Diaphorina citri psyllid: psy17066

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MKKSSSSNLKSFRPRVRVGCVQSLSTIFYHYIGLKTSTVKYSGGHDNHFSIKPSQWQWDKFKDFFHFYVMIGGLPCLAIIFVSNVFIGPATLTEIPEGYTPQHWEYHKHPITRFIAKTCHTSPQEIYEKKMDRLYELDEIRKIQKVTNKIDKLMGERNDQQVYYYKPVHTNHFTSREKEAEEFRDVVSGSTS
cccccccHHHccccccccccccccccccccccccccccEEEccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEECccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEECccccccccccHHHHHHHHHHcccccc
************RPRVRVGCVQSLSTIFYHYIGLKTSTVKYSGGHDNHFSIKPSQWQWDKFKDFFHFYVMIGGLPCLAIIFVSNVFIGPATLTEIPEGYTPQHWEYHKHPITRFIAKTCHTSPQEIYEKKMDRLYELDEIRKIQKVTNKIDKLMGERNDQQVYYYKPVHTNHFTSREKE*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKSSSSNLKSFRPRVRVGCVQSLSTIFYHYIGLKTSTVKYSGGHDNHFSIKPSQWQWDKFKDFFHFYVMIGGLPCLAIIFVSNVFIGPATLTEIPEGYTPQHWEYHKHPITRFIAKTCHTSPQEIYEKKMDRLYELDEIRKIQKVTNKIDKLMGERNDQQVYYYKPVHTNHFTSREKEAEEFRDVVSGSTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ9CQH3
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ02380
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO43674

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0005747 [CC]mitochondrial respiratory chain complex IprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted