarity=0.164  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||-++..+..+|
T Consensus        97 I~G~sgsGKStlA~~La~~l  116 (301)
T PRK04220         97 IGGASGVGTSTIAFELASRL  116 (301)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            58999999999999888876


No 357
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=72.00  E-value=2.4  Score=29.16  Aligned_cols=17  Identities=18%  Similarity=0.131  Sum_probs=14.7

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      +.|++|+|||-.-++++
T Consensus        26 l~G~nG~GKSTLl~~il   42 (176)
T cd03238          26 VTGVSGSGKSTLVNEGL   42 (176)
T ss_pred             EECCCCCCHHHHHHHHh
Confidence            36999999999999874


No 358
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=71.85  E-value=2.4  Score=28.80  Aligned_cols=17  Identities=24%  Similarity=0.239  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      +.|++|+|||-.-+++.
T Consensus        38 l~G~nGsGKSTLl~~l~   54 (192)
T cd03232          38 LMGESGAGKTTLLDVLA   54 (192)
T ss_pred             EECCCCCCHHHHHHHHh
Confidence            46999999999999875


No 359
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=71.72  E-value=2.4  Score=29.95  Aligned_cols=19  Identities=16%  Similarity=0.123  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-..+++.-.
T Consensus        34 l~G~nGsGKSTLl~~l~Gl   52 (254)
T PRK10418         34 LVGGSGSGKSLTCAAALGI   52 (254)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988553


No 360
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=71.61  E-value=2.5  Score=28.75  Aligned_cols=19  Identities=21%  Similarity=0.317  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+.+.-.
T Consensus        39 i~G~nGsGKSTLl~~l~Gl   57 (207)
T cd03369          39 IVGRTGAGKSTLILALFRF   57 (207)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988653


No 361
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.55  E-value=2.5  Score=29.70  Aligned_cols=18  Identities=11%  Similarity=0.041  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        35 i~G~nGsGKSTLl~~l~G   52 (252)
T PRK14256         35 IIGPSGCGKSTVLRSINR   52 (252)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            469999999999998865


No 362
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=71.52  E-value=2.5  Score=30.24  Aligned_cols=19  Identities=11%  Similarity=0.172  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||..-+++.-.
T Consensus        51 I~G~nGsGKSTLl~~l~Gl   69 (267)
T PRK14237         51 LIGPSGSGKSTYLRSLNRM   69 (267)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            4699999999999988653


No 363
>PRK10869 recombination and repair protein; Provisional
Probab=71.51  E-value=1.7  Score=35.02  Aligned_cols=16  Identities=19%  Similarity=0.086  Sum_probs=12.5

Q ss_pred             CCCCcCCchHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVV   16 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~   16 (80)
                      |.||||||||.+---|
T Consensus        27 itGetGaGKS~ildAi   42 (553)
T PRK10869         27 ITGETGAGKSIAIDAL   42 (553)
T ss_pred             EECCCCCChHHHHHHH
Confidence            4699999999876533


No 364
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=71.44  E-value=2.5  Score=29.43  Aligned_cols=18  Identities=22%  Similarity=0.146  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        34 l~G~nGsGKSTLl~~l~G   51 (241)
T PRK10895         34 LLGPNGAGKTTTFYMVVG   51 (241)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999988865


No 365
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.42  E-value=2.4  Score=30.50  Aligned_cols=18  Identities=11%  Similarity=0.023  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        51 IiG~nGsGKSTLl~~l~G   68 (274)
T PRK14265         51 FIGPSGCGKSTLLRCFNR   68 (274)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998864


No 366
>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family. Members of this family include the predicted ATPase, TraG, encoded by transfer region genes of conjugative transposons of Bacteroides, such as CTnDOT, found on the main chromosome. Members also include TraG homologs borne on plasmids in Bacteroides. The protein family is related to the conjugative transfer system ATPase VirB4.
Probab=71.28  E-value=3.2  Score=35.24  Aligned_cols=22  Identities=14%  Similarity=0.146  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.||+|||...++++..+..
T Consensus       443 I~G~sGsGKS~l~~~l~~~~~~  464 (829)
T TIGR03783       443 ILGPSGSGKSFFTNHLVRQYYE  464 (829)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4799999999999998876544


No 367
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=71.23  E-value=2.5  Score=30.28  Aligned_cols=18  Identities=17%  Similarity=0.078  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|||||-.-+++.-
T Consensus        38 i~G~nGsGKSTLl~~l~G   55 (269)
T PRK11831         38 IMGPSGIGKTTLLRLIGG   55 (269)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 368
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=71.21  E-value=3.4  Score=28.72  Aligned_cols=17  Identities=24%  Similarity=0.180  Sum_probs=14.8

Q ss_pred             CCCcCCchHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~   18 (80)
                      -|+||+|||-+...|+-
T Consensus         6 lG~tGsGKSs~~N~ilg   22 (212)
T PF04548_consen    6 LGKTGSGKSSLGNSILG   22 (212)
T ss_dssp             ECSTTSSHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHhc
Confidence            49999999999998863


No 369
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=71.21  E-value=2.5  Score=29.94  Aligned_cols=19  Identities=11%  Similarity=0.074  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||..-+++.-.
T Consensus        35 i~G~nGsGKSTLl~~i~G~   53 (262)
T PRK09984         35 LLGPSGSGKSTLLRHLSGL   53 (262)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988653


No 370
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=71.20  E-value=3.6  Score=27.33  Aligned_cols=22  Identities=14%  Similarity=0.122  Sum_probs=18.1

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      .|+.|+|||-..+.+..++...
T Consensus         5 ~G~~GsGKTt~~~~l~~~~~~~   26 (148)
T cd03114           5 TGVPGAGKSTLIDALITALRAR   26 (148)
T ss_pred             ECCCCCcHHHHHHHHHHHHHHC
Confidence            5999999999998888876443


No 371
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=71.18  E-value=2.4  Score=30.36  Aligned_cols=18  Identities=11%  Similarity=0.133  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        38 l~G~nGsGKSTLl~~l~G   55 (272)
T PRK15056         38 LVGVNGSGKSTLFKALMG   55 (272)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 372
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.13  E-value=2.5  Score=30.03  Aligned_cols=18  Identities=17%  Similarity=0.137  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        47 i~G~nGsGKSTLl~~l~G   64 (265)
T PRK14252         47 LIGPSGCGKSTFLRCFNR   64 (265)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998864


No 373
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=71.09  E-value=2.4  Score=33.60  Aligned_cols=20  Identities=20%  Similarity=0.252  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||-..++++..+
T Consensus       366 IvG~sGsGKSTLl~lL~gl~  385 (588)
T PRK13657        366 IVGPTGAGKSTLINLLQRVF  385 (588)
T ss_pred             EECCCCCCHHHHHHHHhcCc
Confidence            46999999999999997754


No 374
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=71.08  E-value=2.3  Score=29.65  Aligned_cols=18  Identities=11%  Similarity=0.143  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        32 i~G~nGsGKSTLl~~l~G   49 (248)
T PRK09580         32 IMGPNGSGKSTLSATLAG   49 (248)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999888755


No 375
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.03  E-value=2.5  Score=29.63  Aligned_cols=18  Identities=11%  Similarity=0.133  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        36 l~G~nGsGKSTLl~~l~G   53 (252)
T PRK14255         36 LIGPSGCGKSTYLRTLNR   53 (252)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998854


No 376
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=71.00  E-value=3.4  Score=29.48  Aligned_cols=22  Identities=27%  Similarity=0.211  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|+.|.|||.+.+.+...+..
T Consensus        43 l~G~~G~GKt~~~~~l~~~l~~   64 (319)
T PRK00440         43 FAGPPGTGKTTAALALARELYG   64 (319)
T ss_pred             EECCCCCCHHHHHHHHHHHHcC
Confidence            3599999999999999887643


No 377
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=70.96  E-value=2.7  Score=29.76  Aligned_cols=20  Identities=20%  Similarity=0.325  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||..-+++.-.+
T Consensus        43 l~G~nGsGKSTLl~~l~G~~   62 (259)
T PRK14274         43 IIGPSGCGKSTFIKTLNLMI   62 (259)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            46999999999999887543


No 378
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=70.93  E-value=2.6  Score=30.04  Aligned_cols=18  Identities=17%  Similarity=0.174  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        52 i~G~nGsGKSTLl~~l~G   69 (268)
T PRK14248         52 LIGPSGCGKSTFLRSINR   69 (268)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            469999999999998865


No 379
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=70.91  E-value=2.6  Score=30.16  Aligned_cols=19  Identities=11%  Similarity=0.029  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||...+++.-.
T Consensus        39 i~G~nGsGKSTLl~~l~Gl   57 (261)
T PRK14263         39 FIGPSGCGKSTVLRSLNRM   57 (261)
T ss_pred             EECCCCCCHHHHHHHHHcc
Confidence            4699999999999988654


No 380
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=70.83  E-value=2.6  Score=29.02  Aligned_cols=18  Identities=22%  Similarity=0.152  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        42 i~G~nGsGKSTLl~~i~G   59 (214)
T PRK13543         42 VQGDNGAGKTTLLRVLAG   59 (214)
T ss_pred             EEcCCCCCHHHHHHHHhC
Confidence            469999999999998854


No 381
>TIGR00678 holB DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau.
Probab=70.78  E-value=3.4  Score=27.79  Aligned_cols=23  Identities=30%  Similarity=0.304  Sum_probs=20.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|+.|.|||..++.+.+.+...
T Consensus        19 ~~G~~G~gkt~~a~~~~~~l~~~   41 (188)
T TIGR00678        19 FAGPEGVGKELLALALAKALLCE   41 (188)
T ss_pred             EECCCCCCHHHHHHHHHHHHcCC
Confidence            36999999999999999998764


No 382
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=70.72  E-value=2.7  Score=30.09  Aligned_cols=20  Identities=15%  Similarity=0.109  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-.-+++.-.+
T Consensus        50 i~G~nGsGKSTLl~~l~Gl~   69 (267)
T PRK14235         50 FIGPSGCGKSTFLRCLNRMN   69 (267)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            46999999999999987543


No 383
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=70.69  E-value=2.5  Score=30.27  Aligned_cols=18  Identities=11%  Similarity=0.093  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        32 i~G~nGsGKSTLl~~l~G   49 (271)
T PRK13638         32 LVGANGCGKSTLFMNLSG   49 (271)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999988754


No 384
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=70.69  E-value=3.6  Score=27.94  Aligned_cols=23  Identities=17%  Similarity=0.138  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|.+|+|||-....++..|...
T Consensus         6 i~G~~gsGKTTli~~L~~~l~~~   28 (159)
T cd03116           6 FVGYSGSGKTTLLEKLIPALSAR   28 (159)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHc
Confidence            47999999999999998887544


No 385
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]
Probab=70.65  E-value=3.9  Score=30.82  Aligned_cols=16  Identities=19%  Similarity=0.287  Sum_probs=13.7

Q ss_pred             CCCCcCCchHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVV   16 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~   16 (80)
                      |.|+.|+|||...+.+
T Consensus        56 vtGevGsGKTv~~Ral   71 (269)
T COG3267          56 VTGEVGSGKTVLRRAL   71 (269)
T ss_pred             EEecCCCchhHHHHHH
Confidence            4699999999999943


No 386
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=70.63  E-value=2.6  Score=29.52  Aligned_cols=19  Identities=16%  Similarity=0.118  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~i~Gl   52 (250)
T PRK14262         34 IIGPSGCGKTTLLRSINRM   52 (250)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988753


No 387
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=70.61  E-value=2.7  Score=28.58  Aligned_cols=19  Identities=16%  Similarity=0.151  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++...
T Consensus        36 i~G~nG~GKSTLl~~i~G~   54 (204)
T cd03250          36 IVGPVGSGKSSLLSALLGE   54 (204)
T ss_pred             EECCCCCCHHHHHHHHhCc
Confidence            4699999999999988663


No 388
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit. This model describes spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Polyamines like spermidine and putrescine play vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).
Probab=70.61  E-value=3.5  Score=30.60  Aligned_cols=19  Identities=16%  Similarity=0.109  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +-|++|+|||-.-+++.-.
T Consensus         1 l~G~nGsGKSTLl~~iaGl   19 (325)
T TIGR01187         1 LLGPSGCGKTTLLRLLAGF   19 (325)
T ss_pred             CcCCCCCCHHHHHHHHHCC
Confidence            4699999999999988653


No 389
>PRK14731 coaE dephospho-CoA kinase; Provisional
Probab=70.60  E-value=2.7  Score=29.24  Aligned_cols=18  Identities=11%  Similarity=0.054  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      ++|.+|||||...+++..
T Consensus        10 itG~igsGKSt~~~~l~~   27 (208)
T PRK14731         10 VTGGIGSGKSTVCRFLAE   27 (208)
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999988754


No 390
>PLN03046 D-glycerate 3-kinase; Provisional
Probab=70.59  E-value=3.3  Score=33.34  Aligned_cols=20  Identities=10%  Similarity=0.132  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|+|||-..+.+...+
T Consensus       217 IsG~qGSGKSTLa~~L~~lL  236 (460)
T PLN03046        217 FSAPQGCGKTTLVFALDYLF  236 (460)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            68999999999999885544


No 391
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=70.59  E-value=2.6  Score=31.41  Aligned_cols=19  Identities=11%  Similarity=0.062  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-..+++.-.
T Consensus        57 I~G~nGsGKSTLl~~L~Gl   75 (320)
T PRK13631         57 IIGNSGSGKSTLVTHFNGL   75 (320)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653


No 392
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family. Members of this protein are assigned by homology to the TraD family of conjugative coupling factor. This particular clade serves as a marker for an extended gene region that occurs occasionally on plasmids, including the toluene catabolism TOL plasmid. More commonly, the gene region is chromosomal, flanked by various markers of conjugative transfer and insertion.
Probab=70.50  E-value=5.4  Score=33.20  Aligned_cols=26  Identities=15%  Similarity=0.088  Sum_probs=20.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFG   26 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~   26 (80)
                      |-|.||+|||....+++........+
T Consensus       185 V~GtTGsGKT~l~~~li~q~i~~g~~  210 (643)
T TIGR03754       185 VLGTTRVGKTRLAELLITQDIRRGDV  210 (643)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHcCCe
Confidence            45999999999999988777665443


No 393
>PRK13695 putative NTPase; Provisional
Probab=70.36  E-value=3.6  Score=27.36  Aligned_cols=21  Identities=24%  Similarity=0.256  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|+|||-..+.++..+.
T Consensus         5 ltG~~G~GKTTll~~i~~~l~   25 (174)
T PRK13695          5 ITGPPGVGKTTLVLKIAELLK   25 (174)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            359999999999998877654


No 394
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=70.26  E-value=2.8  Score=28.88  Aligned_cols=19  Identities=21%  Similarity=0.266  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        34 i~G~nGsGKSTLl~~l~G~   52 (229)
T cd03254          34 IVGPTGAGKTTLINLLMRF   52 (229)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988543


No 395
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=70.18  E-value=2.8  Score=29.97  Aligned_cols=19  Identities=26%  Similarity=0.226  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        30 i~G~NGsGKSTLlk~L~G~   48 (246)
T cd03237          30 ILGPNGIGKTTFIKMLAGV   48 (246)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999987553


No 396
>PRK14734 coaE dephospho-CoA kinase; Provisional
Probab=70.18  E-value=4.6  Score=28.07  Aligned_cols=18  Identities=11%  Similarity=0.115  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|..|+|||-..+++..
T Consensus         6 itG~igsGKst~~~~l~~   23 (200)
T PRK14734          6 LTGGIGSGKSTVADLLSS   23 (200)
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999988754


No 397
>PRK06526 transposase; Provisional
Probab=70.14  E-value=3.4  Score=30.00  Aligned_cols=22  Identities=14%  Similarity=0.098  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +-|++|+|||-++.-+...++.
T Consensus       103 l~Gp~GtGKThLa~al~~~a~~  124 (254)
T PRK06526        103 FLGPPGTGKTHLAIGLGIRACQ  124 (254)
T ss_pred             EEeCCCCchHHHHHHHHHHHHH
Confidence            3599999999999988776654


No 398
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=70.10  E-value=2.8  Score=30.07  Aligned_cols=19  Identities=11%  Similarity=0.167  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        40 l~G~nGsGKSTLl~~l~Gl   58 (271)
T PRK13632         40 ILGHNGSGKSTISKILTGL   58 (271)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999888654


No 399
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=70.07  E-value=1.3  Score=28.62  Aligned_cols=18  Identities=11%  Similarity=0.113  Sum_probs=15.0

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |-||.|+||+.+++.+-.
T Consensus        26 i~GE~GtGK~~~A~~lh~   43 (138)
T PF14532_consen   26 ITGEPGTGKSLLARALHR   43 (138)
T ss_dssp             EECCTTSSHHHHHHCCHH
T ss_pred             EEcCCCCCHHHHHHHHHh
Confidence            459999999999987744


No 400
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=70.04  E-value=2.9  Score=28.81  Aligned_cols=19  Identities=11%  Similarity=0.137  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-..+++.-.
T Consensus        45 i~G~nGsGKSTLl~~l~Gl   63 (226)
T cd03248          45 LVGPSGSGKSTVVALLENF   63 (226)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988654


No 401
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=70.00  E-value=2.4  Score=29.65  Aligned_cols=18  Identities=17%  Similarity=0.213  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        38 i~G~nGsGKSTLl~~i~G   55 (252)
T CHL00131         38 IMGPNGSGKSTLSKVIAG   55 (252)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999998765


No 402
>COG4240 Predicted kinase [General function prediction only]
Probab=69.98  E-value=4.1  Score=30.87  Aligned_cols=24  Identities=13%  Similarity=0.311  Sum_probs=21.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      |.|..|+|||-++-.|.++|++..
T Consensus        55 isGpQGSGKStls~~i~~~L~~kg   78 (300)
T COG4240          55 ISGPQGSGKSTLSALIVRLLAAKG   78 (300)
T ss_pred             eecCCCCchhhHHHHHHHHHHHhc
Confidence            569999999999999999998865


No 403
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=69.92  E-value=2.8  Score=28.85  Aligned_cols=19  Identities=16%  Similarity=0.072  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +-|++|+|||-.-+++.-.
T Consensus        30 l~G~nGsGKSTLl~~l~Gl   48 (177)
T cd03222          30 IVGPNGTGKTTAVKILAGQ   48 (177)
T ss_pred             EECCCCChHHHHHHHHHcC
Confidence            3599999999999987653


No 404
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=69.91  E-value=2.8  Score=29.94  Aligned_cols=18  Identities=28%  Similarity=0.268  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        35 I~G~NGsGKSTLl~~i~G   52 (251)
T PRK09544         35 LLGPNGAGKSTLVRVVLG   52 (251)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998864


No 405
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=69.91  E-value=3.2  Score=29.10  Aligned_cols=20  Identities=15%  Similarity=-0.002  Sum_probs=16.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|+|||-.+..+...+
T Consensus         8 i~G~~G~GKst~a~~l~~~~   27 (197)
T PRK12339          8 IGGIPGVGKTSISGYIARHR   27 (197)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            57999999999998776643


No 406
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=69.82  E-value=3.5  Score=27.38  Aligned_cols=20  Identities=20%  Similarity=0.207  Sum_probs=14.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+.|.|||-+..-++.++
T Consensus        22 i~GpPGTGKT~~l~~~i~~~   41 (236)
T PF13086_consen   22 IQGPPGTGKTTTLASIIAQL   41 (236)
T ss_dssp             EE-STTSSHHHHHHHHHHHH
T ss_pred             EECCCCCChHHHHHHHHHHh
Confidence            46999999997666666666


No 407
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=69.75  E-value=3.4  Score=30.17  Aligned_cols=19  Identities=16%  Similarity=0.017  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||.....+...
T Consensus       100 i~G~~g~GKT~l~~~~~~~  118 (310)
T TIGR02236       100 VFGEFGSGKTQICHQLAVN  118 (310)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            4799999999987766543


No 408
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=69.69  E-value=2.8  Score=29.59  Aligned_cols=20  Identities=20%  Similarity=0.285  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-.-+++.-.+
T Consensus        36 l~G~nGsGKSTLl~~i~G~~   55 (257)
T PRK10619         36 IIGSSGSGKSTFLRCINFLE   55 (257)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            46999999999999887643


No 409
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=69.62  E-value=2.9  Score=28.10  Aligned_cols=18  Identities=17%  Similarity=0.152  Sum_probs=15.0

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (182)
T cd03215          31 IAGLVGNGQTELAEALFG   48 (182)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999998888754


No 410
>PLN02748 tRNA dimethylallyltransferase
Probab=69.58  E-value=2.9  Score=33.42  Aligned_cols=20  Identities=15%  Similarity=0.167  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||..+.-+...+
T Consensus        27 i~GptgsGKs~la~~la~~~   46 (468)
T PLN02748         27 VMGPTGSGKSKLAVDLASHF   46 (468)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            57999999999998887765


No 411
>PRK04296 thymidine kinase; Provisional
Probab=69.57  E-value=3.7  Score=28.13  Aligned_cols=19  Identities=11%  Similarity=0.041  Sum_probs=13.1

Q ss_pred             CCCCcCCchHH-HHHHHHHH
Q psy17057          1 MAGSTMRDKTP-FKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte-~~k~~l~~   19 (80)
                      +.|+.|+|||. +-.++.++
T Consensus         7 itG~~GsGKTT~~l~~~~~~   26 (190)
T PRK04296          7 IYGAMNSGKSTELLQRAYNY   26 (190)
T ss_pred             EECCCCCHHHHHHHHHHHHH
Confidence            46999999994 44555444


No 412
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=69.55  E-value=2.8  Score=27.37  Aligned_cols=18  Identities=11%  Similarity=0.145  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-..+.+..
T Consensus        31 i~G~nGsGKStLl~~l~G   48 (144)
T cd03221          31 LVGRNGAGKSTLLKLIAG   48 (144)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999888754


No 413
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=69.43  E-value=2.9  Score=29.36  Aligned_cols=19  Identities=11%  Similarity=0.097  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.--
T Consensus        35 i~G~nGsGKSTLl~~l~Gl   53 (251)
T PRK14249         35 IIGPSGCGKSTLLRALNRM   53 (251)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988653


No 414
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=69.36  E-value=3.7  Score=30.26  Aligned_cols=20  Identities=15%  Similarity=0.159  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|++|.|||.+.+.+...+
T Consensus        56 l~GppG~GKT~la~~ia~~l   75 (328)
T PRK00080         56 LYGPPGLGKTTLANIIANEM   75 (328)
T ss_pred             EECCCCccHHHHHHHHHHHh
Confidence            35999999999999887765


No 415
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=69.36  E-value=2.9  Score=30.21  Aligned_cols=19  Identities=11%  Similarity=0.037  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-.-+++.-.
T Consensus        38 i~G~nGsGKSTLl~~l~Gl   56 (279)
T PRK13650         38 IIGHNGSGKSTTVRLIDGL   56 (279)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988654


No 416
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=69.35  E-value=3  Score=29.25  Aligned_cols=18  Identities=17%  Similarity=0.169  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        34 i~G~nGsGKSTLl~~l~G   51 (250)
T PRK14266         34 LIGPSGCGKSTFIRTLNR   51 (250)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            469999999999998865


No 417
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=69.32  E-value=3.4  Score=30.49  Aligned_cols=19  Identities=16%  Similarity=0.018  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||.....++..
T Consensus       107 i~G~~GsGKT~l~~~~~~~  125 (317)
T PRK04301        107 FYGEFGSGKTQICHQLAVN  125 (317)
T ss_pred             EECCCCCCHhHHHHHHHHH
Confidence            5799999999988877544


No 418
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=69.26  E-value=2.9  Score=30.30  Aligned_cols=19  Identities=16%  Similarity=0.176  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        38 i~G~nGsGKSTLl~~L~Gl   56 (286)
T PRK13646         38 IVGQTGSGKSTLIQNINAL   56 (286)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999998653


No 419
>PF00406 ADK:  Adenylate kinase;  InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction  AMP + MgATP = ADP + MgADP  an essential reaction for many processes in living cells. Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). A third ADK has been identified in bovine heart and human cells [], this is a mitochondrial GTP:AMP phosphotransferase, also specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate []. ADK has also been identified in different bacterial species and in yeast []. Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge.; GO: 0005524 ATP binding, 0019205 nucleobase-containing compound kinase activity, 0006139 nucleobase-containing compound metabolic process; PDB: 1ZD8_A 3TLX_D 1TEV_A 1ZAK_B 3CM0_A 3ADK_A 1ZIP_A 1ZIO_A 1ZIN_A 3NDP_A ....
Probab=69.26  E-value=4.4  Score=26.24  Aligned_cols=19  Identities=11%  Similarity=-0.104  Sum_probs=16.0

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      =|.+||||+..++.+...+
T Consensus         2 ~G~PgsGK~t~~~~la~~~   20 (151)
T PF00406_consen    2 LGPPGSGKGTQAKRLAKRY   20 (151)
T ss_dssp             EESTTSSHHHHHHHHHHHH
T ss_pred             cCCCCCChHHHHHHHHHhc
Confidence            3899999999999887754


No 420
>PTZ00424 helicase 45; Provisional
Probab=69.23  E-value=3.7  Score=30.46  Aligned_cols=19  Identities=21%  Similarity=0.163  Sum_probs=14.5

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .++||+|||.+.-+.+...
T Consensus        71 ~apTGsGKT~~~~l~~l~~   89 (401)
T PTZ00424         71 QAQSGTGKTATFVIAALQL   89 (401)
T ss_pred             ECCCCChHHHHHHHHHHHH
Confidence            4789999999877665543


No 421
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=69.23  E-value=2.9  Score=29.98  Aligned_cols=19  Identities=11%  Similarity=0.050  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        44 l~G~nGsGKSTLl~~l~Gl   62 (269)
T PRK14259         44 LIGPSGCGKSTVLRSLNRM   62 (269)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988653


No 422
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=69.21  E-value=3  Score=29.03  Aligned_cols=19  Identities=16%  Similarity=0.132  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||..-+++.-.
T Consensus        31 i~G~nGsGKSTLl~~l~g~   49 (232)
T cd03300          31 LLGPSGCGKTTLLRLIAGF   49 (232)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988553


No 423
>PRK10263 DNA translocase FtsK; Provisional
Probab=69.20  E-value=3.5  Score=37.05  Aligned_cols=22  Identities=27%  Similarity=0.246  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |||-||+|||++-.-+|..|+.
T Consensus      1015 IAGaTGSGKSv~LntLIlSLl~ 1036 (1355)
T PRK10263       1015 VAGTTGSGKSVGVNAMILSMLY 1036 (1355)
T ss_pred             EecCCCCCHHHHHHHHHHHHHH
Confidence            6899999999998888877654


No 424
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=69.07  E-value=3  Score=29.00  Aligned_cols=18  Identities=22%  Similarity=0.150  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 l~G~nGsGKSTLl~~l~G   50 (242)
T TIGR03411        33 IIGPNGAGKTTMMDVITG   50 (242)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999888865


No 425
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=68.95  E-value=2.6  Score=29.79  Aligned_cols=18  Identities=11%  Similarity=0.074  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        27 l~G~nGsGKSTLl~~l~G   44 (248)
T PRK03695         27 LVGPNGAGKSTLLARMAG   44 (248)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999998765


No 426
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=68.84  E-value=4.6  Score=24.40  Aligned_cols=19  Identities=21%  Similarity=0.155  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +-|++|+|||-+.+.+...
T Consensus         1 i~G~~gsGKstl~~~l~~~   19 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQ   19 (163)
T ss_pred             CcCCCCCCHHHHHHHHhCc
Confidence            5699999999998876553


No 427
>PRK08116 hypothetical protein; Validated
Probab=68.83  E-value=4.2  Score=29.65  Aligned_cols=23  Identities=22%  Similarity=0.187  Sum_probs=19.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +-|++|+|||-.+..|..+|...
T Consensus       119 l~G~~GtGKThLa~aia~~l~~~  141 (268)
T PRK08116        119 LWGSVGTGKTYLAACIANELIEK  141 (268)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHc
Confidence            35999999999999999988654


No 428
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=68.76  E-value=3.1  Score=29.08  Aligned_cols=18  Identities=17%  Similarity=0.122  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        32 i~G~nGsGKSTLl~~l~G   49 (242)
T cd03295          32 LIGPSGSGKTTTMKMINR   49 (242)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            459999999999888754


No 429
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=68.73  E-value=3.1  Score=29.49  Aligned_cols=19  Identities=21%  Similarity=0.371  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        52 i~G~nGsGKSTLl~~l~Gl   70 (257)
T cd03288          52 ICGRTGSGKSSLSLAFFRM   70 (257)
T ss_pred             EECCCCCCHHHHHHHHHcc
Confidence            4699999999999988664


No 430
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=68.72  E-value=3.1  Score=28.55  Aligned_cols=18  Identities=22%  Similarity=0.290  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        32 i~G~nGsGKSTLl~~i~G   49 (218)
T cd03290          32 IVGQVGCGKSSLLLAILG   49 (218)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            359999999999998754


No 431
>PRK00279 adk adenylate kinase; Reviewed
Probab=68.68  E-value=3.9  Score=28.24  Aligned_cols=20  Identities=10%  Similarity=-0.009  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|.+|+|||..++.+.+++
T Consensus         5 v~G~pGsGKsT~a~~la~~~   24 (215)
T PRK00279          5 LLGPPGAGKGTQAKFIAEKY   24 (215)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35899999999999887754


No 432
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=68.67  E-value=3.2  Score=28.69  Aligned_cols=18  Identities=11%  Similarity=0.193  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (234)
T cd03251          33 LVGPSGSGKSTLVNLIPR   50 (234)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999997744


No 433
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=68.63  E-value=2.9  Score=33.82  Aligned_cols=20  Identities=15%  Similarity=0.177  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||-..|+++..+
T Consensus       484 IvG~sGsGKSTLlklL~gl~  503 (686)
T TIGR03797       484 IVGPSGSGKSTLLRLLLGFE  503 (686)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            46999999999999998754


No 434
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=68.56  E-value=3.1  Score=28.91  Aligned_cols=18  Identities=11%  Similarity=0.128  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        30 l~G~nGsGKSTLl~~l~G   47 (232)
T PRK10771         30 ILGPSGAGKSTLLNLIAG   47 (232)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            359999999999888754


No 435
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=68.46  E-value=3.8  Score=28.90  Aligned_cols=22  Identities=27%  Similarity=0.203  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.+|+|||.....++.+++.
T Consensus        35 i~g~~G~GKT~l~~~~~~~~~~   56 (271)
T cd01122          35 LTAGTGVGKTTFLREYALDLIT   56 (271)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHH
Confidence            4799999999987776666543


No 436
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=68.44  E-value=3.6  Score=31.44  Aligned_cols=19  Identities=21%  Similarity=0.027  Sum_probs=16.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||.+++.+...+
T Consensus       171 ~GppGtGKT~lAkaia~~~  189 (389)
T PRK03992        171 YGPPGTGKTLLAKAVAHET  189 (389)
T ss_pred             ECCCCCChHHHHHHHHHHh
Confidence            5999999999999886643


No 437
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=68.40  E-value=3.2  Score=29.65  Aligned_cols=18  Identities=11%  Similarity=0.004  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        41 i~G~nGsGKSTLl~~l~G   58 (264)
T PRK14243         41 FIGPSGCGKSTILRCFNR   58 (264)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            469999999999998875


No 438
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=68.35  E-value=3.3  Score=27.53  Aligned_cols=18  Identities=17%  Similarity=0.289  Sum_probs=14.9

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+.+.-
T Consensus        33 l~G~nGsGKstLl~~i~G   50 (171)
T cd03228          33 IVGPSGSGKSTLLKLLLR   50 (171)
T ss_pred             EECCCCCCHHHHHHHHHc
Confidence            469999999998887754


No 439
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=68.15  E-value=3.9  Score=32.30  Aligned_cols=23  Identities=13%  Similarity=0.047  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |.|.+|+|||.+...+..+|...
T Consensus       100 lvG~~GsGKTTtaakLA~~L~~~  122 (437)
T PRK00771        100 LVGLQGSGKTTTAAKLARYFKKK  122 (437)
T ss_pred             EECCCCCcHHHHHHHHHHHHHHc
Confidence            46999999999887777777643


No 440
>PRK13853 type IV secretion system protein VirB4; Provisional
Probab=68.14  E-value=3  Score=34.77  Aligned_cols=18  Identities=28%  Similarity=0.353  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |-|.||+|||...++++.
T Consensus       431 I~G~tGsGKS~l~~~l~~  448 (789)
T PRK13853        431 IFGPIGRGKTTLMTFILA  448 (789)
T ss_pred             EECCCCCCHHHHHHHHHh
Confidence            469999999999998863


No 441
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=68.10  E-value=2.2  Score=33.26  Aligned_cols=20  Identities=15%  Similarity=0.238  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||+|||-..++++..+
T Consensus       353 ivG~sGsGKSTL~~ll~g~~  372 (529)
T TIGR02857       353 LVGPSGAGKSTLLNLLLGFV  372 (529)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            35999999999999997744


No 442
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=68.10  E-value=3.2  Score=29.90  Aligned_cols=20  Identities=10%  Similarity=0.097  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||-.-+++.-.+
T Consensus        38 I~G~nGsGKSTLl~~l~Gl~   57 (277)
T PRK13642         38 IIGQNGSGKSTTARLIDGLF   57 (277)
T ss_pred             EECCCCCcHHHHHHHHhcCC
Confidence            47999999999999886543


No 443
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=67.97  E-value=2.3  Score=33.82  Aligned_cols=20  Identities=15%  Similarity=0.127  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||+|||-..++++..+
T Consensus       371 ivG~sGsGKSTL~~ll~g~~  390 (574)
T PRK11160        371 LLGRTGCGKSTLLQLLTRAW  390 (574)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            45999999999999998864


No 444
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=67.96  E-value=3.2  Score=29.55  Aligned_cols=18  Identities=11%  Similarity=0.052  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +-|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~i~G   50 (258)
T PRK13548         33 ILGPNGAGKSTLLRALSG   50 (258)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            359999999999988865


No 445
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=67.95  E-value=3.2  Score=29.31  Aligned_cols=18  Identities=11%  Similarity=0.062  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        33 l~G~nGsGKSTLl~~l~G   50 (255)
T PRK11231         33 LIGPNGCGKSTLLKCFAR   50 (255)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998865


No 446
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=67.93  E-value=5.2  Score=23.66  Aligned_cols=19  Identities=21%  Similarity=0.072  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|..|+|||-..+.+...
T Consensus         1 iiG~~~~GKStl~~~l~~~   19 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGG   19 (157)
T ss_pred             CCCcCCCcHHHHHHHHHhC
Confidence            5799999999988877553


No 447
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=67.77  E-value=3.9  Score=32.74  Aligned_cols=20  Identities=25%  Similarity=0.140  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||++++.+-+.+
T Consensus        55 liGp~G~GKT~LAr~LAk~l   74 (443)
T PRK05201         55 MIGPTGVGKTEIARRLAKLA   74 (443)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            45999999999999998865


No 448
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=67.66  E-value=3.3  Score=30.22  Aligned_cols=19  Identities=16%  Similarity=0.104  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        24 l~G~NGaGKSTLl~~l~Gl   42 (302)
T TIGR01188        24 FLGPNGAGKTTTIRMLTTL   42 (302)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            3599999999999988653


No 449
>PRK14531 adenylate kinase; Provisional
Probab=67.62  E-value=4.4  Score=27.34  Aligned_cols=20  Identities=10%  Similarity=-0.051  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|||||-..+.+...+
T Consensus         7 i~G~pGsGKsT~~~~la~~~   26 (183)
T PRK14531          7 FLGPPGAGKGTQAARLCAAH   26 (183)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            45999999999999887754


No 450
>CHL00181 cbbX CbbX; Provisional
Probab=67.61  E-value=5.5  Score=29.36  Aligned_cols=21  Identities=29%  Similarity=0.284  Sum_probs=18.2

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -|++|.|||-+++.+.+.+..
T Consensus        65 ~G~pGtGKT~lAr~la~~~~~   85 (287)
T CHL00181         65 TGSPGTGKTTVALKMADILYK   85 (287)
T ss_pred             ECCCCCCHHHHHHHHHHHHHH
Confidence            599999999999999887644


No 451
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=67.56  E-value=3.7  Score=32.68  Aligned_cols=18  Identities=28%  Similarity=0.145  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |-|+||-||||++.-+.+
T Consensus        55 MIGpTGVGKTEIARRLAk   72 (444)
T COG1220          55 MIGPTGVGKTEIARRLAK   72 (444)
T ss_pred             EECCCCCcHHHHHHHHHH
Confidence            569999999999987655


No 452
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=67.50  E-value=4.1  Score=27.00  Aligned_cols=19  Identities=11%  Similarity=-0.062  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |-|.+|+|||-.++.+...
T Consensus         4 i~G~pGsGKst~a~~La~~   22 (194)
T cd01428           4 LLGPPGSGKGTQAERLAKK   22 (194)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            4589999999999887664


No 453
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=67.46  E-value=4.2  Score=31.01  Aligned_cols=23  Identities=13%  Similarity=0.158  Sum_probs=20.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|+.|.|||..++.+.++|.+.
T Consensus        50 ~~G~~G~GKttlA~~lA~~Llc~   72 (351)
T PRK09112         50 FEGPEGIGKATLAFHLANHILSH   72 (351)
T ss_pred             eECCCCCCHHHHHHHHHHHHcCC
Confidence            46999999999999999999873


No 454
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.43  E-value=3.4  Score=28.93  Aligned_cols=19  Identities=21%  Similarity=0.230  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|++|+|||-.-+++.-.
T Consensus        35 i~G~nGsGKSTLl~~i~G~   53 (252)
T PRK14272         35 LIGPSGCGKTTFLRAINRM   53 (252)
T ss_pred             EECCCCCCHHHHHHHHhcc
Confidence            4699999999999988654


No 455
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=67.34  E-value=3.3  Score=28.26  Aligned_cols=19  Identities=11%  Similarity=0.174  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        31 i~G~nGsGKStLl~~l~G~   49 (200)
T cd03217          31 LMGPNGSGKSTLAKTIMGH   49 (200)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999988887543


No 456
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=67.30  E-value=3.7  Score=29.43  Aligned_cols=20  Identities=15%  Similarity=0.106  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+||+-+.+.++..-
T Consensus         9 lsgPSG~GKsTl~k~L~~~~   28 (191)
T COG0194           9 LSGPSGVGKSTLVKALLEDD   28 (191)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            36999999999999888754


No 457
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=67.26  E-value=3.3  Score=29.66  Aligned_cols=19  Identities=16%  Similarity=0.123  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        38 l~G~nGsGKSTLl~~i~Gl   56 (280)
T PRK13649         38 FIGHTGSGKSTIMQLLNGL   56 (280)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999888653


No 458
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=67.23  E-value=3.4  Score=29.75  Aligned_cols=18  Identities=11%  Similarity=-0.066  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        35 i~G~NGsGKSTLl~~l~G   52 (277)
T PRK13652         35 VIGPNGAGKSTLFRHFNG   52 (277)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998864


No 459
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=67.23  E-value=4.4  Score=30.57  Aligned_cols=22  Identities=18%  Similarity=0.147  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|+.|.|||-+++.+.+.|.+
T Consensus        43 ~~Gp~G~GKTtla~~la~~l~c   64 (363)
T PRK14961         43 LSGTRGVGKTTIARLLAKSLNC   64 (363)
T ss_pred             EecCCCCCHHHHHHHHHHHhcC
Confidence            3699999999999999998864


No 460
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=67.23  E-value=3.3  Score=32.60  Aligned_cols=20  Identities=10%  Similarity=0.248  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-..++++..+
T Consensus       354 ivG~sGsGKSTL~~ll~g~~  373 (547)
T PRK10522        354 LIGGNGSGKSTLAMLLTGLY  373 (547)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            46999999999999997743


No 461
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=67.20  E-value=3.5  Score=29.53  Aligned_cols=19  Identities=11%  Similarity=0.050  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-..+++.-.
T Consensus        56 I~G~nGsGKSTLl~~laGl   74 (272)
T PRK14236         56 FIGPSGCGKSTLLRCFNRM   74 (272)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            4699999999999998653


No 462
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=67.19  E-value=3.1  Score=29.63  Aligned_cols=18  Identities=11%  Similarity=0.069  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        38 i~G~nGsGKSTLl~~i~G   55 (265)
T PRK10253         38 IIGPNGCGKSTLLRTLSR   55 (265)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999987754


No 463
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=67.14  E-value=3.5  Score=29.48  Aligned_cols=19  Identities=11%  Similarity=0.162  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        44 i~G~NGsGKSTLl~~l~Gl   62 (267)
T PRK15112         44 IIGENGSGKSTLAKMLAGM   62 (267)
T ss_pred             EEcCCCCCHHHHHHHHhCC
Confidence            4699999999988887653


No 464
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains.
Probab=67.04  E-value=6.9  Score=32.24  Aligned_cols=26  Identities=15%  Similarity=0.065  Sum_probs=21.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFG   26 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~   26 (80)
                      |-|.||+|||....+++..++....+
T Consensus       181 v~G~TGsGKT~l~~~l~~q~i~~g~~  206 (634)
T TIGR03743       181 VLGTTGVGKTRLAELLITQDIRRGDV  206 (634)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHcCCe
Confidence            45999999999998888887775543


No 465
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=66.98  E-value=4.1  Score=28.05  Aligned_cols=19  Identities=11%  Similarity=-0.039  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|.+|||||..++.+...
T Consensus         4 i~G~pGsGKsT~a~~La~~   22 (210)
T TIGR01351         4 LLGPPGSGKGTQAKRIAEK   22 (210)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            4699999999999988663


No 466
>PHA00729 NTP-binding motif containing protein
Probab=66.96  E-value=4.5  Score=29.44  Aligned_cols=21  Identities=24%  Similarity=0.271  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||-.++-+...+.
T Consensus        22 ItG~pGvGKT~LA~aLa~~l~   42 (226)
T PHA00729         22 IFGKQGSGKTTYALKVARDVF   42 (226)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            469999999999999888764


No 467
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=66.95  E-value=3.4  Score=29.93  Aligned_cols=19  Identities=11%  Similarity=0.011  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        32 l~G~nGsGKSTLl~~laG~   50 (272)
T PRK13547         32 LLGRNGAGKSTLLKALAGD   50 (272)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988553


No 468
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]
Probab=66.84  E-value=3.8  Score=33.63  Aligned_cols=59  Identities=20%  Similarity=0.256  Sum_probs=37.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH-HHHH--hcCccccCC-CCCCCccce
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA-WFQA--FGNAKTAHN-NNSSRFGKF   67 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s-ilea--fGnAkT~~n-~nSSrfGk~   67 (80)
                      |-||||-||-.+++.|=+    +|+-    ..++.-.+....+.. +||+  ||..|=.-. .-+.|-|||
T Consensus       251 i~GETGtGKElvAraIH~----~S~R----~~kPfV~~NCAAlPesLlESELFGHeKGAFTGA~~~r~GrF  313 (550)
T COG3604         251 IRGETGTGKELVARAIHQ----LSPR----RDKPFVKLNCAALPESLLESELFGHEKGAFTGAINTRRGRF  313 (550)
T ss_pred             EecCCCccHHHHHHHHHh----hCcc----cCCCceeeeccccchHHHHHHHhcccccccccchhccCcce
Confidence            459999999999998733    2332    223344455544444 7775  888776543 346778887


No 469
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=66.82  E-value=3.7  Score=30.77  Aligned_cols=19  Identities=21%  Similarity=0.027  Sum_probs=16.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||-+++.+...+
T Consensus       162 ~GppGtGKT~lakaia~~l  180 (364)
T TIGR01242       162 YGPPGTGKTLLAKAVAHET  180 (364)
T ss_pred             ECCCCCCHHHHHHHHHHhC
Confidence            5999999999999886644


No 470
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=66.80  E-value=3.9  Score=34.21  Aligned_cols=20  Identities=15%  Similarity=0.243  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|+||||||-..|+++..+
T Consensus       504 IvG~SGsGKSTL~KLL~gly  523 (709)
T COG2274         504 IVGRSGSGKSTLLKLLLGLY  523 (709)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            34999999999999997754


No 471
>PF03668 ATP_bind_2:  P-loop ATPase protein family;  InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins. This is a family of putative P-loop ATPases [], as they contain an ATP-binding site and display ATPase and GTPase activities.; GO: 0005524 ATP binding
Probab=66.80  E-value=3.4  Score=31.18  Aligned_cols=16  Identities=13%  Similarity=0.110  Sum_probs=13.2

Q ss_pred             CCCCcCCchHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVV   16 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~   16 (80)
                      |+|-||||||.+-+..
T Consensus         6 iTGlSGaGKs~Al~~l   21 (284)
T PF03668_consen    6 ITGLSGAGKSTALRAL   21 (284)
T ss_pred             EeCCCcCCHHHHHHHH
Confidence            5799999999987653


No 472
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=66.76  E-value=3.7  Score=28.41  Aligned_cols=18  Identities=11%  Similarity=0.231  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        32 l~G~nGsGKSTLl~~i~G   49 (236)
T cd03253          32 IVGPSGSGKSTILRLLFR   49 (236)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999999998854


No 473
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=66.74  E-value=3.5  Score=29.81  Aligned_cols=20  Identities=15%  Similarity=0.208  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||-.-+++.-.+
T Consensus        38 I~G~nGaGKSTLl~~l~G~~   57 (282)
T PRK13640         38 LIGHNGSGKSTISKLINGLL   57 (282)
T ss_pred             EECCCCCcHHHHHHHHhccc
Confidence            46999999999999987654


No 474
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=66.66  E-value=3.5  Score=29.82  Aligned_cols=19  Identities=11%  Similarity=0.037  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-..+++.-.
T Consensus        37 i~G~nGaGKSTLl~~i~Gl   55 (283)
T PRK13636         37 ILGGNGAGKSTLFQNLNGI   55 (283)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988664


No 475
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=66.61  E-value=3.9  Score=27.62  Aligned_cols=19  Identities=11%  Similarity=0.127  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|.||+||+...+.++..
T Consensus         7 l~Gpsg~GK~tl~~~L~~~   25 (184)
T smart00072        7 LSGPSGVGKGTLLAELIQE   25 (184)
T ss_pred             EECCCCCCHHHHHHHHHhc
Confidence            3599999999999988776


No 476
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=66.58  E-value=3.6  Score=29.65  Aligned_cols=18  Identities=17%  Similarity=0.152  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|++|+|||-.-+++.-
T Consensus        33 i~G~nGsGKSTLl~~l~G   50 (274)
T PRK13644         33 IIGKNGSGKSTLALHLNG   50 (274)
T ss_pred             EECCCCCCHHHHHHHHhc
Confidence            469999999998888865


No 477
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=66.47  E-value=3.5  Score=30.91  Aligned_cols=19  Identities=16%  Similarity=0.254  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        36 iiG~nGsGKSTLlk~L~Gl   54 (343)
T PRK11153         36 VIGASGAGKSTLIRCINLL   54 (343)
T ss_pred             EECCCCCcHHHHHHHHhCC
Confidence            3599999999999988653


No 478
>PRK09694 helicase Cas3; Provisional
Probab=66.45  E-value=5.1  Score=34.38  Aligned_cols=21  Identities=24%  Similarity=0.165  Sum_probs=16.6

Q ss_pred             CCcCCchHHHHHHHHHHHhhh
Q psy17057          3 GSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         3 G~sg~gKte~~k~~l~~l~~~   23 (80)
                      .+||+||||++..+...|+..
T Consensus       308 ApTGsGKTEAAL~~A~~l~~~  328 (878)
T PRK09694        308 APTGSGKTEAALAYAWRLIDQ  328 (878)
T ss_pred             eCCCCCHHHHHHHHHHHHHHh
Confidence            579999999998877666543


No 479
>PF03266 NTPase_1:  NTPase;  InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []. It includes proteins from bacteria to human, and the function was determined first in a hyperthermophilic bacterium to be an NTPase []. The structure of one member-sequence represents a variation of the RecA fold, and implies that the function might be that of a DNA/RNA modifying enzyme []. The sequence carries both a Walker A and Walker B motif which together are characteristic of ATPases or GTPases. The protein exhibits an increased expression profile in human liver cholangiocarcinoma when compared to normal tissue [].; GO: 0005524 ATP binding, 0016740 transferase activity, 0019204 nucleotide phosphatase activity; PDB: 1YE8_A 2I3B_A.
Probab=66.39  E-value=4.5  Score=27.60  Aligned_cols=22  Identities=23%  Similarity=0.164  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+.|.|||-+-+-++.+|-.
T Consensus         4 iTG~pG~GKTTll~k~i~~l~~   25 (168)
T PF03266_consen    4 ITGPPGVGKTTLLKKVIEELKK   25 (168)
T ss_dssp             EES-TTSSHHHHHHHHHHHHHH
T ss_pred             EECcCCCCHHHHHHHHHHHhhc
Confidence            4699999999999999998843


No 480
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=66.37  E-value=4.5  Score=29.05  Aligned_cols=20  Identities=15%  Similarity=0.177  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|.|||-..+.+...+
T Consensus        35 l~Gp~G~GKT~la~~ia~~~   54 (305)
T TIGR00635        35 LYGPPGLGKTTLAHIIANEM   54 (305)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            36999999999999887765


No 481
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=66.35  E-value=3.4  Score=29.20  Aligned_cols=18  Identities=11%  Similarity=0.113  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        32 i~G~nGsGKSTLl~~i~G   49 (256)
T TIGR03873        32 LLGPNGSGKSTLLRLLAG   49 (256)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999998854


No 482
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]
Probab=66.27  E-value=7.2  Score=31.63  Aligned_cols=22  Identities=9%  Similarity=0.067  Sum_probs=19.0

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      -|+||+||+.+..++.+++-..
T Consensus       295 Vg~SG~gKsTI~rllfRFyD~~  316 (497)
T COG5265         295 VGESGAGKSTILRLLFRFYDVN  316 (497)
T ss_pred             EeCCCCcHHHHHHHHHHHhCCc
Confidence            4899999999999999997443


No 483
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=66.26  E-value=4.5  Score=27.71  Aligned_cols=23  Identities=13%  Similarity=0.185  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +-|++|.|||-.+.-+.+.++..
T Consensus        52 l~G~~G~GKThLa~ai~~~~~~~   74 (178)
T PF01695_consen   52 LYGPPGTGKTHLAVAIANEAIRK   74 (178)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHHT
T ss_pred             EEhhHhHHHHHHHHHHHHHhccC
Confidence            35899999999999999887763


No 484
>PRK14532 adenylate kinase; Provisional
Probab=66.22  E-value=4.2  Score=27.17  Aligned_cols=20  Identities=10%  Similarity=-0.027  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+.+.+
T Consensus         5 ~~G~pGsGKsT~a~~la~~~   24 (188)
T PRK14532          5 LFGPPAAGKGTQAKRLVEER   24 (188)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            46999999999998887654


No 485
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=66.17  E-value=3.6  Score=30.98  Aligned_cols=18  Identities=17%  Similarity=0.073  Sum_probs=15.2

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +-|++|+|||-.-+++.-
T Consensus        29 l~G~nGsGKSTLl~~iaG   46 (352)
T PRK11144         29 IFGRSGAGKTSLINAISG   46 (352)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            359999999999988755


No 486
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=66.12  E-value=3.6  Score=33.24  Aligned_cols=19  Identities=16%  Similarity=0.219  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-..+.|+..
T Consensus       355 lvG~nGsGKSTLlk~i~Gl  373 (623)
T PRK10261        355 LVGESGSGKSTTGRALLRL  373 (623)
T ss_pred             EECCCCCCHHHHHHHHHcC
Confidence            4699999999999998754


No 487
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=66.11  E-value=3.6  Score=31.14  Aligned_cols=19  Identities=16%  Similarity=0.219  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|+||+|||-.-++|.-.
T Consensus        33 llGpsGsGKSTLLr~IaGl   51 (353)
T PRK10851         33 LLGPSGSGKTTLLRIIAGL   51 (353)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            3599999999999988663


No 488
>KOG0058|consensus
Probab=66.09  E-value=4.3  Score=34.28  Aligned_cols=19  Identities=16%  Similarity=0.244  Sum_probs=17.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|+||+|||-+..+++++.
T Consensus       500 VGPSGsGKSTiasLL~rfY  518 (716)
T KOG0058|consen  500 VGPSGSGKSTIASLLLRFY  518 (716)
T ss_pred             ECCCCCCHHHHHHHHHHhc
Confidence            3899999999999999975


No 489
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein.
Probab=65.95  E-value=3.2  Score=33.94  Aligned_cols=20  Identities=10%  Similarity=0.200  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|+||+|||-..++++..+
T Consensus       512 IvG~SGsGKSTLl~lL~gl~  531 (711)
T TIGR00958       512 LVGPSGSGKSTVAALLQNLY  531 (711)
T ss_pred             EECCCCCCHHHHHHHHHhcc
Confidence            46999999999999998854


No 490
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=65.88  E-value=3.7  Score=29.79  Aligned_cols=19  Identities=16%  Similarity=0.083  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        38 i~G~nGaGKSTLl~~l~Gl   56 (287)
T PRK13637         38 LIGHTGSGKSTLIQHLNGL   56 (287)
T ss_pred             EECCCCCcHHHHHHHHhcC
Confidence            4699999999999988653


No 491
>PTZ00265 multidrug resistance protein (mdr1); Provisional
Probab=65.73  E-value=4.3  Score=36.39  Aligned_cols=21  Identities=14%  Similarity=0.161  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |-|+||+|||-+.+++++++-
T Consensus      1199 IVG~SGsGKSTl~~LL~r~yd 1219 (1466)
T PTZ00265       1199 IVGETGSGKSTVMSLLMRFYD 1219 (1466)
T ss_pred             EECCCCCCHHHHHHHHHHhCC
Confidence            359999999999999999764


No 492
>PF01656 CbiA:  CobQ/CobB/MinD/ParA nucleotide binding domain;  InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from Salmonella typhimurium []., and CobQ from Rhodobacter capsulatus []. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria [].; PDB: 3K9G_A 3K9H_B 3EZ9_B 3EZF_A 3EZ2_B 3EZ6_A 3EZ7_A 1G3Q_A 1G3R_A 1DTS_A ....
Probab=65.70  E-value=5.7  Score=26.01  Aligned_cols=22  Identities=18%  Similarity=0.123  Sum_probs=19.3

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      .+|.|.|||-++-.+..+|...
T Consensus         5 ~~kGG~GKTt~a~~la~~la~~   26 (195)
T PF01656_consen    5 SGKGGVGKTTIAANLAQALARK   26 (195)
T ss_dssp             ESSTTSSHHHHHHHHHHHHHHT
T ss_pred             cCCCCccHHHHHHHHHhccccc
Confidence            5789999999999999988773


No 493
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=65.68  E-value=4.8  Score=29.36  Aligned_cols=22  Identities=18%  Similarity=0.157  Sum_probs=19.7

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      .|+.|.|||.+++.+.+.|.+.
T Consensus        42 ~G~~G~GKt~~a~~la~~l~~~   63 (355)
T TIGR02397        42 SGPRGTGKTSIARIFAKALNCQ   63 (355)
T ss_pred             ECCCCCCHHHHHHHHHHHhcCC
Confidence            5999999999999999998654


No 494
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter. This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.
Probab=65.68  E-value=2.5  Score=33.48  Aligned_cols=20  Identities=10%  Similarity=0.109  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|+||+|||-..+++...+
T Consensus       373 ivG~sGsGKSTl~~ll~g~~  392 (555)
T TIGR01194       373 IVGENGCGKSTLAKLFCGLY  392 (555)
T ss_pred             EECCCCCCHHHHHHHHhCCC
Confidence            45999999999999998754


No 495
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional
Probab=65.63  E-value=5.1  Score=29.58  Aligned_cols=23  Identities=17%  Similarity=0.095  Sum_probs=20.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|.+|+|||-...-++..|...
T Consensus         6 i~G~~gSGKTTLi~~Li~~L~~~   28 (274)
T PRK14493          6 IVGYKATGKTTLVERLVDRLSGR   28 (274)
T ss_pred             EECCCCCCHHHHHHHHHHHHHhC
Confidence            47999999999999999998765


No 496
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.
Probab=65.59  E-value=3.2  Score=31.49  Aligned_cols=20  Identities=25%  Similarity=0.358  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|.+|+|||.+.+.++.++
T Consensus       183 i~G~tGsGKTTll~al~~~i  202 (340)
T TIGR03819       183 ISGGTGSGKTTLLSALLALV  202 (340)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            47999999999998877654


No 497
>PRK00698 tmk thymidylate kinase; Validated
Probab=65.50  E-value=5.5  Score=26.58  Aligned_cols=22  Identities=14%  Similarity=0.055  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +-|..|||||-..+.+.++|-.
T Consensus         8 ieG~~gsGKsT~~~~L~~~l~~   29 (205)
T PRK00698          8 IEGIDGAGKSTQIELLKELLEQ   29 (205)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            3589999999999999888744


No 498
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=65.47  E-value=3.8  Score=29.92  Aligned_cols=19  Identities=16%  Similarity=0.228  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +-|++|||||-.-+++.-.
T Consensus        35 l~G~NGaGKSTLl~~l~Gl   53 (303)
T TIGR01288        35 LLGPNGAGKSTIARMLLGM   53 (303)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            3599999999999988653


No 499
>PRK13898 type IV secretion system ATPase VirB4; Provisional
Probab=65.25  E-value=3.7  Score=34.22  Aligned_cols=20  Identities=20%  Similarity=0.089  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||...++++..+
T Consensus       451 i~G~tGsGKS~l~~~l~~~~  470 (800)
T PRK13898        451 IIGPTGAGKTVLMNFLCAQA  470 (800)
T ss_pred             EECCCCCcHHHHHHHHHhhc
Confidence            46999999999999987644


No 500
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=65.23  E-value=4.7  Score=31.63  Aligned_cols=22  Identities=27%  Similarity=0.350  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.+|+|||.....++...+.
T Consensus        36 i~G~pGsGKT~l~~qf~~~~~~   57 (509)
T PRK09302         36 VSGTAGTGKTLFALQFLVNGIK   57 (509)
T ss_pred             EEeCCCCCHHHHHHHHHHHHHH
Confidence            5799999999999877654443


Done!