Query         psy17068
Match_columns 157
No_of_seqs    17 out of 19
Neff          1.9 
Searched_HMMs 46136
Date          Fri Aug 16 21:02:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17068.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17068hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10349 WWbp:  WW-domain ligan  35.4 1.9E+02  0.0041   21.6   6.3   23   50-72     67-90  (116)
  2 TIGR02549 CRISPR_DxTHG CRISPR-  29.2      33 0.00071   20.8   1.1    8   13-20      2-9   (26)
  3 PF12811 BaxI_1:  Bax inhibitor  25.4      72  0.0016   27.7   2.9   12  115-126    52-63  (274)
  4 PF08226 DUF1720:  Domain of un  24.2 2.5E+02  0.0054   20.0   5.0    8   72-79     32-39  (75)
  5 PF05673 DUF815:  Protein of un  23.5      42 0.00092   28.8   1.2   17    7-23    104-121 (249)
  6 PF08226 DUF1720:  Domain of un  22.0   3E+02  0.0066   19.6   5.1    8   65-72     32-39  (75)
  7 KOG0921|consensus               20.9 3.3E+02  0.0072   28.8   6.9   58   49-107  1192-1249(1282)
  8 COG2607 Predicted ATPase (AAA+  20.2      54  0.0012   29.3   1.2   22    7-28    137-159 (287)
  9 PF13249 Prenyltrans_2:  Prenyl  16.3      50  0.0011   21.9   0.1   25   17-41      5-30  (113)
 10 PF03829 PTSIIA_gutA:  PTS syst  16.1      93   0.002   23.6   1.5   29    3-43     16-44  (117)

No 1  
>PF10349 WWbp:  WW-domain ligand protein;  InterPro: IPR018826  This entry represents a sequence domain found in WW domain-binding protein that is characterised by several short PY and PT-like motifs of the PPPPY form. These appear to bind directly to the WW domains of WWP1 and WWP2 and other such diverse proteins as dystrophin and YAP (Yes-associated protein). The presence of a phosphotyrosine residue in the pWBP-1 peptide abolishes WW domain binding which suggests a potential regulatory role for tyrosine phosphorylation in modulating WW domain-ligand interactions. Given the likelihood that WWP1 and WWP2 function as E3 ubiquitin-protein ligases, it is possible that initial substrate-specific recognition occurs via WW domain-substrate protein interaction followed by ubiquitin transfer and subsequent proteolysis []. This domain lies just downstream of IPR004182 from INTERPRO in many sequences. 
Probab=35.42  E-value=1.9e+02  Score=21.59  Aligned_cols=23  Identities=22%  Similarity=0.355  Sum_probs=8.8

Q ss_pred             CCCCCC-CCCCCCCCCCCCCCCCC
Q psy17068         50 GYHNQN-RGYRNQIRGYRDQNHGY   72 (157)
Q Consensus        50 GYp~pN-~GYp~~~qGYP~q~qGY   72 (157)
                      .|..|. .+|..+..++...-.+|
T Consensus        67 ~y~~Pp~~~y~~pp~~~~~~~~~~   90 (116)
T PF10349_consen   67 PYGAPPPPAYGPPPPGYPPPPAAY   90 (116)
T ss_pred             CCCCCCCcccCCCCCCCCCCCCcC
Confidence            344433 34444433333333333


No 2  
>TIGR02549 CRISPR_DxTHG CRISPR-associated DxTHG motif protein. This model describes a short region highly conserved between two otherwise substantially different CRISPR-associated (cas) proteins, TIGR02221 and TIGR01987. This region includes the motif [VIL]-D-x-[ST]-H-[GS].
Probab=29.16  E-value=33  Score=20.78  Aligned_cols=8  Identities=63%  Similarity=0.958  Sum_probs=6.5

Q ss_pred             EEEeeccc
Q psy17068         13 IFLDLTHQ   20 (157)
Q Consensus        13 ~~~~~~~~   20 (157)
                      |.||+||-
T Consensus         2 vilDiTHG    9 (26)
T TIGR02549         2 IILDVTHG    9 (26)
T ss_pred             EEEEecCc
Confidence            67899994


No 3  
>PF12811 BaxI_1:  Bax inhibitor 1 like ;  InterPro: IPR010539 Bax inhibitor-1 (BI1) family contains six known genes in human. Some members of BI1 family have been proved to play important roles in cell death [, ].
Probab=25.39  E-value=72  Score=27.69  Aligned_cols=12  Identities=17%  Similarity=0.304  Sum_probs=5.8

Q ss_pred             cchhhhhhcccc
Q psy17068        115 AIKTADTANKSA  126 (157)
Q Consensus       115 P~kt~~~~~~~~  126 (157)
                      +-|-.|+.+|.+
T Consensus        52 ~MT~~~vv~KT~   63 (274)
T PF12811_consen   52 RMTVDGVVNKTG   63 (274)
T ss_pred             CcccccHHHHHH
Confidence            334445555543


No 4  
>PF08226 DUF1720:  Domain of unknown function (DUF1720);  InterPro: IPR013182 This domain is found in different combinations with cortical patch components EF hand, SH3 and ENTH and is therefore likely to be involved in cytoskeletal processes. This family contains many hypothetical proteins.
Probab=24.18  E-value=2.5e+02  Score=20.03  Aligned_cols=8  Identities=25%  Similarity=0.875  Sum_probs=3.2

Q ss_pred             CCCCCCCC
Q psy17068         72 YREQNRGY   79 (157)
Q Consensus        72 YP~QnqGY   79 (157)
                      +.++.-||
T Consensus        32 ~qPQ~TG~   39 (75)
T PF08226_consen   32 FQPQQTGF   39 (75)
T ss_pred             cCcccccc
Confidence            33333344


No 5  
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=23.47  E-value=42  Score=28.81  Aligned_cols=17  Identities=41%  Similarity=0.759  Sum_probs=12.0

Q ss_pred             cccceEEEEe-eccccCc
Q psy17068          7 LNEKFIIFLD-LTHQNGE   23 (157)
Q Consensus         7 ~~~~~~~~~~-~~~~~~~   23 (157)
                      ...|||||+| |+-..+|
T Consensus       104 ~~~kFIlf~DDLsFe~~d  121 (249)
T PF05673_consen  104 RPYKFILFCDDLSFEEGD  121 (249)
T ss_pred             CCCCEEEEecCCCCCCCc
Confidence            3579999996 5555554


No 6  
>PF08226 DUF1720:  Domain of unknown function (DUF1720);  InterPro: IPR013182 This domain is found in different combinations with cortical patch components EF hand, SH3 and ENTH and is therefore likely to be involved in cytoskeletal processes. This family contains many hypothetical proteins.
Probab=21.96  E-value=3e+02  Score=19.58  Aligned_cols=8  Identities=25%  Similarity=0.862  Sum_probs=3.0

Q ss_pred             CCCCCCCC
Q psy17068         65 YRDQNHGY   72 (157)
Q Consensus        65 YP~q~qGY   72 (157)
                      +.++.-||
T Consensus        32 ~qPQ~TG~   39 (75)
T PF08226_consen   32 FQPQQTGF   39 (75)
T ss_pred             cCcccccc
Confidence            33333333


No 7  
>KOG0921|consensus
Probab=20.94  E-value=3.3e+02  Score=28.81  Aligned_cols=58  Identities=19%  Similarity=0.148  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCccCCCCC
Q psy17068         49 RGYHNQNRGYRNQIRGYRDQNHGYREQNRGYREQNRGYRDHNRGYREQKRGYREQNRGY  107 (157)
Q Consensus        49 ~GYp~pN~GYp~~~qGYP~q~qGYP~QnqGYp~qnqGYP~qnqGYP~QnqGY~qqNqGY  107 (157)
                      +||-.+-.|+--.++||-....+|+..-.++-. ++++-..-+||...-.|+...-.|+
T Consensus      1192 GGYGggys~gGygsGGYGgsa~~~~~~~Gagvg-~GyrGvsrgGfrnnggGdyrnpggg 1249 (1282)
T KOG0921|consen 1192 GGYGGGYSGGGYGSGGYGGSAPSARANYGAGVG-NGYRGVSRGGFRNNGGGDYRNPGGG 1249 (1282)
T ss_pred             CCcCCCCCCCCcCCCCCCCCCCCCCCCcccccc-CCCccccCCccccCCCCCCCCCCCC
Confidence            455444444444555555555555554443322 2333445556666555554444333


No 8  
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=20.20  E-value=54  Score=29.26  Aligned_cols=22  Identities=36%  Similarity=0.780  Sum_probs=16.9

Q ss_pred             cccceEEEEe-eccccCcccccc
Q psy17068          7 LNEKFIIFLD-LTHQNGEGSWTS   28 (157)
Q Consensus         7 ~~~~~~~~~~-~~~~~~~~~~~~   28 (157)
                      ..+|||||.| |+...|+.++.+
T Consensus       137 ~~~kFIlFcDDLSFe~gd~~yK~  159 (287)
T COG2607         137 RPEKFILFCDDLSFEEGDDAYKA  159 (287)
T ss_pred             CCceEEEEecCCCCCCCchHHHH
Confidence            4689999995 888888776643


No 9  
>PF13249 Prenyltrans_2:  Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C ....
Probab=16.28  E-value=50  Score=21.90  Aligned_cols=25  Identities=28%  Similarity=0.557  Sum_probs=0.0

Q ss_pred             eccccCcccccc-CCCccchhhhccc
Q psy17068         17 LTHQNGEGSWTS-NNVPDTLDQYLSC   41 (157)
Q Consensus        17 ~~~~~~~~~~~~-~~~~~~~~~~~~~   41 (157)
                      +..|+..|+|.. ...|++.+-++..
T Consensus         5 ~~~Q~~dGgw~~~~~~~~~~~T~~al   30 (113)
T PF13249_consen    5 LSRQNPDGGWGGFGGPSDVWDTAFAL   30 (113)
T ss_dssp             HHHB-TTSSBBSSTS-BEHHHHHHHH
T ss_pred             HHHcCCCCCCcCCCCCCCHHHHHHHH


No 10 
>PF03829 PTSIIA_gutA:  PTS system glucitol/sorbitol-specific IIA component;  InterPro: IPR004716 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ].  The Man family is unique in several respects among PTS permease families:   It is the only PTS family in which members possess a IID protein.  It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue.  Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars.   This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria. The system in Escherichia coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0005737 cytoplasm; PDB: 2F9H_A.
Probab=16.09  E-value=93  Score=23.60  Aligned_cols=29  Identities=38%  Similarity=0.664  Sum_probs=0.0

Q ss_pred             cccccccceEEEEeeccccCccccccCCCccchhhhccccC
Q psy17068          3 AHYMLNEKFIIFLDLTHQNGEGSWTSNNVPDTLDQYLSCHT   43 (157)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ht   43 (157)
                      |.-++.+++||+++            .+.|++|..|--.|.
T Consensus        16 a~~~~~~~mlIlF~------------~~Ap~~L~d~~vih~   44 (117)
T PF03829_consen   16 AEDFLEENMLILFG------------ENAPDELADYCVIHT   44 (117)
T ss_dssp             T--TT-S-EEEEE-------------TTS-HHHHTTCEEEE
T ss_pred             HHhhhhCCeEEEEC------------CCCChhHheEEEEEe


Done!