Diaphorina citri psyllid: psy17098

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----

RIAAGEGRFNTNTEVNINTEVKSIPVTKKGVYFAFRDQGACISLLAIKVYYITCPETTINFAHFPTTPTGREVTFIEQATGRCVENAEEVGTPTYLCKGDGKWYLPSGGCKCKPGFEADVEKQTCNGTCHACPETTINFAHFPTTPTGREVTFIEQATGRCVENAEEVGTPTYLCKGDGKWYLPSGGCKCKPGFEADVEKQTCN

ccccccccccccccEEEEEEEEEECccccCEEEEEEccccEEEEEEEEEEEEcccHHHcccccccccccccccccccEEEEECccccCCcccccEEECcccCEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccEEECccccEEcccccccccccccccccccccc

RIAAG*G******EVNINTEVKSIPVTKKGVYFAFRDQGACISLLAIKVYYITCPETTINFAHFPTTPTGREVTFIEQATGRCVENAEEVGTPTYLCKGDGKWYLPSGGCKCKPGFEADVE*QTCNGTCHACPETTINFAHFPTTPTGR*VT***QATGRCVENAEEVGTPTYLCKGDGKWYLPSGGCKCKPGFEA********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0032314 [BP]	regulation of Rac GTPase activity	probable	GO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0048583, GO:0035020, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032319, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005004 [MF]	GPI-linked ephrin receptor activity	probable	GO:0004714, GO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0005003, GO:0060089, GO:0004888, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0018108 [BP]	peptidyl-tyrosine phosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:2000026 [BP]	regulation of multicellular organismal development	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0010259 [BP]	multicellular organismal aging	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0031290 [BP]	retinal ganglion cell axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0043408 [BP]	regulation of MAPK cascade	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0008046 [MF]	axon guidance receptor activity	probable	GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0009967 [BP]	positive regulation of signal transduction	probable	GO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031589 [BP]	cell-substrate adhesion	probable	GO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0043549 [BP]	regulation of kinase activity	probable	GO:0042325, GO:0019220, GO:0019222, GO:0050790, GO:0031323, GO:0051338, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0065009, GO:0050789
GO:0016477 [BP]	cell migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0048013 [BP]	ephrin receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0030155 [BP]	regulation of cell adhesion	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0032956 [BP]	regulation of actin cytoskeleton organization	probable	GO:0033043, GO:0032970, GO:0051493, GO:0051128, GO:0065007, GO:0008150, GO:0050794, GO:0050789
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0032879 [BP]	regulation of localization	probable	GO:0008150, GO:0065007, GO:0050789
GO:0022603 [BP]	regulation of anatomical structure morphogenesis	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0005005 [MF]	transmembrane-ephrin receptor activity	probable	GO:0004714, GO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0005003, GO:0060089, GO:0004888, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043085 [BP]	positive regulation of catalytic activity	probable	GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0007417 [BP]	central nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007569 [BP]	cell aging	probable	GO:0032502, GO:0007568, GO:0009987, GO:0044767, GO:0044763, GO:0008150, GO:0044699
GO:0005887 [CC]	integral to plasma membrane	probable	GO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0001932 [BP]	regulation of protein phosphorylation	probable	GO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FL7, chain A
Confidence level:very confident
Coverage over the Query: 1-170,184-195
View the alignment between query and template
View the model in PyMOL

Template: 3FL7, chain A
Confidence level:very confident
Coverage over the Query: 130-204
View the alignment between query and template
View the model in PyMOL