Query         psy1710
Match_columns 77
No_of_seqs    106 out of 551
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 21:53:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1710.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1710hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0660|consensus               99.2 2.1E-11 4.4E-16   94.7   5.1   62   13-75      8-95  (359)
  2 cd07874 STKc_JNK3 Catalytic do  97.9 6.7E-06 1.5E-10   59.6   2.5   62   12-74      2-89  (355)
  3 cd07875 STKc_JNK1 Catalytic do  97.9 1.7E-05 3.6E-10   57.9   3.9   63   10-73      7-95  (364)
  4 cd07876 STKc_JNK2 Catalytic do  97.8 1.9E-05   4E-10   57.6   3.7   63   11-74      5-93  (359)
  5 cd07878 STKc_p38beta_MAPK11 Ca  97.7 3.7E-06   8E-11   60.6  -1.4   55   17-72      5-85  (343)
  6 KOG0659|consensus               97.6 1.4E-05 3.1E-10   61.5   0.5   45   27-72      2-72  (318)
  7 cd07880 STKc_p38gamma_MAPK12 C  97.6 2.3E-05   5E-10   57.0   1.4   57   16-73      4-86  (343)
  8 cd07850 STKc_JNK Catalytic dom  97.5 6.3E-05 1.4E-09   54.7   2.6   61   12-73      1-87  (353)
  9 cd07877 STKc_p38alpha_MAPK14 C  97.5   3E-05 6.5E-10   56.5   0.9   61   12-73      2-88  (345)
 10 cd05102 PTKc_VEGFR3 Catalytic   97.4 0.00014   3E-09   52.2   3.0   52   23-74      2-84  (338)
 11 KOG0595|consensus               97.4 0.00015 3.2E-09   57.9   3.3   50   24-74      7-82  (429)
 12 cd05054 PTKc_VEGFR Catalytic d  97.3 7.7E-05 1.7E-09   54.5   1.1   52   23-74      2-84  (337)
 13 PHA03212 serine/threonine kina  97.2 0.00031 6.6E-09   53.0   3.4   46   27-73     92-155 (391)
 14 KOG0665|consensus               97.2  0.0004 8.6E-09   54.6   3.8   59   13-73      2-87  (369)
 15 KOG0662|consensus               97.2 0.00011 2.3E-09   55.1   0.4   46   27-73      2-73  (292)
 16 cd07879 STKc_p38delta_MAPK13 C  97.1 0.00016 3.5E-09   52.5   0.8   58   15-73      3-86  (342)
 17 cd07856 STKc_Sty1_Hog1 Catalyt  97.0 0.00099 2.1E-08   48.3   4.2   54   20-74      3-82  (328)
 18 cd07858 STKc_TEY_MAPK_plant Ca  97.0 0.00026 5.7E-09   51.1   1.2   50   23-73      1-76  (337)
 19 KOG0600|consensus               97.0 0.00044 9.5E-09   56.7   2.4   47   26-73    116-188 (560)
 20 cd07859 STKc_TDY_MAPK_plant Ca  97.0 0.00066 1.4E-08   48.2   3.0   46   28-74      1-72  (338)
 21 cd05103 PTKc_VEGFR2 Catalytic   97.0 0.00032 6.9E-09   51.0   1.2   49   26-74      6-84  (343)
 22 cd05626 STKc_LATS2 Catalytic d  96.9 0.00098 2.1E-08   49.3   3.7   46   28-74      2-74  (381)
 23 KOG0584|consensus               96.9  0.0006 1.3E-08   56.6   2.8   51   24-75     36-115 (632)
 24 cd07869 STKc_PFTAIRE1 Catalyti  96.9 0.00081 1.8E-08   47.5   3.0   49   25-74      3-76  (303)
 25 KOG0593|consensus               96.9 0.00015 3.2E-09   57.1  -1.0   43   27-70      2-70  (396)
 26 cd05625 STKc_LATS1 Catalytic d  96.8  0.0012 2.5E-08   48.6   3.2   46   27-73      1-73  (382)
 27 cd07871 STKc_PCTAIRE3 Catalyti  96.8  0.0014   3E-08   46.1   3.4   47   26-73      4-75  (288)
 28 KOG0032|consensus               96.8  0.0023 4.9E-08   49.6   4.6   52   23-74     31-109 (382)
 29 cd05061 PTKc_InsR Catalytic do  96.7  0.0015 3.2E-08   45.8   3.0   48   26-74      5-82  (288)
 30 KOG0575|consensus               96.7  0.0018   4E-08   53.5   3.8   44   27-71     18-88  (592)
 31 cd05629 STKc_NDR_like_fungal C  96.7   0.002 4.3E-08   47.3   3.6   47   27-74      1-74  (377)
 32 cd07873 STKc_PCTAIRE1 Catalyti  96.6  0.0021 4.5E-08   45.3   3.3   48   26-74      5-77  (301)
 33 PF00069 Pkinase:  Protein kina  96.6  0.0011 2.3E-08   44.8   1.7   43   29-72      1-69  (260)
 34 cd07862 STKc_CDK6 Catalytic do  96.6  0.0023   5E-08   44.5   3.4   45   27-71      1-74  (290)
 35 cd05599 STKc_NDR_like Catalyti  96.6  0.0022 4.8E-08   46.6   3.3   47   27-74      1-74  (364)
 36 KOG0667|consensus               96.6  0.0016 3.5E-08   53.8   2.6   24   27-50    186-209 (586)
 37 KOG0661|consensus               96.6 0.00037 7.9E-09   56.9  -1.2   51   24-74      7-82  (538)
 38 cd07849 STKc_ERK1_2_like Catal  96.5  0.0011 2.5E-08   47.7   1.4   49   24-73      2-75  (336)
 39 cd05071 PTKc_Src Catalytic dom  96.5   0.002 4.3E-08   44.5   2.5   44   26-70      5-70  (262)
 40 cd05105 PTKc_PDGFR_alpha Catal  96.5   0.004 8.7E-08   47.4   4.3   52   22-73     31-113 (400)
 41 cd07863 STKc_CDK4 Catalytic do  96.5   0.003 6.5E-08   43.7   3.4   46   28-73      1-74  (288)
 42 PTZ00036 glycogen synthase kin  96.5  0.0023 4.9E-08   49.0   2.8   48   25-73     64-131 (440)
 43 cd05104 PTKc_Kit Catalytic dom  96.5  0.0028 6.1E-08   47.1   3.1   48   27-74     35-112 (375)
 44 KOG0615|consensus               96.5  0.0025 5.5E-08   51.5   3.0   49   25-74    170-249 (475)
 45 KOG1152|consensus               96.4  0.0011 2.4E-08   55.7   1.0   26   27-52    561-586 (772)
 46 cd05096 PTKc_DDR1 Catalytic do  96.4  0.0031 6.6E-08   44.5   3.0   23   26-48      4-26  (304)
 47 PTZ00024 cyclin-dependent prot  96.4  0.0048   1E-07   44.2   4.0   28   22-49      3-31  (335)
 48 cd07872 STKc_PCTAIRE2 Catalyti  96.4  0.0036 7.8E-08   44.4   3.3   47   26-73      5-76  (309)
 49 cd05598 STKc_LATS Catalytic do  96.4   0.004 8.7E-08   45.6   3.6   45   28-73      2-73  (376)
 50 KOG0594|consensus               96.4  0.0027 5.9E-08   49.1   2.6   47   26-73     10-83  (323)
 51 PHA03210 serine/threonine kina  96.4  0.0039 8.4E-08   48.7   3.5   24   25-48    146-169 (501)
 52 cd06649 PKc_MEK2 Catalytic dom  96.3  0.0034 7.3E-08   45.4   2.9   47   26-73      4-75  (331)
 53 cd06608 STKc_myosinIII_like Ca  96.3  0.0049 1.1E-07   41.8   3.3   49   26-74      5-76  (275)
 54 cd05106 PTKc_CSF-1R Catalytic   96.3  0.0033 7.2E-08   46.8   2.5   47   27-73     38-114 (374)
 55 cd07853 STKc_NLK Catalytic dom  96.3  0.0024 5.1E-08   46.9   1.7   45   29-74      2-72  (372)
 56 cd05069 PTKc_Yes Catalytic dom  96.2  0.0042 9.1E-08   42.6   2.7   47   23-70      1-70  (260)
 57 cd07848 STKc_CDKL5 Catalytic d  96.2  0.0026 5.6E-08   44.2   1.7   45   27-72      1-71  (287)
 58 cd05088 PTKc_Tie2 Catalytic do  96.2   0.004 8.6E-08   44.2   2.5   46   27-72      7-79  (303)
 59 PHA03209 serine/threonine kina  96.2  0.0033 7.2E-08   46.2   2.2   48   26-74     65-130 (357)
 60 cd07870 STKc_PFTAIRE2 Catalyti  96.2  0.0046 9.9E-08   43.1   2.7   47   26-73      4-75  (291)
 61 cd06637 STKc_TNIK Catalytic do  96.1  0.0048   1E-07   42.2   2.7   48   25-72      4-74  (272)
 62 cd07868 STKc_CDK8 Catalytic do  96.1  0.0056 1.2E-07   43.3   3.1   41   33-74      7-71  (317)
 63 cd07851 STKc_p38 Catalytic dom  96.1  0.0033 7.2E-08   45.6   2.0   37   13-49      1-37  (343)
 64 cd05072 PTKc_Lyn Catalytic dom  96.1   0.007 1.5E-07   41.3   3.4   47   26-73      5-73  (261)
 65 cd06638 STKc_myosinIIIA Cataly  96.1  0.0058 1.3E-07   42.3   2.9   48   24-71     15-85  (286)
 66 cd05605 STKc_GRK4_like Catalyt  96.1  0.0071 1.5E-07   42.5   3.3   46   28-74      1-73  (285)
 67 cd06636 STKc_MAP4K4_6 Catalyti  96.0   0.005 1.1E-07   42.6   2.4   48   24-72     13-84  (282)
 68 PHA03211 serine/threonine kina  96.0  0.0065 1.4E-07   47.6   3.3   47   26-73    168-232 (461)
 69 cd06650 PKc_MEK1 Catalytic dom  96.0  0.0069 1.5E-07   44.0   3.1   47   26-73      4-75  (333)
 70 cd05628 STKc_NDR1 Catalytic do  96.0  0.0066 1.4E-07   44.5   3.0   46   27-73      1-73  (363)
 71 cd08221 STKc_Nek9 Catalytic do  96.0    0.01 2.2E-07   40.3   3.7   45   28-73      1-71  (256)
 72 cd05597 STKc_DMPK_like Catalyt  96.0  0.0071 1.5E-07   43.8   3.1   46   27-73      1-73  (331)
 73 cd07865 STKc_CDK9 Catalytic do  96.0  0.0075 1.6E-07   41.9   3.1   50   24-74      9-84  (310)
 74 cd05624 STKc_MRCK_beta Catalyt  96.0    0.01 2.2E-07   43.0   3.8   47   27-73      1-73  (331)
 75 PHA03207 serine/threonine kina  95.9  0.0074 1.6E-07   45.0   3.1   46   25-71     90-156 (392)
 76 PTZ00263 protein kinase A cata  95.9  0.0068 1.5E-07   43.8   2.8   47   27-74     18-91  (329)
 77 cd07867 STKc_CDC2L6 Catalytic   95.9   0.011 2.3E-07   41.6   3.7   41   33-74      7-71  (317)
 78 cd05107 PTKc_PDGFR_beta Cataly  95.9  0.0066 1.4E-07   46.3   2.7   53   22-74     31-114 (401)
 79 cd05114 PTKc_Tec_Rlk Catalytic  95.9  0.0084 1.8E-07   40.9   2.9   46   27-73      4-71  (256)
 80 cd05614 STKc_MSK2_N N-terminal  95.9  0.0092   2E-07   42.8   3.2   46   28-73      1-77  (332)
 81 cd08228 STKc_Nek6 Catalytic do  95.8    0.01 2.2E-07   40.5   3.3   46   27-73      2-74  (267)
 82 cd06611 STKc_SLK_like Catalyti  95.8  0.0076 1.7E-07   41.7   2.6   49   25-74      3-75  (280)
 83 KOG0597|consensus               95.8  0.0017 3.6E-08   54.7  -0.8   45   27-72      2-72  (808)
 84 cd06617 PKc_MKK3_6 Catalytic d  95.8   0.014   3E-07   40.2   3.9   48   27-74      1-73  (283)
 85 cd05032 PTKc_InsR_like Catalyt  95.8  0.0078 1.7E-07   41.3   2.6   47   26-73      5-81  (277)
 86 cd05600 STKc_Sid2p_Dbf2p Catal  95.8  0.0096 2.1E-07   42.8   3.2   46   27-73      1-73  (333)
 87 KOG0585|consensus               95.8   0.012 2.6E-07   48.5   4.1   49   25-74     95-181 (576)
 88 KOG0663|consensus               95.8  0.0069 1.5E-07   48.3   2.5   46   26-72     75-146 (419)
 89 PTZ00266 NIMA-related protein   95.8  0.0094   2E-07   51.9   3.5   47   26-73     12-84  (1021)
 90 cd05062 PTKc_IGF-1R Catalytic   95.8  0.0093   2E-07   41.3   2.9   47   26-73      5-81  (277)
 91 KOG0580|consensus               95.8   0.003 6.4E-08   48.2   0.4   49   23-73     19-94  (281)
 92 cd07847 STKc_CDKL1_4 Catalytic  95.8   0.014   3E-07   40.1   3.6   46   27-73      1-72  (286)
 93 PLN00034 mitogen-activated pro  95.7  0.0069 1.5E-07   44.1   2.2   46   26-72     73-143 (353)
 94 cd05100 PTKc_FGFR3 Catalytic d  95.7  0.0088 1.9E-07   43.0   2.7   52   22-73      6-90  (334)
 95 cd05113 PTKc_Btk_Bmx Catalytic  95.7   0.011 2.4E-07   40.7   3.1   46   27-73      4-71  (256)
 96 cd05067 PTKc_Lck_Blk Catalytic  95.7  0.0092   2E-07   40.8   2.7   44   26-70      5-70  (260)
 97 cd06616 PKc_MKK4 Catalytic dom  95.7  0.0078 1.7E-07   41.8   2.3   47   28-74      5-76  (288)
 98 cd06654 STKc_PAK1 Catalytic do  95.7   0.014   3E-07   41.3   3.6   49   24-73     17-89  (296)
 99 cd05622 STKc_ROCK1 Catalytic d  95.7    0.01 2.2E-07   44.1   3.0   47   26-73     42-115 (371)
100 cd06607 STKc_TAO Catalytic dom  95.7   0.015 3.2E-07   41.2   3.6   51   23-74     11-88  (307)
101 cd05098 PTKc_FGFR1 Catalytic d  95.7  0.0076 1.7E-07   42.6   2.2   47   26-72     17-95  (307)
102 cd05621 STKc_ROCK2 Catalytic d  95.7   0.011 2.4E-07   44.0   3.1   48   26-74     42-116 (370)
103 cd05064 PTKc_EphR_A10 Catalyti  95.7   0.011 2.3E-07   41.0   2.8   47   27-74      5-79  (266)
104 PTZ00426 cAMP-dependent protei  95.6  0.0083 1.8E-07   44.1   2.3   47   26-73     29-103 (340)
105 KOG0598|consensus               95.6   0.013 2.8E-07   46.1   3.4   47   25-73     23-97  (357)
106 cd08528 STKc_Nek10 Catalytic d  95.6   0.019   4E-07   39.4   3.8   22   29-50      2-23  (269)
107 cd08217 STKc_Nek2 Catalytic do  95.6   0.016 3.6E-07   38.9   3.5   46   28-74      1-72  (265)
108 KOG0605|consensus               95.6  0.0081 1.8E-07   49.4   2.3   48   26-73    140-213 (550)
109 cd05596 STKc_ROCK Catalytic do  95.6    0.01 2.2E-07   44.0   2.7   48   26-74     42-116 (370)
110 cd07844 STKc_PCTAIRE_like Cata  95.6   0.017 3.7E-07   40.1   3.6   47   26-73      4-75  (291)
111 cd08219 STKc_Nek3 Catalytic do  95.6   0.016 3.5E-07   39.4   3.4   45   28-73      1-70  (255)
112 cd07842 STKc_CDK8_like Catalyt  95.6   0.018   4E-07   40.2   3.7   45   28-73      1-74  (316)
113 KOG1151|consensus               95.6  0.0023   5E-08   53.1  -1.0   48   24-72    460-538 (775)
114 cd05035 PTKc_Axl_like Catalyti  95.6   0.013 2.9E-07   39.8   3.0   45   29-74      1-74  (273)
115 cd07855 STKc_ERK5 Catalytic do  95.5  0.0045 9.7E-08   44.6   0.5   50   23-73      1-76  (334)
116 KOG0666|consensus               95.5  0.0034 7.3E-08   50.0  -0.2   48   24-72     21-98  (438)
117 cd05066 PTKc_EphR_A Catalytic   95.5   0.011 2.4E-07   40.7   2.3   46   26-72      3-76  (267)
118 cd06613 STKc_MAP4K3_like Catal  95.5   0.015 3.2E-07   39.4   3.0   47   26-73      2-72  (262)
119 cd06647 STKc_PAK_I Catalytic d  95.5   0.011 2.4E-07   41.8   2.4   47   26-73     18-88  (293)
120 cd05074 PTKc_Tyro3 Catalytic d  95.5   0.018   4E-07   39.4   3.4   44   29-73      1-73  (273)
121 cd06646 STKc_MAP4K5 Catalytic   95.5   0.016 3.5E-07   39.7   3.1   47   26-73      8-78  (267)
122 cd06609 STKc_MST3_like Catalyt  95.4   0.018 3.8E-07   39.7   3.3   46   27-73      1-71  (274)
123 cd07833 STKc_CDKL Catalytic do  95.4   0.013 2.9E-07   40.2   2.6   46   27-73      1-72  (288)
124 KOG1035|consensus               95.4  0.0095 2.1E-07   53.1   2.2   42   30-72    482-548 (1351)
125 cd07837 STKc_CdkB_plant Cataly  95.4   0.016 3.5E-07   40.2   3.0   46   27-72      1-72  (295)
126 cd05623 STKc_MRCK_alpha Cataly  95.4   0.023 5.1E-07   41.0   3.9   48   27-74      1-74  (332)
127 cd07839 STKc_CDK5 Catalytic do  95.4  0.0082 1.8E-07   41.5   1.4   45   28-73      1-71  (284)
128 cd06622 PKc_MAPKK_PBS2_like Ca  95.4  0.0061 1.3E-07   42.3   0.8   46   27-73      1-71  (286)
129 cd05091 PTKc_Ror2 Catalytic do  95.4   0.013 2.8E-07   40.5   2.4   47   27-74      5-81  (283)
130 cd06644 STKc_STK10_LOK Catalyt  95.4   0.018 3.9E-07   40.2   3.1   51   22-73      7-81  (292)
131 cd07852 STKc_MAPK15 Catalytic   95.3  0.0093   2E-07   42.8   1.7   50   24-73      4-79  (337)
132 KOG0583|consensus               95.3   0.019 4.1E-07   44.1   3.4   52   24-75     14-94  (370)
133 cd05110 PTKc_HER4 Catalytic do  95.3   0.019 4.1E-07   40.6   3.2   47   27-74      7-82  (303)
134 cd05068 PTKc_Frk_like Catalyti  95.3   0.015 3.2E-07   39.8   2.5   46   27-73      6-73  (261)
135 cd05099 PTKc_FGFR4 Catalytic d  95.3   0.016 3.5E-07   41.2   2.8   47   26-72     11-89  (314)
136 cd05046 PTK_CCK4 Pseudokinase   95.3   0.014 3.1E-07   40.1   2.4   45   27-72      5-79  (275)
137 cd07864 STKc_CDK12 Catalytic d  95.3   0.016 3.5E-07   40.4   2.6   48   26-74      6-79  (302)
138 cd05627 STKc_NDR2 Catalytic do  95.3   0.026 5.6E-07   41.2   3.8   46   27-73      1-73  (360)
139 cd05108 PTKc_EGFR Catalytic do  95.2    0.02 4.4E-07   40.7   3.1   47   26-73      6-81  (316)
140 cd06615 PKc_MEK Catalytic doma  95.2   0.025 5.4E-07   40.2   3.5   46   27-73      1-71  (308)
141 cd08220 STKc_Nek8 Catalytic do  95.2    0.02 4.2E-07   38.7   2.8   45   28-73      1-71  (256)
142 cd07866 STKc_BUR1 Catalytic do  95.2   0.011 2.5E-07   41.1   1.7   48   26-74      7-80  (311)
143 cd06656 STKc_PAK3 Catalytic do  95.2   0.023   5E-07   40.2   3.2   48   25-73     17-88  (297)
144 KOG0591|consensus               95.2  0.0037 8.1E-08   49.0  -0.9   42   27-69     19-86  (375)
145 cd05043 PTK_Ryk Pseudokinase d  95.2   0.034 7.5E-07   38.4   4.0   46   26-72      5-79  (280)
146 cd06625 STKc_MEKK3_like Cataly  95.1   0.035 7.5E-07   37.7   3.8   46   27-73      2-76  (263)
147 cd05097 PTKc_DDR_like Catalyti  95.1   0.025 5.5E-07   39.7   3.2   22   27-48      5-26  (295)
148 cd06643 STKc_SLK Catalytic dom  95.1   0.027 5.8E-07   39.1   3.2   44   29-73      7-74  (282)
149 cd05101 PTKc_FGFR2 Catalytic d  95.1   0.016 3.6E-07   40.8   2.2   48   26-73     14-93  (304)
150 PHA02882 putative serine/threo  95.1   0.014 3.1E-07   41.3   1.9   26   26-51     11-36  (294)
151 cd05070 PTKc_Fyn_Yrk Catalytic  95.0   0.023   5E-07   38.9   2.8   44   26-70      5-70  (260)
152 cd07845 STKc_CDK10 Catalytic d  95.0   0.023 5.1E-07   40.1   2.9   48   25-73      5-78  (309)
153 cd06655 STKc_PAK2 Catalytic do  95.0   0.027 5.9E-07   39.9   3.3   47   26-73     18-88  (296)
154 cd05089 PTKc_Tie1 Catalytic do  95.0   0.018   4E-07   40.5   2.3   46   27-72      2-74  (297)
155 cd05057 PTKc_EGFR_like Catalyt  95.0   0.021 4.5E-07   39.6   2.5   46   26-72      6-80  (279)
156 KOG0608|consensus               95.0   0.024 5.3E-07   48.7   3.3   25   29-53    631-657 (1034)
157 cd05053 PTKc_FGFR Catalytic do  95.0   0.024 5.2E-07   39.4   2.8   51   23-73      7-88  (293)
158 cd05080 PTKc_Tyk2_rpt2 Catalyt  95.0   0.035 7.6E-07   38.5   3.6   45   27-72      3-77  (283)
159 cd05148 PTKc_Srm_Brk Catalytic  94.9   0.023   5E-07   38.7   2.6   47   27-74      6-75  (261)
160 KOG0668|consensus               94.9   0.007 1.5E-07   46.7   0.0   63   11-74     22-106 (338)
161 cd07832 STKc_CCRK Catalytic do  94.9   0.032 6.9E-07   38.3   3.3   45   28-73      1-71  (286)
162 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  94.9    0.04 8.7E-07   38.1   3.8   46   27-74      4-78  (284)
163 cd05616 STKc_cPKC_beta Catalyt  94.9   0.035 7.6E-07   39.9   3.5   44   29-72      2-72  (323)
164 cd05039 PTKc_Csk_like Catalyti  94.9   0.034 7.4E-07   37.8   3.3   46   26-72      5-71  (256)
165 cd07861 STKc_CDK1_euk Catalyti  94.9    0.04 8.7E-07   37.9   3.7   46   28-74      1-72  (285)
166 cd06645 STKc_MAP4K3 Catalytic   94.9   0.022 4.8E-07   39.0   2.3   47   26-73      8-78  (267)
167 cd06619 PKc_MKK5 Catalytic dom  94.9   0.039 8.4E-07   38.4   3.6   46   27-73      1-71  (279)
168 cd07846 STKc_CDKL2_3 Catalytic  94.9  0.0099 2.1E-07   41.0   0.6   46   27-73      1-72  (286)
169 cd05111 PTK_HER3 Pseudokinase   94.9   0.043 9.2E-07   38.3   3.8   46   27-73      7-81  (279)
170 cd05601 STKc_CRIK Catalytic do  94.8    0.03 6.5E-07   40.1   3.1   46   27-73      1-73  (330)
171 cd05034 PTKc_Src_like Catalyti  94.8   0.033 7.1E-07   37.9   3.1   46   26-72      5-72  (261)
172 cd06612 STKc_MST1_2 Catalytic   94.8    0.05 1.1E-06   36.7   4.0   47   26-73      2-70  (256)
173 cd06653 STKc_MEKK3_like_1 Cata  94.8   0.046 9.9E-07   37.6   3.8   48   26-74      1-77  (264)
174 cd05618 STKc_aPKC_iota Catalyt  94.8   0.034 7.4E-07   40.3   3.3   42   33-74      1-69  (329)
175 cd07854 STKc_MAPK4_6 Catalytic  94.8   0.016 3.5E-07   42.0   1.6   49   23-72      1-73  (342)
176 cd06639 STKc_myosinIIIB Cataly  94.8   0.041 8.8E-07   38.3   3.6   49   25-73     20-91  (291)
177 PRK13184 pknD serine/threonine  94.8   0.027 5.9E-07   48.7   3.1   45   27-72      2-73  (932)
178 cd06620 PKc_MAPKK_Byr1_like Ca  94.8   0.024 5.3E-07   39.4   2.4   47   27-74      5-76  (284)
179 cd07836 STKc_Pho85 Catalytic d  94.8   0.041 8.8E-07   37.9   3.5   45   28-73      1-70  (284)
180 cd05589 STKc_PKN Catalytic dom  94.8   0.028 6.1E-07   40.4   2.7   45   29-74      1-75  (324)
181 cd06628 STKc_MAPKKK_Byr2_like   94.7   0.057 1.2E-06   36.8   4.1   45   28-73      1-78  (267)
182 cd05112 PTKc_Itk Catalytic dom  94.7   0.042 9.1E-07   37.3   3.4   45   27-72      4-70  (256)
183 cd05587 STKc_cPKC Catalytic do  94.7   0.042 9.2E-07   39.4   3.6   46   28-73      1-73  (324)
184 cd05095 PTKc_DDR2 Catalytic do  94.7   0.039 8.4E-07   38.8   3.3   22   26-47      4-25  (296)
185 cd06621 PKc_MAPKK_Pek1_like Ca  94.7   0.047   1E-06   38.2   3.6   45   27-72      1-70  (287)
186 cd06651 STKc_MEKK3 Catalytic d  94.6   0.065 1.4E-06   36.8   4.3   45   27-72      2-75  (266)
187 cd08224 STKc_Nek6_Nek7 Catalyt  94.6   0.043 9.4E-07   37.2   3.3   46   27-73      2-74  (267)
188 cd05059 PTKc_Tec_like Catalyti  94.6   0.045 9.7E-07   37.4   3.3   46   27-73      4-71  (256)
189 cd05631 STKc_GRK4 Catalytic do  94.5   0.051 1.1E-06   38.2   3.6   44   29-73      2-72  (285)
190 cd05592 STKc_nPKC_theta_delta   94.5    0.04 8.6E-07   39.7   3.1   41   33-73      1-68  (316)
191 cd05609 STKc_MAST Catalytic do  94.5   0.058 1.3E-06   38.1   3.9   45   28-73      2-73  (305)
192 cd05036 PTKc_ALK_LTK Catalytic  94.5   0.042 9.1E-07   38.1   3.0   46   27-73      6-81  (277)
193 cd07840 STKc_CDK9_like Catalyt  94.5   0.055 1.2E-06   37.0   3.6   44   29-73      1-70  (287)
194 KOG0611|consensus               94.5   0.012 2.5E-07   48.6   0.2   48   23-71     49-123 (668)
195 cd05590 STKc_nPKC_eta Catalyti  94.5   0.049 1.1E-06   39.2   3.5   42   33-74      1-69  (320)
196 cd05050 PTKc_Musk Catalytic do  94.5   0.028 6.1E-07   39.1   2.1   45   27-72      5-79  (288)
197 cd08218 STKc_Nek1 Catalytic do  94.4   0.052 1.1E-06   36.8   3.4   44   28-72      1-70  (256)
198 KOG0194|consensus               94.4   0.057 1.2E-06   43.6   4.0   55   15-70    144-230 (474)
199 cd06640 STKc_MST4 Catalytic do  94.4   0.036 7.7E-07   38.5   2.5   47   26-73      3-74  (277)
200 PLN00009 cyclin-dependent kina  94.4   0.062 1.3E-06   37.5   3.8   46   27-73      2-73  (294)
201 cd07831 STKc_MOK Catalytic dom  94.3   0.052 1.1E-06   37.2   3.2   45   29-73      1-70  (282)
202 cd05575 STKc_SGK Catalytic dom  94.3   0.041   9E-07   39.5   2.8   41   33-74      1-69  (323)
203 PTZ00284 protein kinase; Provi  94.3   0.024 5.2E-07   43.3   1.6   24   26-49    128-151 (467)
204 cd05045 PTKc_RET Catalytic dom  94.3   0.048   1E-06   38.1   2.9   22   28-49      1-22  (290)
205 cd06623 PKc_MAPKK_plant_like C  94.3   0.081 1.8E-06   35.7   4.0   45   28-73      2-71  (264)
206 cd05610 STKc_MASTL Catalytic d  94.2   0.059 1.3E-06   43.9   3.8   46   26-72      3-75  (669)
207 cd07843 STKc_CDC2L1 Catalytic   94.2   0.053 1.1E-06   37.8   3.1   46   27-73      5-76  (293)
208 cd06630 STKc_MEKK1 Catalytic d  94.2   0.039 8.4E-07   37.6   2.3   46   28-74      1-76  (268)
209 cd06642 STKc_STK25-YSK1 Cataly  94.2   0.013 2.8E-07   40.6  -0.0   47   26-73      3-74  (277)
210 cd05591 STKc_nPKC_epsilon Cata  94.2   0.053 1.1E-06   38.9   3.1   42   33-74      1-69  (321)
211 cd07857 STKc_MPK1 Catalytic do  94.1   0.052 1.1E-06   39.0   3.0   45   28-72      1-73  (332)
212 cd05604 STKc_SGK3 Catalytic do  94.1   0.058 1.3E-06   38.7   3.2   40   33-73      1-68  (325)
213 cd05082 PTKc_Csk Catalytic dom  94.1    0.07 1.5E-06   36.4   3.4   45   27-72      6-70  (256)
214 PTZ00267 NIMA-related protein   94.1   0.056 1.2E-06   41.8   3.3   45   28-73     68-137 (478)
215 cd05615 STKc_cPKC_alpha Cataly  94.1   0.047   1E-06   39.4   2.7   22   28-49      1-22  (323)
216 cd05090 PTKc_Ror1 Catalytic do  94.0   0.066 1.4E-06   37.1   3.3   46   27-73      5-79  (283)
217 cd05055 PTKc_PDGFR Catalytic d  94.0   0.044 9.6E-07   39.0   2.4   47   26-72     34-110 (302)
218 KOG1290|consensus               94.0   0.057 1.2E-06   44.7   3.3   57   11-70     64-151 (590)
219 PLN00113 leucine-rich repeat r  94.0   0.082 1.8E-06   43.6   4.2   46   27-74    690-756 (968)
220 cd05585 STKc_YPK1_like Catalyt  94.0    0.07 1.5E-06   38.1   3.4   39   35-74      1-66  (312)
221 cd08229 STKc_Nek7 Catalytic do  93.9   0.033 7.2E-07   38.0   1.6   46   27-73      2-74  (267)
222 cd06648 STKc_PAK_II Catalytic   93.9   0.067 1.4E-06   37.5   3.1   46   27-73     19-88  (285)
223 cd05570 STKc_PKC Catalytic dom  93.9   0.061 1.3E-06   38.6   2.9   41   33-73      1-68  (318)
224 cd05573 STKc_ROCK_NDR_like Cat  93.9   0.035 7.5E-07   39.8   1.6   46   27-73      1-73  (350)
225 cd05580 STKc_PKA Catalytic dom  93.8   0.064 1.4E-06   37.5   2.9   46   27-73      1-73  (290)
226 cd05049 PTKc_Trk Catalytic dom  93.8   0.054 1.2E-06   37.2   2.5   47   27-74      5-81  (280)
227 cd05582 STKc_RSK_N N-terminal   93.8   0.084 1.8E-06   37.7   3.5   42   32-74      1-71  (318)
228 cd05574 STKc_phototropin_like   93.7   0.044 9.6E-07   38.7   1.9   45   27-72      1-72  (316)
229 cd05612 STKc_PRKX_like Catalyt  93.7   0.044 9.5E-07   38.7   1.9   45   27-72      1-72  (291)
230 cd05603 STKc_SGK2 Catalytic do  93.6   0.072 1.6E-06   38.1   3.0   40   33-73      1-68  (321)
231 PHA03390 pk1 serine/threonine-  93.6   0.097 2.1E-06   36.5   3.5   47   28-74     15-82  (267)
232 cd05073 PTKc_Hck Catalytic dom  93.6   0.081 1.8E-06   36.2   3.1   46   26-72      5-72  (260)
233 cd05588 STKc_aPKC Catalytic do  93.6   0.074 1.6E-06   38.5   3.0   42   33-74      1-69  (329)
234 cd05042 PTKc_Aatyk Catalytic d  93.6   0.091   2E-06   36.1   3.3   40   33-73      1-67  (269)
235 cd06652 STKc_MEKK2 Catalytic d  93.6    0.11 2.4E-06   35.6   3.7   47   26-73      1-76  (265)
236 cd05056 PTKc_FAK Catalytic dom  93.6   0.065 1.4E-06   36.8   2.5   44   27-71      6-77  (270)
237 cd08222 STKc_Nek11 Catalytic d  93.5   0.049 1.1E-06   37.1   1.9   45   28-73      1-74  (260)
238 cd05602 STKc_SGK1 Catalytic do  93.5   0.078 1.7E-06   38.1   3.0   41   33-74      1-69  (325)
239 cd05092 PTKc_TrkA Catalytic do  93.5     0.1 2.2E-06   36.3   3.4   46   27-73      5-79  (280)
240 cd05065 PTKc_EphR_B Catalytic   93.5   0.081 1.7E-06   36.3   2.9   46   27-73      4-77  (269)
241 cd05084 PTKc_Fes Catalytic dom  93.5    0.09   2E-06   35.6   3.1   39   33-72      1-64  (252)
242 cd07834 STKc_MAPK Catalytic do  93.5   0.032   7E-07   39.6   0.9   46   28-74      1-72  (330)
243 cd08225 STKc_Nek5 Catalytic do  93.5   0.053 1.1E-06   36.6   1.9   45   28-73      1-71  (257)
244 KOG0581|consensus               93.4    0.12 2.6E-06   40.9   4.0   46   28-74     80-150 (364)
245 cd05619 STKc_nPKC_theta Cataly  93.4   0.088 1.9E-06   37.9   3.1   41   33-73      1-68  (316)
246 cd08227 PK_STRAD_alpha Pseudok  93.4   0.091   2E-06   37.7   3.1   43   31-74      2-72  (327)
247 cd06641 STKc_MST3 Catalytic do  93.3     0.1 2.2E-06   36.2   3.2   44   28-72      5-73  (277)
248 cd06917 STKc_NAK1_like Catalyt  93.2   0.097 2.1E-06   36.0   3.0   45   28-72      2-73  (277)
249 cd05617 STKc_aPKC_zeta Catalyt  93.2    0.11 2.4E-06   37.5   3.4   41   33-73      1-68  (327)
250 KOG0589|consensus               93.2   0.037   8E-07   44.3   1.0   46   26-73      3-75  (426)
251 cd05047 PTKc_Tie Catalytic dom  93.2    0.12 2.6E-06   35.7   3.4   40   34-73      2-68  (270)
252 KOG0658|consensus               93.1   0.084 1.8E-06   41.7   2.7   44   28-72     25-88  (364)
253 cd05087 PTKc_Aatyk1_Aatyk3 Cat  93.0    0.16 3.4E-06   35.0   3.8   41   33-74      1-68  (269)
254 PRK09188 serine/threonine prot  93.0   0.061 1.3E-06   41.6   1.9   26   24-49     15-40  (365)
255 cd06610 STKc_OSR1_SPAK Catalyt  93.0    0.18 3.9E-06   34.1   3.9   45   27-72      1-70  (267)
256 cd05613 STKc_MSK1_N N-terminal  92.9   0.099 2.2E-06   36.4   2.7   45   28-72      1-76  (290)
257 cd05607 STKc_GRK7 Catalytic do  92.9    0.17 3.8E-06   35.3   3.9   39   35-74      1-66  (277)
258 cd05584 STKc_p70S6K Catalytic   92.9   0.093   2E-06   37.8   2.5   41   32-73      1-72  (323)
259 cd05078 PTK_Jak2_Jak3_rpt1 Pse  92.9    0.09 1.9E-06   36.1   2.4   41   33-74      1-72  (258)
260 cd05571 STKc_PKB Catalytic dom  92.8    0.12 2.6E-06   37.2   3.0   40   33-73      1-67  (323)
261 cd06618 PKc_MKK7 Catalytic dom  92.8   0.062 1.3E-06   37.7   1.5   56   18-73      5-86  (296)
262 cd05083 PTKc_Chk Catalytic dom  92.8   0.073 1.6E-06   36.2   1.8   45   27-72      6-70  (254)
263 KOG0197|consensus               92.7   0.084 1.8E-06   42.8   2.3   50   21-71    199-271 (468)
264 PF07714 Pkinase_Tyr:  Protein   92.7    0.12 2.6E-06   35.8   2.9   41   31-72      3-72  (259)
265 smart00219 TyrKc Tyrosine kina  92.7    0.18   4E-06   33.7   3.6   43   30-73      2-73  (258)
266 cd00192 PTKc Catalytic domain   92.6    0.15 3.2E-06   34.1   3.0   39   33-72      1-67  (262)
267 cd06624 STKc_ASK Catalytic dom  92.4    0.15 3.3E-06   34.9   3.0   40   33-73     14-77  (268)
268 cd05079 PTKc_Jak1_rpt2 Catalyt  92.4    0.19   4E-06   35.0   3.5   44   29-73      6-78  (284)
269 cd05586 STKc_Sck1_like Catalyt  92.3    0.18 3.8E-06   36.2   3.4   40   35-74      1-69  (330)
270 cd05595 STKc_PKB_beta Catalyti  92.3    0.14 3.1E-06   36.9   3.0   40   33-73      1-67  (323)
271 KOG0201|consensus               92.3   0.071 1.5E-06   43.3   1.4   26   25-50     11-36  (467)
272 cd06634 STKc_TAO2 Catalytic do  92.3   0.088 1.9E-06   37.4   1.7   49   25-74     13-88  (308)
273 cd05630 STKc_GRK6 Catalytic do  92.2   0.093   2E-06   36.9   1.8   22   28-49      1-22  (285)
274 KOG4250|consensus               92.2   0.052 1.1E-06   46.1   0.6   38   31-69     17-79  (732)
275 KOG0193|consensus               92.2   0.082 1.8E-06   44.6   1.7   58   19-77    383-464 (678)
276 cd05052 PTKc_Abl Catalytic dom  92.2   0.096 2.1E-06   35.9   1.8   44   28-72      7-73  (263)
277 cd05038 PTKc_Jak_rpt2 Catalyti  92.1    0.19   4E-06   34.4   3.2   47   27-74      4-79  (284)
278 cd05620 STKc_nPKC_delta Cataly  92.0    0.14 3.1E-06   36.8   2.6   41   33-73      1-68  (316)
279 PLN03225 Serine/threonine-prot  92.0   0.089 1.9E-06   42.4   1.7   26   26-51    131-156 (566)
280 cd06657 STKc_PAK4 Catalytic do  92.0    0.11 2.5E-06   36.8   2.1   47   25-72     18-88  (292)
281 cd05051 PTKc_DDR Catalytic dom  91.9    0.11 2.4E-06   36.0   1.8   24   26-49      4-27  (296)
282 cd05593 STKc_PKB_gamma Catalyt  91.8    0.18   4E-06   36.5   3.0   40   33-73      1-67  (328)
283 cd05040 PTKc_Ack_like Catalyti  91.8    0.22 4.7E-06   33.8   3.2   39   33-72      1-67  (257)
284 cd05594 STKc_PKB_alpha Catalyt  91.8    0.18   4E-06   36.2   3.0   40   33-73      1-67  (325)
285 cd05109 PTKc_HER2 Catalytic do  91.8     0.1 2.2E-06   36.1   1.6   48   26-74      6-82  (279)
286 cd05041 PTKc_Fes_like Catalyti  91.6    0.25 5.5E-06   33.3   3.4   40   33-73      1-64  (251)
287 cd05058 PTKc_Met_Ron Catalytic  91.6    0.24 5.3E-06   33.6   3.3   40   33-73      1-68  (262)
288 cd05632 STKc_GRK5 Catalytic do  91.4    0.12 2.7E-06   36.2   1.7   22   28-49      1-22  (285)
289 cd05033 PTKc_EphR Catalytic do  91.4    0.11 2.4E-06   35.6   1.5   46   26-72      3-76  (266)
290 cd05611 STKc_Rim15_like Cataly  91.3    0.28 6.1E-06   33.4   3.4   41   32-72      1-68  (260)
291 cd06626 STKc_MEKK4 Catalytic d  91.3    0.14   3E-06   34.6   1.8   45   28-73      1-71  (264)
292 cd08529 STKc_FA2-like Catalyti  91.3    0.23 4.9E-06   33.5   2.8   44   29-73      2-71  (256)
293 KOG0586|consensus               91.1    0.17 3.7E-06   42.2   2.5   47   27-74     56-128 (596)
294 cd06632 STKc_MEKK1_plant Catal  91.1    0.15 3.2E-06   34.3   1.7   44   28-72      1-73  (258)
295 cd08223 STKc_Nek4 Catalytic do  91.0    0.16 3.5E-06   34.3   1.9   44   28-72      1-70  (257)
296 cd06633 STKc_TAO3 Catalytic do  90.9    0.14 2.9E-06   36.7   1.6   49   24-73     18-93  (313)
297 PTZ00283 serine/threonine prot  90.9    0.15 3.2E-06   40.0   1.8   26   24-49     29-54  (496)
298 KOG1989|consensus               90.8    0.26 5.7E-06   42.0   3.4   54   20-73     29-108 (738)
299 cd07838 STKc_CDK4_6_like Catal  90.8    0.29 6.2E-06   33.5   3.0   46   29-74      1-74  (287)
300 cd05076 PTK_Tyk2_rpt1 Pseudoki  90.8    0.33 7.1E-06   33.9   3.4   16   59-74     74-89  (274)
301 KOG0192|consensus               90.7    0.23 4.9E-06   38.4   2.7   44   29-74     43-112 (362)
302 cd06635 STKc_TAO1 Catalytic do  90.7     0.3 6.4E-06   34.9   3.1   46   27-73     25-97  (317)
303 cd07841 STKc_CDK7 Catalytic do  90.6    0.16 3.4E-06   35.4   1.6   44   28-72      1-73  (298)
304 cd05044 PTKc_c-ros Catalytic d  90.6    0.34 7.4E-06   33.0   3.3   40   33-73      1-71  (269)
305 cd05077 PTK_Jak1_rpt1 Pseudoki  90.6     0.3 6.5E-06   33.8   3.0   18   56-74     60-77  (262)
306 cd05093 PTKc_TrkB Catalytic do  90.6    0.34 7.3E-06   33.8   3.3   45   28-73      6-79  (288)
307 cd05085 PTKc_Fer Catalytic dom  90.6    0.41   9E-06   32.2   3.6   41   33-74      1-65  (250)
308 KOG0596|consensus               90.4    0.53 1.1E-05   39.8   4.7   50   21-71    354-430 (677)
309 KOG1164|consensus               90.2    0.18   4E-06   37.0   1.7   23   28-50     19-41  (322)
310 cd05608 STKc_GRK1 Catalytic do  90.1    0.47   1E-05   33.2   3.7   38   35-73      1-65  (280)
311 cd05094 PTKc_TrkC Catalytic do  90.1    0.37   8E-06   33.7   3.1   47   27-74      5-80  (291)
312 KOG0588|consensus               90.0    0.16 3.5E-06   43.4   1.5   44   28-72     13-83  (786)
313 KOG0578|consensus               89.9   0.061 1.3E-06   44.4  -1.0   46   24-70    270-339 (550)
314 cd06614 STKc_PAK Catalytic dom  89.9    0.37   8E-06   33.4   3.0   49   24-73     16-87  (286)
315 cd08215 STKc_Nek Catalytic dom  89.8    0.23 5.1E-06   33.0   1.9   45   28-73      1-71  (258)
316 cd05122 PKc_STE Catalytic doma  89.8    0.58 1.2E-05   30.8   3.7   44   29-73      2-69  (253)
317 cd05578 STKc_Yank1 Catalytic d  89.7    0.24 5.2E-06   33.7   1.9   45   28-73      1-72  (258)
318 KOG1163|consensus               89.5    0.45 9.7E-06   37.1   3.4   53   22-74     10-96  (341)
319 cd05063 PTKc_EphR_A2 Catalytic  89.3     0.2 4.4E-06   34.2   1.3   47   26-73      4-78  (268)
320 KOG0577|consensus               89.3    0.13 2.9E-06   44.1   0.5   27   24-50     23-49  (948)
321 KOG1095|consensus               89.2    0.54 1.2E-05   41.4   4.1   48   26-74    691-768 (1025)
322 KOG0576|consensus               89.2    0.12 2.5E-06   44.4   0.0   28   24-51     12-39  (829)
323 cd05086 PTKc_Aatyk2 Catalytic   89.0    0.51 1.1E-05   32.6   3.2   39   34-73      2-67  (268)
324 cd06629 STKc_MAPKKK_Bck1_like   88.9    0.28   6E-06   33.6   1.7   22   28-49      2-23  (272)
325 KOG0200|consensus               88.8    0.24 5.1E-06   40.2   1.6   47   22-68    290-369 (609)
326 PLN03224 probable serine/threo  88.8    0.29 6.3E-06   39.4   2.0   23   26-48    144-166 (507)
327 KOG4717|consensus               88.6    0.27 5.9E-06   41.8   1.8   43   27-70     18-86  (864)
328 cd06627 STKc_Cdc7_like Catalyt  88.5    0.31 6.8E-06   32.5   1.8   45   28-73      1-71  (254)
329 cd05581 STKc_PDK1 Catalytic do  88.5    0.35 7.5E-06   32.9   2.0   47   27-73      1-74  (280)
330 cd05048 PTKc_Ror Catalytic Dom  88.4    0.23 4.9E-06   34.2   1.1   45   27-72      5-79  (283)
331 cd08226 PK_STRAD_beta Pseudoki  88.3    0.57 1.2E-05   33.6   3.1   41   33-74      4-72  (328)
332 KOG4279|consensus               87.8    0.16 3.6E-06   44.4   0.1   19   33-51    581-599 (1226)
333 cd05116 PTKc_Syk Catalytic dom  87.4    0.71 1.5E-05   31.5   3.0   15   34-48      2-16  (257)
334 cd06605 PKc_MAPKK Catalytic do  87.2    0.38 8.1E-06   32.6   1.6   46   27-73      1-71  (265)
335 KOG0664|consensus               87.2    0.15 3.3E-06   40.5  -0.5   45   30-74     56-125 (449)
336 KOG0199|consensus               86.9    0.54 1.2E-05   41.1   2.7   46   26-72    109-182 (1039)
337 cd07860 STKc_CDK2_3 Catalytic   86.8    0.45 9.7E-06   32.8   1.8   44   28-72      1-70  (284)
338 cd06606 STKc_MAPKKK Catalytic   86.4    0.48   1E-05   31.3   1.7   45   28-73      1-71  (260)
339 cd05572 STKc_cGK_PKG Catalytic  85.9     1.2 2.6E-05   30.3   3.5   39   35-74      1-66  (262)
340 KOG0198|consensus               85.8     0.5 1.1E-05   36.2   1.7   25   26-50     16-40  (313)
341 KOG0671|consensus               85.2     1.3 2.8E-05   35.7   3.8   27   25-51     87-113 (415)
342 cd07830 STKc_MAK_like Catalyti  85.1     0.6 1.3E-05   32.1   1.7   44   29-72      1-69  (283)
343 KOG0592|consensus               85.0     1.1 2.5E-05   37.5   3.6   24   26-49     72-95  (604)
344 KOG0670|consensus               84.7    0.57 1.2E-05   39.7   1.7   37   11-50    419-455 (752)
345 KOG1026|consensus               84.7    0.44 9.5E-06   40.9   1.1   25   23-47    481-506 (774)
346 cd05115 PTKc_Zap-70 Catalytic   84.4     1.6 3.5E-05   30.0   3.7   38   34-72      2-66  (257)
347 cd05075 PTKc_Axl Catalytic dom  84.3    0.67 1.4E-05   31.6   1.7   40   31-71      3-70  (272)
348 cd05583 STKc_MSK_N N-terminal   84.2    0.78 1.7E-05   31.8   2.0   21   28-48      1-21  (288)
349 PRK10345 hypothetical protein;  83.7    0.91   2E-05   32.3   2.2   45   29-73      4-73  (210)
350 cd08530 STKc_CNK2-like Catalyt  83.4    0.85 1.8E-05   30.5   1.9   45   28-73      1-71  (256)
351 cd07835 STKc_CDK1_like Catalyt  83.4     0.8 1.7E-05   31.5   1.8   44   29-73      1-70  (283)
352 KOG0694|consensus               83.4    0.85 1.8E-05   38.8   2.2   47   27-73    368-441 (694)
353 KOG0612|consensus               82.5    0.51 1.1E-05   42.5   0.6   24   26-49     74-97  (1317)
354 cd05060 PTKc_Syk_like Catalyti  82.3    0.89 1.9E-05   30.9   1.6   16   33-48      1-16  (257)
355 cd06631 STKc_YSK4 Catalytic do  81.9       1 2.3E-05   30.6   1.9   45   28-73      1-74  (265)
356 cd05037 PTK_Jak_rpt1 Pseudokin  80.8     1.1 2.4E-05   30.2   1.6   17   33-49      1-17  (259)
357 KOG0616|consensus               80.5     1.9   4E-05   34.2   3.0   24   26-49     43-66  (355)
358 cd05145 RIO1_like RIO kinase f  80.2     1.2 2.6E-05   30.2   1.7   18   32-49      2-19  (190)
359 KOG2345|consensus               79.9    0.75 1.6E-05   35.6   0.7   29   19-47     13-41  (302)
360 cd05119 RIO RIO kinase family,  79.7     1.2 2.6E-05   29.2   1.5   18   32-49      2-19  (187)
361 cd05118 STKc_CMGC Catalytic do  79.2     1.3 2.8E-05   30.2   1.6   44   29-73      1-70  (283)
362 KOG0582|consensus               79.0       2 4.2E-05   35.5   2.8   47   26-72     25-95  (516)
363 cd06659 STKc_PAK6 Catalytic do  78.2     1.3 2.8E-05   31.3   1.5   47   25-72     19-89  (297)
364 KOG0574|consensus               77.7    0.24 5.3E-06   39.7  -2.6   22   28-49     34-55  (502)
365 smart00090 RIO RIO-like kinase  76.0     1.5 3.3E-05   31.4   1.3   20   28-47     29-48  (237)
366 KOG2052|consensus               75.7     1.2 2.7E-05   36.6   0.9   39   27-65    211-269 (513)
367 PHA02988 hypothetical protein;  75.7     2.5 5.5E-05   29.8   2.3   39   33-72     26-89  (283)
368 cd05633 STKc_GRK3 Catalytic do  75.0       2 4.4E-05   30.0   1.7   40   34-73      1-69  (279)
369 cd07829 STKc_CDK_like Catalyti  74.1     2.1 4.5E-05   29.1   1.5   22   29-50      1-22  (282)
370 cd05606 STKc_beta_ARK Catalyti  74.0     2.2 4.8E-05   29.7   1.7   41   34-74      1-70  (278)
371 PRK14879 serine/threonine prot  72.9     2.4 5.3E-05   28.3   1.6   16   32-47      1-16  (211)
372 cd06658 STKc_PAK5 Catalytic do  72.7     1.5 3.3E-05   30.9   0.6   50   22-72     17-90  (292)
373 cd05147 RIO1_euk RIO kinase fa  70.9     2.8   6E-05   28.8   1.6   18   32-49      2-19  (190)
374 COG0515 SPS1 Serine/threonine   69.6     3.7 8.1E-05   26.5   1.9   21   29-49      2-22  (384)
375 cd05144 RIO2_C RIO kinase fami  69.3     3.2   7E-05   27.9   1.6   21   29-49     17-37  (198)
376 cd05577 STKc_GRK Catalytic dom  68.2     3.6 7.9E-05   28.4   1.7   38   35-73      1-65  (277)
377 KOG1165|consensus               65.9     5.6 0.00012   32.3   2.5   46   22-67     23-90  (449)
378 KOG0033|consensus               65.6     1.8   4E-05   33.9  -0.2   22   25-46      9-30  (355)
379 KOG0607|consensus               65.2     1.3 2.8E-05   35.8  -1.1   39   33-71     84-146 (463)
380 smart00221 STYKc Protein kinas  61.8     6.4 0.00014   25.5   1.8   22   29-50      1-22  (225)
381 KOG4721|consensus               59.0     5.9 0.00013   34.3   1.6   46   22-68    118-179 (904)
382 KOG1167|consensus               57.9     1.7 3.6E-05   35.1  -1.7   27   24-50     33-59  (418)
383 PRK09605 bifunctional UGMP fam  56.8     7.6 0.00016   30.7   1.8   21   27-47    333-353 (535)
384 KOG0669|consensus               55.5     1.4   3E-05   34.7  -2.5   26   24-49     14-39  (376)
385 KOG1166|consensus               55.3     6.8 0.00015   34.6   1.4   28   23-50    693-721 (974)
386 KOG0604|consensus               54.0      10 0.00023   30.4   2.1   49   22-70     56-124 (400)
387 KOG0696|consensus               53.6      11 0.00024   31.6   2.4   24   26-49    348-371 (683)
388 KOG0579|consensus               53.5       2 4.4E-05   37.6  -2.0   27   24-50     29-55  (1187)
389 cd05579 STKc_MAST_like Catalyt  50.3      12 0.00025   24.9   1.7   15   35-49      1-15  (265)
390 KOG0603|consensus               50.1      13 0.00028   31.5   2.2   50   26-75    321-390 (612)
391 KOG4278|consensus               48.2     9.9 0.00021   33.5   1.3   36   33-69    273-331 (1157)
392 TIGR03724 arch_bud32 Kae1-asso  46.6      13 0.00028   24.6   1.4   14   34-47      1-14  (199)
393 KOG0587|consensus               45.5      27 0.00058   31.1   3.5   47   24-71     16-86  (953)
394 KOG1025|consensus               45.4      11 0.00025   33.7   1.3   19   29-47    698-716 (1177)
395 PRK10359 lipopolysaccharide co  45.3      15 0.00032   27.0   1.7   24   25-48     29-52  (232)
396 cd00180 PKc Catalytic domain o  45.0      17 0.00038   22.5   1.8   15   35-49      1-15  (215)
397 cd05123 STKc_AGC Catalytic dom  44.0      18 0.00039   24.0   1.9   15   35-49      1-15  (250)
398 KOG0984|consensus               43.1      20 0.00043   27.6   2.1   27   20-46     38-65  (282)
399 KOG0690|consensus               42.2      14  0.0003   30.2   1.2   24   26-49    167-190 (516)
400 KOG0695|consensus               41.7     9.6 0.00021   31.3   0.3   31   20-50    242-273 (593)
401 KOG1006|consensus               41.5       6 0.00013   31.3  -0.9   24   26-49     63-86  (361)
402 cd05120 APH_ChoK_like Aminogly  40.6      23  0.0005   21.0   1.8   19   31-49      2-20  (155)
403 KOG1187|consensus               40.3      19 0.00041   27.6   1.6   47   26-73     74-143 (361)
404 KOG0610|consensus               38.9      13 0.00028   30.5   0.6   25   26-50     76-100 (459)
405 KOG1345|consensus               34.1     6.8 0.00015   31.1  -1.6   47   23-69     20-89  (378)
406 KOG3653|consensus               32.6      16 0.00035   30.5   0.2   23   27-49    210-232 (534)
407 KOG0986|consensus               31.8      29 0.00063   29.2   1.6   24   29-52    187-212 (591)
408 KOG4236|consensus               31.4      23  0.0005   30.7   1.0   26   24-49    559-586 (888)
409 COG4901 Ribosomal protein S25   29.5      19 0.00042   24.2   0.1   15   53-68     79-93  (107)
410 KOG0196|consensus               29.4      21 0.00046   31.7   0.4   27   23-49    624-651 (996)
411 KOG4257|consensus               25.5      54  0.0012   29.0   2.2   18   30-47    392-409 (974)
412 cd00235 TLP-20 Telokin-like pr  25.4      40 0.00087   22.6   1.1   22   22-44     27-48  (108)
413 KOG4645|consensus               24.5      40 0.00088   31.4   1.3   27   23-49   1231-1257(1509)
414 PRK04750 ubiB putative ubiquin  22.2      56  0.0012   26.9   1.6   22   28-50    121-142 (537)

No 1  
>KOG0660|consensus
Probab=99.20  E-value=2.1e-11  Score=94.69  Aligned_cols=62  Identities=31%  Similarity=0.421  Sum_probs=54.7

Q ss_pred             ceEEeecceEEEeCCCcccccccCCCCCcceEEEEec--------hhh------------------hhhccCcchheeEE
Q psy1710          13 GNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPM--------KKL------------------LQKGAGTNEQLVLL   66 (77)
Q Consensus        13 ~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~--------~~~------------------~~~~~~~~~~~~~~   66 (77)
                      |+.+.+.+..|+++.+|..+++||+||||+||||.|+        +||                  +-||+. |||+|.|
T Consensus         8 ~~~~~~~~~~~~i~~~y~~~~~iG~GAyGvVcsA~~~~t~~~VAIKKi~~~F~~~~~akRtlRElklLr~~~-HeNIi~l   86 (359)
T KOG0660|consen    8 YYDYEVFGELFEIPRYYVLIEPIGRGAYGVVCSAKDKRTGEKVAIKKILNPFENQIDAKRTLRELKLLRHLR-HENIIGL   86 (359)
T ss_pred             ceEEEeeeeEEeccceecccccccCcceeeEEEEEEcCCCCEeehhhhhhhhhchHHHHHHHHHHHHHHHhc-CCCcceE
Confidence            7888899999999999999999999999999999988        344                  228995 9999999


Q ss_pred             EeEeeCCCc
Q psy1710          67 YMWWISPTQ   75 (77)
Q Consensus        67 ~~~~~~~~~   75 (77)
                      +|++.+|+-
T Consensus        87 ~di~~p~~~   95 (359)
T KOG0660|consen   87 LDIFRPPSR   95 (359)
T ss_pred             Eeecccccc
Confidence            999999753


No 2  
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=97.91  E-value=6.7e-06  Score=59.64  Aligned_cols=62  Identities=27%  Similarity=0.278  Sum_probs=49.2

Q ss_pred             CceEEeecceEEEeCCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeE
Q psy1710          12 AGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVL   65 (77)
Q Consensus        12 ~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~   65 (77)
                      .|+.++..+..+.+.+||+.++.||+|+||.||.|+|...-                          +.+.+ .|+|++.
T Consensus         2 ~~~~~~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~   80 (355)
T cd07874           2 QFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCV-NHKNIIS   80 (355)
T ss_pred             cceeeccCchhhhhhhceeEEEEeeecCCEEEEEEEecCCCceEEEEEeCCcccChHHHHHHHHHHHHHHHh-CCCchhc
Confidence            56777888888889999999999999999999999875211                          11344 6899999


Q ss_pred             EEeEeeCCC
Q psy1710          66 LYMWWISPT   74 (77)
Q Consensus        66 ~~~~~~~~~   74 (77)
                      ++++|..+.
T Consensus        81 ~~~~~~~~~   89 (355)
T cd07874          81 LLNVFTPQK   89 (355)
T ss_pred             eeeeeeccc
Confidence            999987543


No 3  
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=97.86  E-value=1.7e-05  Score=57.91  Aligned_cols=63  Identities=25%  Similarity=0.251  Sum_probs=49.7

Q ss_pred             CCCceEEeecceEEEeCCCcccccccCCCCCcceEEEEechh-------h-------------------hhhccCcchhe
Q psy1710          10 TLAGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKK-------L-------------------LQKGAGTNEQL   63 (77)
Q Consensus        10 ~~~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~-------------------~~~~~~~~~~~   63 (77)
                      .+.++........+.+.+||+..+.||+|+||.||.|+|...       +                   +.+.+ .|+|+
T Consensus         7 ~~~~~~~~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i   85 (364)
T cd07875           7 DNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCV-NHKNI   85 (364)
T ss_pred             cccceeeecCcchhchhcceeEEEEeecCCCeEEEEEEECCCCcEEEEEEeCccccCchhHHHHHHHHHHHHhc-CCCCc
Confidence            346777788888888999999999999999999999987521       1                   11445 68999


Q ss_pred             eEEEeEeeCC
Q psy1710          64 VLLYMWWISP   73 (77)
Q Consensus        64 ~~~~~~~~~~   73 (77)
                      +.+++++.+.
T Consensus        86 i~~~~~~~~~   95 (364)
T cd07875          86 IGLLNVFTPQ   95 (364)
T ss_pred             cccceeeccc
Confidence            9999987643


No 4  
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=97.84  E-value=1.9e-05  Score=57.55  Aligned_cols=63  Identities=25%  Similarity=0.261  Sum_probs=49.5

Q ss_pred             CCceEEeecceEEEeCCCcccccccCCCCCcceEEEEechh-------h-------------------hhhccCcchhee
Q psy1710          11 LAGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKK-------L-------------------LQKGAGTNEQLV   64 (77)
Q Consensus        11 ~~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~-------------------~~~~~~~~~~~~   64 (77)
                      .+|+...+.+..+.+.+||+.++.||+|+||.||.|.|..+       +                   +.+.+ .|+|++
T Consensus         5 ~~~~~~~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv   83 (359)
T cd07876           5 SQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCV-NHKNII   83 (359)
T ss_pred             CCcceecccchhhhhhhceEEEEEeecCCCEEEEEEEEcCCCceeEEEEecccccchhHHHHHHHHHHHHHhC-CCCCEe
Confidence            45677777777788999999999999999999999987531       0                   11344 689999


Q ss_pred             EEEeEeeCCC
Q psy1710          65 LLYMWWISPT   74 (77)
Q Consensus        65 ~~~~~~~~~~   74 (77)
                      .+++++....
T Consensus        84 ~~~~~~~~~~   93 (359)
T cd07876          84 SLLNVFTPQK   93 (359)
T ss_pred             eeeeeeccCC
Confidence            9999987543


No 5  
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=97.73  E-value=3.7e-06  Score=60.59  Aligned_cols=55  Identities=31%  Similarity=0.415  Sum_probs=43.1

Q ss_pred             eecceEEEeCCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEe
Q psy1710          17 LVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        17 ~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~   70 (77)
                      +.++..|++++||+.++.||.|+||.||.|.|..+-                          .-+.+ .|+|+|.++|++
T Consensus         5 ~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~   83 (343)
T cd07878           5 ELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDTRLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHM-KHENVIGLLDVF   83 (343)
T ss_pred             HHhHHHhhhhhhhhhheecccCCCeEEEEEEECCCCCEEEEEEeCchhhhhHHHHHHHHHHHHHHhc-CCCchhhhhhhh
Confidence            345567899999999999999999999999875210                          11555 689999999987


Q ss_pred             eC
Q psy1710          71 IS   72 (77)
Q Consensus        71 ~~   72 (77)
                      ..
T Consensus        84 ~~   85 (343)
T cd07878          84 TP   85 (343)
T ss_pred             cc
Confidence            54


No 6  
>KOG0659|consensus
Probab=97.64  E-value=1.4e-05  Score=61.48  Aligned_cols=45  Identities=24%  Similarity=0.447  Sum_probs=36.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +||..++.+|+|+||+|++|.|.++        |                  +-|-+ +|+|+|.|-|+|-.
T Consensus         2 ~rY~~~~~lGEG~~gvVyka~d~~t~~~VAIKKIkl~~~kdGi~~talREIK~Lqel-~h~nIi~LiD~F~~   72 (318)
T KOG0659|consen    2 DRYEKLEKLGEGTYGVVYKARDTETGKRVAIKKIKLGNAKDGINRTALREIKLLQEL-KHPNIIELIDVFPH   72 (318)
T ss_pred             chhhhhhhhcCcceEEEEEEEecCCCcEEEEEEeeccccccCccHHHHHHHHHHHHc-cCcchhhhhhhccC
Confidence            6999999999999999999998732        2                  11455 69999999998843


No 7  
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=97.62  E-value=2.3e-05  Score=57.02  Aligned_cols=57  Identities=30%  Similarity=0.407  Sum_probs=44.8

Q ss_pred             EeecceEEEeCCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeE
Q psy1710          16 ELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMW   69 (77)
Q Consensus        16 ~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~   69 (77)
                      .+++...|++.+||+.++.||+|+||.||+|.+..+=                          ..+.+ .|+|++.+++.
T Consensus         4 ~~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~   82 (343)
T cd07880           4 QEVNKTIWEVPDRYRDLKQVGSGAYGTVCSALDRRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHM-KHENVIGLLDV   82 (343)
T ss_pred             hhhhhhhhccccceEEEEEeeecCCeEEEEEEECCCCcEEEEEEecccccchHHHHHHHHHHHHHHhc-CCCCccceeee
Confidence            3456778999999999999999999999999865210                          11556 78999999998


Q ss_pred             eeCC
Q psy1710          70 WISP   73 (77)
Q Consensus        70 ~~~~   73 (77)
                      +.+.
T Consensus        83 ~~~~   86 (343)
T cd07880          83 FTPD   86 (343)
T ss_pred             ecCC
Confidence            7653


No 8  
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=97.53  E-value=6.3e-05  Score=54.66  Aligned_cols=61  Identities=28%  Similarity=0.279  Sum_probs=47.9

Q ss_pred             CceEEeecceEEEeCCCcccccccCCCCCcceEEEEechh-------hh-------------------hhccCcchheeE
Q psy1710          12 AGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKK-------LL-------------------QKGAGTNEQLVL   65 (77)
Q Consensus        12 ~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~~-------------------~~~~~~~~~~~~   65 (77)
                      +++.+.+.+..|.+..||+.++.||+|+||.|+.|.|..+       ++                   .+-+ .|+|++.
T Consensus         1 ~~~~~~~~~~~~~~~~~y~~~~~lg~g~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~   79 (353)
T cd07850           1 QFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDTVTGQNVAIKKLSRPFQNVTHAKRAYRELVLMKLV-NHKNIIG   79 (353)
T ss_pred             CceeecccchhhhhhcceEEEEEeccCCCEEEEEEEECCCCCEEEEEecCccccChhHHHHHHHHHHHHHhc-CCCCCcc
Confidence            3567777777888999999999999999999999987521       11                   1334 7899999


Q ss_pred             EEeEeeCC
Q psy1710          66 LYMWWISP   73 (77)
Q Consensus        66 ~~~~~~~~   73 (77)
                      +++.|.++
T Consensus        80 ~~~~~~~~   87 (353)
T cd07850          80 LLNVFTPQ   87 (353)
T ss_pred             eeeeeccC
Confidence            99988654


No 9  
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=97.53  E-value=3e-05  Score=56.46  Aligned_cols=61  Identities=28%  Similarity=0.345  Sum_probs=47.8

Q ss_pred             CceEEeecceEEEeCCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeE
Q psy1710          12 AGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVL   65 (77)
Q Consensus        12 ~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~   65 (77)
                      .|++...++..|++++||...+.||+|+||.||.|.|..+-                          ..+.+ .|+|++.
T Consensus         2 ~~~~~~~~~~~~~~~~~y~~~~~lg~G~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~Ei~~l~~l-~h~~iv~   80 (345)
T cd07877           2 TFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHM-KHENVIG   80 (345)
T ss_pred             ccchhhHHHHHhhccCceEEEEEeeecCCeEEEEEEEcCCCeEEEEEEecCcchhhHHHHHHHHHHHHHHHc-CCCcccc
Confidence            46667777888999999999999999999999999875210                          11445 6899999


Q ss_pred             EEeEeeCC
Q psy1710          66 LYMWWISP   73 (77)
Q Consensus        66 ~~~~~~~~   73 (77)
                      +++.+...
T Consensus        81 ~~~~~~~~   88 (345)
T cd07877          81 LLDVFTPA   88 (345)
T ss_pred             eeeeeeec
Confidence            99987643


No 10 
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=97.40  E-value=0.00014  Score=52.22  Aligned_cols=52  Identities=27%  Similarity=0.355  Sum_probs=38.6

Q ss_pred             EEe-CCCcccccccCCCCCcceEEEEech------------hhh------------------hhccCcchheeEEEeEee
Q psy1710          23 FEV-GPRYTNLAYIGEGAYGMVVSEAPMK------------KLL------------------QKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        23 f~V-~~RY~~lk~IG~GAYG~VcSA~D~~------------~~~------------------~~~~~~~~~~~~~~~~~~   71 (77)
                      |.+ .+||+..+.||+|+||.|+.|.+..            |++                  -+.++.|+|+|.+++.+.
T Consensus         2 ~~~~~~~~~~~~~lG~G~fg~Vy~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l~~h~niv~~~~~~~   81 (338)
T cd05102           2 WEFPRDRLRLGKVLGHGAFGKVVEASAFGIDKKSSCNTVAVKMLKEGATASEHKALMSELKILIHIGNHLNVVNLLGACT   81 (338)
T ss_pred             cccchhHceeeeEeccCCcceEEEEEEeccCCcccchhhheeccccccchHHHHHHHHHHHHHHHhccCcceeeEEeEec
Confidence            444 3789999999999999999996410            111                  145668999999999877


Q ss_pred             CCC
Q psy1710          72 SPT   74 (77)
Q Consensus        72 ~~~   74 (77)
                      .+.
T Consensus        82 ~~~   84 (338)
T cd05102          82 KPN   84 (338)
T ss_pred             CCC
Confidence            654


No 11 
>KOG0595|consensus
Probab=97.38  E-value=0.00015  Score=57.91  Aligned_cols=50  Identities=22%  Similarity=0.171  Sum_probs=38.9

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechhh----------------h----------hhccCcchheeEEEeEeeCCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKKL----------------L----------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~~----------------~----------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ....+|...+.||.|+||+||.|+++.+=                +          -|-+ .|||+|.|+|..-.|.
T Consensus         7 ~~~~~y~~~~~iG~GsfavVykg~h~~~~~~VAIK~i~~~~l~~k~~e~L~~Ei~iLkel-~H~nIV~l~d~~~~~~   82 (429)
T KOG0595|consen    7 RVVGDYELSREIGSGSFAVVYKGRHKKSGTEVAIKCIAKKKLNKKLVELLLSEIKILKEL-KHPNIVRLLDCIEDDD   82 (429)
T ss_pred             cccccceehhhccCcceEEEEEeEeccCCceEEeeeehhhccCHHHHHHHHHHHHHHHhc-CCcceeeEEEEEecCC
Confidence            35567999999999999999999866221                1          1667 6999999999876654


No 12 
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=97.34  E-value=7.7e-05  Score=54.53  Aligned_cols=52  Identities=23%  Similarity=0.315  Sum_probs=38.8

Q ss_pred             EEeC-CCcccccccCCCCCcceEEEEech------------hh------------------hhhccCcchheeEEEeEee
Q psy1710          23 FEVG-PRYTNLAYIGEGAYGMVVSEAPMK------------KL------------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        23 f~V~-~RY~~lk~IG~GAYG~VcSA~D~~------------~~------------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      |.++ +||+..+.||.|+||.|+.|.+..            |+                  ..++++.|+|+|.+++.+.
T Consensus         2 ~~~~~~~~~i~~~lG~G~fg~Vy~a~~~~~~~~~~~~~va~K~~~~~~~~~~~~~~~~E~~~~~~l~~h~niv~~~~~~~   81 (337)
T cd05054           2 WEFPRDRLKLGKPLGRGAFGKVIQASAFGIEKSASCRTVAVKMLKEGATASEYKALMTELKILIHIGHHLNVVNLLGACT   81 (337)
T ss_pred             cccCHHHhhhhcccccCcCceEEeccccccccccccceeeeeeccCCCCHHHHHHHHHHHHHHHhhccCcchhheeeeEe
Confidence            4454 799999999999999999885321            11                  1166778999999999876


Q ss_pred             CCC
Q psy1710          72 SPT   74 (77)
Q Consensus        72 ~~~   74 (77)
                      .+.
T Consensus        82 ~~~   84 (337)
T cd05054          82 KPG   84 (337)
T ss_pred             cCC
Confidence            543


No 13 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=97.23  E-value=0.00031  Score=52.99  Aligned_cols=46  Identities=13%  Similarity=0.146  Sum_probs=37.4

Q ss_pred             CCcccccccCCCCCcceEEEEechhh------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|+.++.||+|+||.|+.|.|..+-                  +-+.+ .|+|+|.+++.|...
T Consensus        92 ~~y~~~~~lg~G~~g~V~~~~d~~~~~~vaiK~~~~~~~~~E~~il~~l-~HpnIv~~~~~~~~~  155 (391)
T PHA03212         92 AGFSILETFTPGAEGFAFACIDNKTCEHVVIKAGQRGGTATEAHILRAI-NHPSIIQLKGTFTYN  155 (391)
T ss_pred             CCcEEEEEEcCCCCeEEEEEEECCCCCEEEEechhhhhhHHHHHHHHhC-CCCCCCCEeEEEEEC
Confidence            67999999999999999999986321                  22566 799999999987654


No 14 
>KOG0665|consensus
Probab=97.20  E-value=0.0004  Score=54.57  Aligned_cols=59  Identities=31%  Similarity=0.362  Sum_probs=48.1

Q ss_pred             ceEEeecc-eEEEeCCCcccccccCCCCCcceEEEEech--------hh------------------hhhccCcchheeE
Q psy1710          13 GNAELVRG-QTFEVGPRYTNLAYIGEGAYGMVVSEAPMK--------KL------------------LQKGAGTNEQLVL   65 (77)
Q Consensus        13 ~~~~~v~~-~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~--------~~------------------~~~~~~~~~~~~~   65 (77)
                      ++..++.+ +.|.++.||.+++++|.|+- .||+|+|..        |.                  +.+++ .|+|+|.
T Consensus         2 ~~~~~i~~~s~ftv~~Ry~nL~p~~~g~~-~v~~a~D~v~~~~v~ikk~~~pf~n~~~akra~rel~l~~~v-~~~nii~   79 (369)
T KOG0665|consen    2 FYSVEIPDSSTFTVPKRYVNLKPIGSGAQ-IVVAAFDQVLGRPVAIKKLSRPFQNQTHAKRAYRELKLMKCV-NHKNIIS   79 (369)
T ss_pred             ceeEEcCCCcceeeeeeeeeecccCCCCc-eEEecchhhccCceehhhhcCccccCccchhhhhhhhhhhhh-cccceee
Confidence            44555555 78999999999999999998 999999872        21                  44888 9999999


Q ss_pred             EEeEeeCC
Q psy1710          66 LYMWWISP   73 (77)
Q Consensus        66 ~~~~~~~~   73 (77)
                      |+..|.|-
T Consensus        80 l~n~ftP~   87 (369)
T KOG0665|consen   80 LLNVFTPQ   87 (369)
T ss_pred             eeeccCcc
Confidence            99988763


No 15 
>KOG0662|consensus
Probab=97.17  E-value=0.00011  Score=55.13  Aligned_cols=46  Identities=28%  Similarity=0.415  Sum_probs=37.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh--h------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--L------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..|..+++||+|.||+|++|.++.+  |                        +-|.+ .|.|+|.|+|+.-|-
T Consensus         2 ~~ydkmekigegtygtvfkarn~~t~eivalkrvrlddddegvpssalreicllkel-khknivrl~dvlhsd   73 (292)
T KOG0662|consen    2 QKYDKMEKIGEGTYGTVFKARNRETHEIVALKRVRLDDDDEGVPSSALREICLLKEL-KHKNIVRLHDVLHSD   73 (292)
T ss_pred             cchHHHHhhcCCcceeeEecccCCccceEEEEEEeccCCCCCCcHHHHHHHHHHHHh-hhcceeehhhhhccC
Confidence            3688899999999999999987643  3                        22667 788999999987653


No 16 
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=97.12  E-value=0.00016  Score=52.47  Aligned_cols=58  Identities=34%  Similarity=0.474  Sum_probs=44.7

Q ss_pred             EEeecceEEEeCCCcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEe
Q psy1710          15 AELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYM   68 (77)
Q Consensus        15 ~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~   68 (77)
                      ........|.+..+|...+.||+|+||.|++|.+..+        +                  ..+.+ .|+|++.+++
T Consensus         3 ~~~~~~~~~~~~~~y~~~~~ig~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~l~~l-~h~niv~~~~   81 (342)
T cd07879           3 REEVNKTVWELPERYTSLKQVGSGAYGSVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELTLLKHM-QHENVIGLLD   81 (342)
T ss_pred             hhhhhhhhhccccceEEEEEeeecCCeEEEEEEeCCCCcEEEEEEecCccccccchhHHHHHHHHHHhc-CCCCccchhh
Confidence            3345567789999999999999999999999987531        1                  11445 6899999999


Q ss_pred             EeeCC
Q psy1710          69 WWISP   73 (77)
Q Consensus        69 ~~~~~   73 (77)
                      .+.++
T Consensus        82 ~~~~~   86 (342)
T cd07879          82 VFTSA   86 (342)
T ss_pred             eeccc
Confidence            87654


No 17 
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=97.03  E-value=0.00099  Score=48.30  Aligned_cols=54  Identities=35%  Similarity=0.584  Sum_probs=42.5

Q ss_pred             ceEEEeCCCcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          20 GQTFEVGPRYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        20 ~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +..|.+.+||+.++.||.|+||.||.|.|..+        +                  ..+.+ .|+|+|.+++.|..+
T Consensus         3 ~~~~~~~~~y~~~~~ig~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~hpniv~~~~~~~~~   81 (328)
T cd07856           3 GTVFEITNRYVDLQPVGMGAFGLVCSARDQLTGQNVAIKKIMKPFSTPVLAKRTYRELKLLKHL-RHENIISLSDIFISP   81 (328)
T ss_pred             cceeccccceEEEEeecccCCeEEEEEEECCCCCEEEEEEecccccccchhHHHHHHHHHHHhc-CCCCeeeEeeeEecC
Confidence            34578899999999999999999999986621        1                  01345 589999999999876


Q ss_pred             C
Q psy1710          74 T   74 (77)
Q Consensus        74 ~   74 (77)
                      .
T Consensus        82 ~   82 (328)
T cd07856          82 L   82 (328)
T ss_pred             C
Confidence            4


No 18 
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=97.02  E-value=0.00026  Score=51.12  Aligned_cols=50  Identities=30%  Similarity=0.527  Sum_probs=38.8

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |++..||..++.||+|+||.||+|.|..+        +                  ..+.+ .|+|++.++|++...
T Consensus         1 ~~~~~~y~~~~~lg~G~~~~vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~ni~~~~~~~~~~   76 (337)
T cd07858           1 FEVDTKYVPIKPIGRGAYGIVCSAKNSETNEKVAIKKIANAFDNRIDAKRTLREIKLLRHL-DHENVIAIKDIMPPP   76 (337)
T ss_pred             CccccceeEEEEeccCCCeEEEEEEecCCCCeEEEEEecccccccchhHHHHHHHHHHHhc-CCCCccchHHheecc
Confidence            56788999999999999999999987531        0                  11445 689999998877643


No 19 
>KOG0600|consensus
Probab=97.00  E-value=0.00044  Score=56.70  Aligned_cols=47  Identities=19%  Similarity=0.368  Sum_probs=38.5

Q ss_pred             CCCcccccccCCCCCcceEEEEechh--h------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK--L------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~--~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.|+.+..||+|.||.|++|+|..+  |                        +-|-+ .|+|||.|-.++.++
T Consensus       116 ~~~feki~kIGeGTyg~VYkAr~~~tgkivALKKvr~d~~~~~~~~t~~REI~ILr~l-~HpNIikL~eivt~~  188 (560)
T KOG0600|consen  116 ADSFEKIEKIGEGTYGQVYKARDLETGKIVALKKVRFDNEKEGFPITAIREIKILRRL-DHPNIIKLEEIVTSK  188 (560)
T ss_pred             hHHHHHHHHhcCcchhheeEeeecccCcEEEEEEeecccCCCcchHHHHHHHHHHHhc-CCCcccceeeEEEec
Confidence            36799999999999999999998732  1                        11556 799999999999887


No 20 
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=96.98  E-value=0.00066  Score=48.18  Aligned_cols=46  Identities=26%  Similarity=0.456  Sum_probs=36.5

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ||+..+.||+|+||.||.|.|+.+                     +     +.+.+ .|+|++.+++.++++.
T Consensus         1 ry~i~~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~hpniv~~~~~~~~~~   72 (338)
T cd07859           1 RYKIQEVIGKGSYGVVCSAIDTHTGEKVAIKKINDVFEHVSDATRILREIKLLRLL-RHPDIVEIKHIMLPPS   72 (338)
T ss_pred             CeEEEEEEeecCCeEEEEEEECCCCCEEEEEEechhhccchhHHHHHHHHHHHHhC-CCCCEeeecceEeccC
Confidence            789999999999999999987631                     0     11445 6999999999988764


No 21 
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=96.97  E-value=0.00032  Score=51.04  Aligned_cols=49  Identities=24%  Similarity=0.291  Sum_probs=37.3

Q ss_pred             CCCcccccccCCCCCcceEEEEech------------h-------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK------------K-------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~------------~-------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+||...+.||+|+||.|+.|.|..            |             +     .-++++.|+|||.+++.+..+.
T Consensus         6 ~~~~~~~~~lG~G~fg~V~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l~~h~niv~~~~~~~~~~   84 (343)
T cd05103           6 RDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPG   84 (343)
T ss_pred             hhHhcccccccCCccceEEEEeeccCCccccceeEEEEEeccCCChHHHHHHHHHHHHHHhccCCccHhhhcceeecCC
Confidence            3789999999999999999986421            0             1     1166778899999998876553


No 22 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=96.95  E-value=0.00098  Score=49.25  Aligned_cols=46  Identities=24%  Similarity=0.376  Sum_probs=35.4

Q ss_pred             CcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .|+.++.||+|+||.|+.|.++.+-                           +.+.+ .|+|+|.+++.+..+.
T Consensus         2 ~f~~~~~LG~G~~g~Vy~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~E~~il~~l-~h~~iv~l~~~~~~~~   74 (381)
T cd05626           2 MFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEA-DNEWVVKLYYSFQDKD   74 (381)
T ss_pred             CceEEEEEeecCCEEEEEEEECCCCCEEEEEEEEHHHhhhhHHHHHHHHHHHHHHhc-CCCCeeeeEEEEecCC
Confidence            5889999999999999999774221                           11445 6899999999887543


No 23 
>KOG0584|consensus
Probab=96.95  E-value=0.0006  Score=56.65  Aligned_cols=51  Identities=20%  Similarity=0.356  Sum_probs=41.5

Q ss_pred             EeCCCcc-cccccCCCCCcceEEEEechhh-------------------hh---------hccCcchheeEEEeEeeCCC
Q psy1710          24 EVGPRYT-NLAYIGEGAYGMVVSEAPMKKL-------------------LQ---------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        24 ~V~~RY~-~lk~IG~GAYG~VcSA~D~~~~-------------------~~---------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +...||. .-..||+|||=+||+|+|..+=                   ||         |.| +|+|+|.+||-|+++.
T Consensus        36 ~p~gRy~k~~evLGrGafKtVYka~De~~giEVAWnqvk~~d~~q~~~~leR~~~Ev~lLKsL-~H~NIirfy~SW~d~~  114 (632)
T KOG0584|consen   36 DPTGRYLKFDEVLGRGAFKTVYKAFDEEEGIEVAWNQVKIRDVTQSPEELERLYSEVHLLKSL-KHPNIIRFYDSWVDTD  114 (632)
T ss_pred             CCCCceeehhhhcccccceeeeeccccccchhhHHHHHhHHHhhcChHHHHHHHHHHHHHccC-CCCceeeeeeheecCC
Confidence            4578884 5678999999999999997322                   11         888 9999999999999975


Q ss_pred             c
Q psy1710          75 Q   75 (77)
Q Consensus        75 ~   75 (77)
                      .
T Consensus       115 n  115 (632)
T KOG0584|consen  115 N  115 (632)
T ss_pred             C
Confidence            3


No 24 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=96.92  E-value=0.00081  Score=47.55  Aligned_cols=49  Identities=27%  Similarity=0.374  Sum_probs=38.1

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh-------h------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK-------L------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      -.++|+.++.||+|+||.|+.|.++.+       +                  +.+.+ .|+|+|.+++++..+.
T Consensus         3 ~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~~   76 (303)
T cd07869           3 KADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGL-KHANIVLLHDIIHTKE   76 (303)
T ss_pred             ccccceEeeeEEecCCEEEEEEEECCCCCEEEEEEeccccccccchhHHHHHHHHhhC-CCCCcCeEEEEEecCC
Confidence            357899999999999999999988521       1                  11455 6899999999987654


No 25 
>KOG0593|consensus
Probab=96.91  E-value=0.00015  Score=57.14  Aligned_cols=43  Identities=30%  Similarity=0.532  Sum_probs=33.1

Q ss_pred             CCcccccccCCCCCcceEEEEech--hh------------------------hhhccCcchheeEEEeEe
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK--KL------------------------LQKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~--~~------------------------~~~~~~~~~~~~~~~~~~   70 (77)
                      ++|+.+-.+|+|+||+|.+.+|+.  +|                        +-|-+ .|||+|.|-.+|
T Consensus         2 ekYE~LgkvGEGSYGvV~KCrnk~TgqIVAIKkF~Esedd~~VkKIAlREIrmLKqL-kH~NLVnLiEVF   70 (396)
T KOG0593|consen    2 EKYEKLGKVGEGSYGVVMKCRNKDTGQIVAIKKFVESEDDPVVKKIALREIRMLKQL-KHENLVNLIEVF   70 (396)
T ss_pred             cHHhhhhccccCcceEEEEeccCCcccEEEEEeeccCCccHHHHHHHHHHHHHHHhc-ccchHHHHHHHH
Confidence            589999999999999998887662  22                        22667 789999875543


No 26 
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=96.82  E-value=0.0012  Score=48.63  Aligned_cols=46  Identities=24%  Similarity=0.374  Sum_probs=35.1

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|+.++.||+|+||.||.|.++.+       +                    +.+.+ .|+|+|.+++.|..+
T Consensus         1 ~~f~~~~~LG~G~~g~Vy~a~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~E~~il~~~-~h~~iv~~~~~~~~~   73 (382)
T cd05625           1 SMFVKIKTLGIGAFGEVCLARKVDTKALYAMKTLRKKDVLLRNQVAHVKAERDILAEA-DNEWVVRLYYSFQDK   73 (382)
T ss_pred             CCcEEEEEEEeCCCEEEEEEEECCCCCEEEEEEEeHHHhhhHHHHHHHHHHHHHHHhC-CCCcCCeEEEEEEeC
Confidence            3689999999999999999987421       0                    01334 688999999988654


No 27 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=96.81  E-value=0.0014  Score=46.12  Aligned_cols=47  Identities=23%  Similarity=0.251  Sum_probs=36.0

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+.++.||.|+||.|+.|.++.+-                         .-+.+ .|+|++.+++++...
T Consensus         4 ~~~y~~~~~lg~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~   75 (288)
T cd07871           4 LETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNL-KHANIVTLHDIIHTE   75 (288)
T ss_pred             cccceEeeEEecCCCEEEEEEEECCCCCEEEEEEecccccCCcchhHHHHHHHHHhC-CCCCEeeEEEEEcCC
Confidence            357999999999999999999875210                         11445 689999999987543


No 28 
>KOG0032|consensus
Probab=96.78  E-value=0.0023  Score=49.62  Aligned_cols=52  Identities=17%  Similarity=0.248  Sum_probs=41.6

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechh-------------h--------------hhhccCcchheeEEEeEeeCCC
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKK-------------L--------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------------~--------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      -.+..+|+..+.||.|+||.|+.|.++.+             +              .-+++..|+|+|+|+|+|-.+.
T Consensus        31 ~~~~~~Y~l~~~lG~G~Fg~v~~~~~~~tg~~~A~K~i~k~~~~~~~~~~~v~~Ev~il~~l~~hpniv~l~~~~e~~~  109 (382)
T KOG0032|consen   31 EDIKEKYELGRELGRGQFGVVYLCREKSTGKEVACKVIPKRKLRGKEDREDVRREVAILQQLSGHPNIVQLKDAFEDPD  109 (382)
T ss_pred             ccccccEEehhhhCCCCceEEEEEEecCCCceeEEEEeehhhccccccHHHHHHHHHHHHhccCCCCEEEEEEEEEcCC
Confidence            45677899999999999999999887641             1              0156645999999999998876


No 29 
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=96.72  E-value=0.0015  Score=45.78  Aligned_cols=48  Identities=27%  Similarity=0.304  Sum_probs=36.6

Q ss_pred             CCCcccccccCCCCCcceEEEEech------------hh------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK------------KL------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~------------~~------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+||+..+.||+|+||.|+.|.++.            |+                  ..+.+ .|+|++.+++.+..+.
T Consensus         5 ~~~~~i~~~lg~G~~g~Vy~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~~   82 (288)
T cd05061           5 REKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGF-TCHHVVRLLGVVSKGQ   82 (288)
T ss_pred             HHHceeeeeecCCCCcEEEEEEEeccCCCCcceEEEEEECCCcCCHHHHHHHHHHHHHHHhC-CCCCeeeEEEEEcCCC
Confidence            5789999999999999999886431            11                  11445 5899999999887654


No 30 
>KOG0575|consensus
Probab=96.71  E-value=0.0018  Score=53.52  Aligned_cols=44  Identities=23%  Similarity=0.536  Sum_probs=35.6

Q ss_pred             CCcccccccCCCCCcceEEEEec------------hhh----------hh-----hccCcchheeEEEeEee
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPM------------KKL----------LQ-----KGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~------------~~~----------~~-----~~~~~~~~~~~~~~~~~   71 (77)
                      .||+.-++||+|+|..++.|.|.            +++          ++     +-+ .|+|||++|+.|=
T Consensus        18 ~~Y~~g~~LGkGgFA~cYe~~~~~tge~~A~KvVpk~~l~k~~~reKv~~EIeIHr~L-~HpnIV~f~~~FE   88 (592)
T KOG0575|consen   18 KRYKRGRFLGKGGFARCYEARDLDTGEVVAVKVVPKKLLKKPKQREKVLNEIEIHRSL-KHPNIVQFYHFFE   88 (592)
T ss_pred             ceeeeeeeeccCcceEEEEEEEcCCCcEEEEEEeehHHhcCcchHHHHHHHHHHHHhc-CCCcEEeeeeEee
Confidence            68999999999999999999982            111          11     566 8999999999874


No 31 
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=96.69  E-value=0.002  Score=47.35  Aligned_cols=47  Identities=19%  Similarity=0.325  Sum_probs=36.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------h--------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------L--------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------~--------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ++|..++.||.|+||.|+.|.++.+             +              +-+.+ .|+|+|.+++.|..+.
T Consensus         1 ~~y~~~~~lG~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~E~~il~~l-~hp~iv~~~~~~~~~~   74 (377)
T cd05629           1 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMFKKDQLAHVKAERDVLAES-DSPWVVSLYYSFQDAQ   74 (377)
T ss_pred             CCceEeEEEeecCCEEEEEEEECCCCCEEEEEEEEHHHHHHhHHHHHHHHHHHHHHhC-CCCCcceEEEEEEcCC
Confidence            3688999999999999999987521             0              00344 6899999999987654


No 32 
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=96.64  E-value=0.0021  Score=45.29  Aligned_cols=48  Identities=23%  Similarity=0.223  Sum_probs=37.2

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .++|..++.||.|+||.|+.|.|+.+=                         +.+.+ .|+|++.+++++..+.
T Consensus         5 ~~~y~~~~~lg~g~~g~vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~nI~~~~~~~~~~~   77 (301)
T cd07873           5 LETYIKLDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDL-KHANIVTLHDIIHTEK   77 (301)
T ss_pred             ccceEEeeEeccCcCEEEEEEEEcCCCcEEEEEEEecccccCchhHHHHHHHHHHhc-CCCCcceEEEEEecCC
Confidence            467999999999999999999875210                         11445 6899999999987653


No 33 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=96.64  E-value=0.0011  Score=44.84  Aligned_cols=43  Identities=16%  Similarity=0.295  Sum_probs=35.4

Q ss_pred             cccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      |+..+.||+|+||.|+.|.+..+=                          ..+++ .|+|++.+++++..
T Consensus         1 y~~~~~lg~G~~g~v~~~~~~~~~~~~~~K~~~~~~~~~~~~~~~~~e~~~~~~l-~~~~i~~~~~~~~~   69 (260)
T PF00069_consen    1 YRLVKKLGSGGFGTVYKAKNKKNGQKVAVKIIDKSEIEEEEREENIREIKILRRL-RHPNIVQILDVFQD   69 (260)
T ss_dssp             EEEEEEEEEESSEEEEEEEETTTTEEEEEEEEESTTHHHHHHHHHHHHHHHHHHH-TBTTBCHEEEEEEE
T ss_pred             CEEeEEEEeCCCEEEEEEEECCCCeEEEEEEeccccccccccchhhhhhhccccc-cccccccccccccc
Confidence            788999999999999999887442                          22677 79999999998864


No 34 
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=96.63  E-value=0.0023  Score=44.50  Aligned_cols=45  Identities=29%  Similarity=0.458  Sum_probs=33.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh---h-----h-------------------hhccC--cchheeEEEeEee
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK---L-----L-------------------QKGAG--TNEQLVLLYMWWI   71 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~---~-----~-------------------~~~~~--~~~~~~~~~~~~~   71 (77)
                      .||+.++.||+|+||.|+.|.|..+   .     +                   -+.+.  .|+|++.++|++.
T Consensus         1 ~~Y~~~~~lg~G~~g~Vy~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~~e~~~l~~l~~~~hpniv~~~~~~~   74 (290)
T cd07862           1 QQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCT   74 (290)
T ss_pred             CCcceeeEeccCCCeEEEEEEEcCCCCeEEEEEEEecccCCCCchHHHHHHHHHHHhhcccCCCCcceEEEEEe
Confidence            4799999999999999999987321   1     0                   02222  5899999999874


No 35 
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=96.60  E-value=0.0022  Score=46.56  Aligned_cols=47  Identities=23%  Similarity=0.329  Sum_probs=36.2

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ++|+.++.||+|+||.|+.|.|..+       +                    +-+.+ .|+|++.+++.+..+.
T Consensus         1 ~~y~~~~~lG~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~E~~il~~l-~h~~iv~~~~~~~~~~   74 (364)
T cd05599           1 DDFESIKVIGRGAFGEVRLVQKKDTGHIYAMKKLRKSEMLEKEQVAHVRAERDILAEA-DNPWVVKLYYSFQDEN   74 (364)
T ss_pred             CCceEEEEEEecCCEEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhC-CCCCCcceEEEEEcCC
Confidence            3689999999999999999987531       0                    11344 5899999999987654


No 36 
>KOG0667|consensus
Probab=96.57  E-value=0.0016  Score=53.78  Aligned_cols=24  Identities=38%  Similarity=0.624  Sum_probs=22.4

Q ss_pred             CCcccccccCCCCCcceEEEEech
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      .||+.++.||+|+||.|.+|.|..
T Consensus       186 ~rY~V~e~LGkGtFGQVvk~~d~~  209 (586)
T KOG0667|consen  186 YRYEVLEVLGKGSFGQVVKAYDHK  209 (586)
T ss_pred             EEEEEEEEecccccceeEEEEecC
Confidence            399999999999999999999985


No 37 
>KOG0661|consensus
Probab=96.55  E-value=0.00037  Score=56.91  Aligned_cols=51  Identities=16%  Similarity=0.201  Sum_probs=41.4

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechhh------------hh-------------hccCcchheeEEEeEeeCCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKKL------------LQ-------------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~~------------~~-------------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+.+||..++.||.|.||.|+.|..+.+-            ++             |-+..|+|+|.|.++++-+-
T Consensus         7 ~~m~RY~~i~klGDGTfGsV~la~~~~~~~~VAIK~MK~Kf~s~ee~~nLREvksL~kln~hpniikL~Evi~d~~   82 (538)
T KOG0661|consen    7 IFMDRYTVIRKLGDGTFGSVYLAKSKETGELVAIKKMKKKFYSWEECMNLREVKSLRKLNPHPNIIKLKEVIRDND   82 (538)
T ss_pred             hHHHHHHHHHHhcCCcceeEEEeeecCCCceeeHHHHHhhhccHHHHHHHHHHHHHHhcCCCCcchhhHHHhhccC
Confidence            46789999999999999999999766332            11             67778999999999987653


No 38 
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=96.54  E-value=0.0011  Score=47.68  Aligned_cols=49  Identities=41%  Similarity=0.678  Sum_probs=37.5

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.++|+..+.||+|+||.||.|.|..+=                         +.+.+ .|+|++.+++++...
T Consensus         2 ~~~~~y~i~~~lg~G~~g~vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~   75 (336)
T cd07849           2 DVGPRYQNLSYIGEGAYGMVCSATHKPTGVKVAIKKISPFEHQTFCQRTLREIKILRRF-KHENIIGILDIIRPP   75 (336)
T ss_pred             ccccceEEEEEEEecCCeEEEEEEEcCCCCeEEEEEecccccchhHHHHHHHHHHHHhC-CCCCcCchhheeecc
Confidence            46789999999999999999999875210                         11445 589999999876554


No 39 
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=96.52  E-value=0.002  Score=44.55  Aligned_cols=44  Identities=23%  Similarity=0.234  Sum_probs=34.1

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-----------------h-----hhhccCcchheeEEEeEe
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-----------------L-----LQKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~-----~~~~~~~~~~~~~~~~~~   70 (77)
                      ..||...+.||+|+||.|+.|.+...                 +     ..+.+ .|+|++.+++.+
T Consensus         5 ~~~~~~~~~lg~g~~~~v~~~~~~~~~~valK~~~~~~~~~~~~~~E~~~l~~l-~~~~i~~~~~~~   70 (262)
T cd05071           5 RESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKL-RHEKLVQLYAVV   70 (262)
T ss_pred             hHHeeEeeecCCCCCCcEEEEEecCCceEEEEecccCccCHHHHHHHHHHHHhC-CCCCcceEEEEE
Confidence            47899999999999999999976432                 0     11456 589999999865


No 40 
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=96.52  E-value=0.004  Score=47.37  Aligned_cols=52  Identities=23%  Similarity=0.269  Sum_probs=38.5

Q ss_pred             EEEe-CCCcccccccCCCCCcceEEEEech------------hhh------------------hhccCcchheeEEEeEe
Q psy1710          22 TFEV-GPRYTNLAYIGEGAYGMVVSEAPMK------------KLL------------------QKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        22 ~f~V-~~RY~~lk~IG~GAYG~VcSA~D~~------------~~~------------------~~~~~~~~~~~~~~~~~   70 (77)
                      .|++ .++|...+.||+|+||.|+.|.+..            |.+                  -++++.|+|+|.|+++|
T Consensus        31 ~~~~~~~~~~~~~~LG~G~fG~Vy~~~~~~~~~~~~~~~vavK~l~~~~~~~~~~~~~~Ei~~l~~l~~HpnIv~l~~~~  110 (400)
T cd05105          31 RWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGAC  110 (400)
T ss_pred             ceeccccceehhheecCCCCceEEEEEEcccCCCCCceEEEEEecCCCCChHHHHHHHHHHHHHHhcCCCCCeeeEEEEE
Confidence            3543 5788899999999999999886521            111                  15676799999999998


Q ss_pred             eCC
Q psy1710          71 ISP   73 (77)
Q Consensus        71 ~~~   73 (77)
                      ...
T Consensus       111 ~~~  113 (400)
T cd05105         111 TKS  113 (400)
T ss_pred             ccC
Confidence            653


No 41 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=96.52  E-value=0.003  Score=43.74  Aligned_cols=46  Identities=26%  Similarity=0.311  Sum_probs=34.1

Q ss_pred             CcccccccCCCCCcceEEEEechh-------hh-------------------hhccC--cchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------LL-------------------QKGAG--TNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~~-------------------~~~~~--~~~~~~~~~~~~~~~   73 (77)
                      ||+.++.||+|+||.|+.|.|+.+       ++                   .+.+.  .|+|++.+++++..+
T Consensus         1 ~y~~~~~lg~g~~g~v~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~e~~~l~~l~~~~h~ni~~~~~~~~~~   74 (288)
T cd07863           1 QYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVQTNEDGLPLSTVREVALLKRLEAFDHPNIVRLMDVCATS   74 (288)
T ss_pred             CceEeeEEeecCCeEEEEEEECCCCcEEEEEEeccCcCCCCCchHHHHHHHHHHHhhhcCCCCeeeeeeeeccc
Confidence            688999999999999999987631       00                   02221  589999999987653


No 42 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=96.48  E-value=0.0023  Score=49.00  Aligned_cols=48  Identities=17%  Similarity=0.366  Sum_probs=36.9

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh--------h------------hhhccCcchheeEEEeEeeCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK--------L------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ...+|...+.||+|+||.|+.|.+..+        +            +-+.+ .|+|+|.|++.|...
T Consensus        64 ~~~~y~~~~~LG~G~fg~Vy~~~~~~~~~~vAiK~i~~~~~~~~~Ei~il~~l-~h~niv~l~~~~~~~  131 (440)
T PTZ00036         64 PNKSYKLGNIIGNGSFGVVYEAICIDTSEKVAIKKVLQDPQYKNRELLIMKNL-NHINIIFLKDYYYTE  131 (440)
T ss_pred             cCCeEEEeEEEEeCCCEEEEEEEECCCCCEEEEEEEecCcchHHHHHHHHHhc-CCCCCcceeeeEeec
Confidence            346899999999999999999987421        1            11455 699999999987643


No 43 
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=96.45  E-value=0.0028  Score=47.05  Aligned_cols=48  Identities=25%  Similarity=0.251  Sum_probs=35.6

Q ss_pred             CCcccccccCCCCCcceEEEEec-------h-----hhh------------------hhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPM-------K-----KLL------------------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~-------~-----~~~------------------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ++|...+.||+|+||.|+.|.+.       .     |++                  -+.++.|+|+|.+++.+....
T Consensus        35 ~~~~~~~~LG~G~fG~V~~~~~~~~~~~~~~~~vavK~l~~~~~~~~~~~~~~Ei~il~~l~~HpnIv~l~~~~~~~~  112 (375)
T cd05104          35 NRLSFGKTLGAGAFGKVVEATAYGLFKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHINIVNLLGACTVGG  112 (375)
T ss_pred             HHeehhheecCCccceEEEEEEeccccCccceeEEEEeccCCcCcHHHHHHHHHHHHHHHhcCCcceeeeeeeeccCC
Confidence            57999999999999999988531       0     111                  134668999999999876554


No 44 
>KOG0615|consensus
Probab=96.45  E-value=0.0025  Score=51.47  Aligned_cols=49  Identities=20%  Similarity=0.312  Sum_probs=38.7

Q ss_pred             eCCCcccccccCCCCCcceEEEEechhh-------hh------------------------hccCcchheeEEEeEeeCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKKL-------LQ------------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~~-------~~------------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..+.|...+.||+||||.|-.|+++++=       +.                        |-+ .|+|+|+++|||--|
T Consensus       170 ~~d~yii~~~LGsGafg~Vkla~e~~tgk~vAiKIi~krk~~~~s~~~~~~~~v~~EieILkkL-~HP~IV~~~d~f~~~  248 (475)
T KOG0615|consen  170 FNDYYIISKTLGSGAFGLVKLAYEKKTGKQVAIKIINKRKSTGCSRAIAKTRDVQNEIEILKKL-SHPNIVRIKDFFEVP  248 (475)
T ss_pred             hcceeEeeeeecCCceeEEEEEEEcccCcEEEeeeeehhhcccccccccchhhhHHHHHHHHhc-CCCCEEEEeeeeecC
Confidence            3567888999999999999999887432       10                        445 799999999999766


Q ss_pred             C
Q psy1710          74 T   74 (77)
Q Consensus        74 ~   74 (77)
                      -
T Consensus       249 d  249 (475)
T KOG0615|consen  249 D  249 (475)
T ss_pred             C
Confidence            4


No 45 
>KOG1152|consensus
Probab=96.44  E-value=0.0011  Score=55.68  Aligned_cols=26  Identities=38%  Similarity=0.531  Sum_probs=22.5

Q ss_pred             CCcccccccCCCCCcceEEEEechhh
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL   52 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~   52 (77)
                      ..|.-++++|+||||.|..|.|+++-
T Consensus       561 s~yttlq~lG~GAyGkV~lai~K~n~  586 (772)
T KOG1152|consen  561 SDYTTLQPLGEGAYGKVNLAIHKENN  586 (772)
T ss_pred             ccceeeeeccccccceEEEeeecccc
Confidence            34889999999999999999998553


No 46 
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=96.42  E-value=0.0031  Score=44.50  Aligned_cols=23  Identities=22%  Similarity=0.190  Sum_probs=20.3

Q ss_pred             CCCcccccccCCCCCcceEEEEe
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAP   48 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D   48 (77)
                      ..||...+.||+|+||.|+.|.+
T Consensus         4 ~~~~~~~~~lg~G~fg~V~~~~~   26 (304)
T cd05096           4 RGHLLFKEKLGEGQFGEVHLCEV   26 (304)
T ss_pred             hhhCeeeeEecccCCeEEEEEEe
Confidence            46899999999999999999864


No 47 
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=96.41  E-value=0.0048  Score=44.18  Aligned_cols=28  Identities=36%  Similarity=0.640  Sum_probs=23.9

Q ss_pred             EEEeCCCcccc-cccCCCCCcceEEEEec
Q psy1710          22 TFEVGPRYTNL-AYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        22 ~f~V~~RY~~l-k~IG~GAYG~VcSA~D~   49 (77)
                      .+++.+||..+ +.||.|+||.|+.|.|+
T Consensus         3 ~~~~~~ry~~~~~~ig~G~~g~vy~~~~~   31 (335)
T PTZ00024          3 SFSISERYIQKGAHLGEGTYGKVEKAYDT   31 (335)
T ss_pred             ccccccchhhhhhcccCCCceeEEEEEEC
Confidence            46788999865 67999999999999876


No 48 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=96.40  E-value=0.0036  Score=44.36  Aligned_cols=47  Identities=23%  Similarity=0.246  Sum_probs=36.4

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|..++.||+|+||.|+.|.|+.+-                         +-+.+ .|+|++.+++.+..+
T Consensus         5 ~~~y~~~~~lg~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~   76 (309)
T cd07872           5 METYIKLEKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDL-KHANIVTLHDIVHTD   76 (309)
T ss_pred             CCceEEEEEecccCCEEEEEEEecCCCCeEEEEEeeccccCCcchhHHHHHHHHHhC-CCCCcceEEEEEeeC
Confidence            468999999999999999999875211                         11345 689999999988654


No 49 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=96.39  E-value=0.004  Score=45.61  Aligned_cols=45  Identities=29%  Similarity=0.384  Sum_probs=34.7

Q ss_pred             CcccccccCCCCCcceEEEEechh-------hh--------------------hhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------LL--------------------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~~--------------------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .|+.++.||+|+||.|+.|.|+.+       ++                    -+.+ .|+|++.+++.|...
T Consensus         2 ~y~~~~~lG~G~~g~V~~a~~~~~~~~~avK~~~~~~~~~~~~~~~~~~E~~il~~l-~h~~iv~~~~~~~~~   73 (376)
T cd05598           2 MFVKIKTIGIGAFGEVCLVRKVDTNALYAMKTLRKADVLMRNQAAHVKAERDILAEA-DNEWVVKLYYSFQDK   73 (376)
T ss_pred             CceEEEEEEeCCCeEEEEEEECCCCCEEEEEEEcHHHHHhhhhHHHHHHHHHHHHhC-CCCCcceEEEEEEcC
Confidence            689999999999999999987631       11                    0334 689999999988654


No 50 
>KOG0594|consensus
Probab=96.36  E-value=0.0027  Score=49.15  Aligned_cols=47  Identities=23%  Similarity=0.292  Sum_probs=36.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchh-eeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQ-LVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~-~~~~~~~~~~~   73 (77)
                      ...|..+..||+|+||.|+.|+++.+=                          +-|.+ .|.| +|.|+|++..-
T Consensus        10 ~~~~~~~eklGeGtyg~Vykar~~~~g~~VALKkirl~~~~EG~P~taiREisllk~L-~~~~~iv~L~dv~~~~   83 (323)
T KOG0594|consen   10 MFDYEKVEKLGEGTYGVVYKARSKRTGKFVALKKIRLEFEEEGVPSTAIREISLLKRL-SHANHIVRLHDVIHTS   83 (323)
T ss_pred             HHHHHHHHHhCCCCceEEEEEEEecCCCEEEEEEEeccccccCCCchhhHHHHHHHHh-CCCcceEEEEeeeeec
Confidence            456899999999999999999877321                          22677 5667 99999998653


No 51 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=96.36  E-value=0.0039  Score=48.65  Aligned_cols=24  Identities=17%  Similarity=0.252  Sum_probs=20.8

Q ss_pred             eCCCcccccccCCCCCcceEEEEe
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAP   48 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D   48 (77)
                      +..+|+.++.||+|+||.|+.|.+
T Consensus       146 ~~~~Y~ii~~LG~G~fG~Vyl~~~  169 (501)
T PHA03210        146 FLAHFRVIDDLPAGAFGKIFICAL  169 (501)
T ss_pred             hhhccEEEeEecCCCCcceEEEEE
Confidence            457899999999999999998753


No 52 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=96.35  E-value=0.0034  Score=45.36  Aligned_cols=47  Identities=15%  Similarity=0.252  Sum_probs=36.4

Q ss_pred             CCCcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+.++.||+|+||.|+.|.+..+                    +     +-+.+ .|+|+|.+++.+...
T Consensus         4 ~~~y~~~~~lg~G~~g~V~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~   75 (331)
T cd06649           4 DDDFERISELGAGNGGVVTKVQHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHEC-NSPYIVGFYGAFYSD   75 (331)
T ss_pred             cccceEEEeecCCCCEEEEEEEECCCCcEEEEEEeecccCHHHHHHHHHHHHHHHHC-CCCCCCeEEEEEEEC
Confidence            46899999999999999999987621                    1     11445 689999999987654


No 53 
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=96.27  E-value=0.0049  Score=41.77  Aligned_cols=49  Identities=20%  Similarity=0.308  Sum_probs=38.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-----------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-----------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-----------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+||+..+.||.|+||.|+.|.++.+-                       +-+.+..|+|++.+++.++.+.
T Consensus         5 ~~~y~~~~~l~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~e~~~l~~~~~h~~i~~~~~~~~~~~   76 (275)
T cd06608           5 TGIFELVEVIGEGTYGKVYKARHKKTGQLVAIKIMDIIEDEEEEIKEEYNILRKYSNHPNIATFYGAFIKKN   76 (275)
T ss_pred             hhheeheeeecCCCCeEEEEEEECCCCcEEEEEEEecCchhHHHHHHHHHHHHHhcCCCChheEEEEEEecC
Confidence            478999999999999999999885311                       1133447999999999987654


No 54 
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=96.25  E-value=0.0033  Score=46.75  Aligned_cols=47  Identities=21%  Similarity=0.271  Sum_probs=35.4

Q ss_pred             CCcccccccCCCCCcceEEEEech------------hh------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK------------KL------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~------------~~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||+|+||.|+.|.+..            |.                  +-+.++.|+|+|.+++.+..+
T Consensus        38 ~~~~~~~~LG~G~fg~V~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~il~~l~~h~nIv~~~~~~~~~  114 (374)
T cd05106          38 DNLQFGKTLGAGAFGKVVEATAFGLGKEDNVLRVAVKMLKASAHTDEREALMSELKILSHLGQHKNIVNLLGACTHG  114 (374)
T ss_pred             HHceehheecCCCcccEEEEEEecCCcccccceeEEEeccCCCCHHHHHHHHHHHHHHHhhccCCceeeEeeEecCC
Confidence            568999999999999999887421            11                  114566899999999987543


No 55 
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=96.25  E-value=0.0024  Score=46.87  Aligned_cols=45  Identities=18%  Similarity=0.152  Sum_probs=34.9

Q ss_pred             cccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      |+.++.||+|+||.|++|.|..+                     +     .-+.+ .|+|++.++|++..+.
T Consensus         2 ~~~~~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~~   72 (372)
T cd07853           2 VEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFF-KHDNVLSALDILQPPH   72 (372)
T ss_pred             CcccceeeeCCCEEEEEEEECCCCCEEEEEeccccccchHHHHHHHHHHHHHHhC-CCCCcCCHhheecCCC
Confidence            67789999999999999987521                     0     11455 7999999999987664


No 56 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=96.22  E-value=0.0042  Score=42.64  Aligned_cols=47  Identities=21%  Similarity=0.274  Sum_probs=34.9

Q ss_pred             EEeC-CCcccccccCCCCCcceEEEEechh--h--------------------hhhccCcchheeEEEeEe
Q psy1710          23 FEVG-PRYTNLAYIGEGAYGMVVSEAPMKK--L--------------------LQKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        23 f~V~-~RY~~lk~IG~GAYG~VcSA~D~~~--~--------------------~~~~~~~~~~~~~~~~~~   70 (77)
                      |+++ +||.....||+|+||.||.|.+...  +                    ..+.+ .|+|++.+++.+
T Consensus         1 ~~~~~~~~~~~~~ig~g~~~~v~~~~~~~~~~~~lK~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~   70 (260)
T cd05069           1 WEIPRESLRLDVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKL-RHDKLVPLYAVV   70 (260)
T ss_pred             CcCChHHeeeeeeecCcCCCeEEEEEEcCCceEEEEEcccCCccHHHHHHHHHHHHhC-CCCCeeeEEEEE
Confidence            4444 7899999999999999999976431  1                    11445 688999998865


No 57 
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=96.22  E-value=0.0026  Score=44.17  Aligned_cols=45  Identities=24%  Similarity=0.387  Sum_probs=34.2

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||+|+||.|+.|.++.+-                          ..+.+ .|+|++.+++.+..
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~   71 (287)
T cd07848           1 NKFEVLGVVGEGAYGVVLKCRHKETKEIVAIKKFKDSEENEEVKETTLRELKMLRTL-KQENIVELKEAFRR   71 (287)
T ss_pred             CCceEEEEecccCCEEEEEEEECCCCcEEEEEEEecccccccchhhHHHHHHHHHhC-CCccccchhhhEec
Confidence            47999999999999999999876211                          11444 68899999887643


No 58 
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=96.19  E-value=0.004  Score=44.25  Aligned_cols=46  Identities=20%  Similarity=0.221  Sum_probs=34.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--h------------------hhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--L------------------QKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--~------------------~~~~~~~~~~~~~~~~~~~   72 (77)
                      ..|+..+.||+|+||.|+.|.++.+       +  +                  -+.++.|+|++.+++.+..
T Consensus         7 ~~~~~~~~lg~G~~g~V~~a~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~Ei~~l~~l~~h~~iv~~~~~~~~   79 (303)
T cd05088           7 NDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEH   79 (303)
T ss_pred             hhceeeeeecCCCCceEEEEEEccCCceeeEEEEEecccCCHHHHHHHHHHHHHHHHhcCCCCcceEEEEECC
Confidence            3578889999999999999986421       0  0                  1456789999999998754


No 59 
>PHA03209 serine/threonine kinase US3; Provisional
Probab=96.17  E-value=0.0033  Score=46.16  Aligned_cols=48  Identities=15%  Similarity=0.185  Sum_probs=37.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h-----------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L-----------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~-----------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..+|..++.||+|+||.|+.|.+..+       +           +.+.+ .|+|+|.+++++....
T Consensus        65 ~~~y~~~~~lg~G~~g~Vy~~~~~~~~~~valK~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~~  130 (357)
T PHA03209         65 SLGYTVIKTLTPGSEGRVFVATKPGQPDPVVLKIGQKGTTLIEAMLLQNV-NHPSVIRMKDTLVSGA  130 (357)
T ss_pred             hcCcEEEEEecCCCCeEEEEEEECCCCceEEEEeCCccccHHHHHHHHhC-CCCCCcChhheEEeCC
Confidence            35799999999999999999987532       1           22445 6899999999887543


No 60 
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=96.16  E-value=0.0046  Score=43.12  Aligned_cols=47  Identities=30%  Similarity=0.392  Sum_probs=35.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|..++.||+|+||.|+.|.++.+                    +     .-+.+ .|+|++.+++.+...
T Consensus         4 ~~~y~~~~~ig~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~l~~l-~h~ni~~~~~~~~~~   75 (291)
T cd07870           4 ATSYLNLEKLGEGSYATVYKGISRINGQLVALKVISMKTEEGVPFTAIREASLLKGL-KHANIVLLHDIIHTK   75 (291)
T ss_pred             cceeEEEEEEEecCCEEEEEEEEcCCCcEEEEEEecccCcCCCcHHHHHHHHHHHhc-CCCCEeEEEEEEecC
Confidence            36799999999999999999976421                    0     11345 689999999987654


No 61 
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=96.14  E-value=0.0048  Score=42.24  Aligned_cols=48  Identities=19%  Similarity=0.320  Sum_probs=36.6

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh------------------hh-----hhccCcchheeEEEeEeeC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK------------------LL-----QKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~------------------~~-----~~~~~~~~~~~~~~~~~~~   72 (77)
                      ...+|...+.||+|+||.|++|.+..+                  +.     -+.+..|+|++.+++.++.
T Consensus         4 ~~~~y~~~~~lg~g~~g~vy~~~~~~~~~~~aik~~~~~~~~~~~~~~e~~~l~~~~~h~~i~~~~~~~~~   74 (272)
T cd06637           4 PAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFIK   74 (272)
T ss_pred             hhhhhhHHHheeecCCeEEEEEEEcCCCcEEEEEEEEcCCccHHHHHHHHHHHHHhcCCCCeeeEeeEEee
Confidence            456899999999999999999986421                  11     1344468999999998874


No 62 
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=96.14  E-value=0.0056  Score=43.30  Aligned_cols=41  Identities=20%  Similarity=0.331  Sum_probs=30.8

Q ss_pred             cccCCCCCcceEEEEechh-------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.++..                   +     +-+++ .|+|+|.+++++....
T Consensus         7 ~~lG~G~~g~Vy~~~~~~~~~~~~~aiK~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~~   71 (317)
T cd07868           7 CKVGRGTYGHVYKAKRKDGKDDRDYALKQIEGTGISMSACREIALLREL-KHPNVISLQKVFLSHA   71 (317)
T ss_pred             cccccCCCeEEEEEEEccCCCCceEEEEEECCCCCcHHHHHHHHHHHhc-CCCCCcceeeeEecCC
Confidence            5699999999999985420                   0     11555 6899999999987654


No 63 
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=96.14  E-value=0.0033  Score=45.61  Aligned_cols=37  Identities=35%  Similarity=0.484  Sum_probs=32.8

Q ss_pred             ceEEeecceEEEeCCCcccccccCCCCCcceEEEEec
Q psy1710          13 GNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        13 ~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      |++.+.++..|++.++|+..+.||+|.||.|+.|.+.
T Consensus         1 ~~~~~~~~~~~~~~~~y~~~~~ig~g~~g~vy~~~~~   37 (343)
T cd07851           1 FYRQELNKTVWEVPDRYQNLSPVGSGAYGQVCSAFDT   37 (343)
T ss_pred             CcchhhccceecccCceEEEEEeccCCceEEEEEEEC
Confidence            4566777888999999999999999999999999875


No 64 
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=96.12  E-value=0.007  Score=41.33  Aligned_cols=47  Identities=23%  Similarity=0.249  Sum_probs=35.6

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h---------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L---------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~---------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+.++.||+|+||.|++|.+...       +               +.+.+ .|+|++.+++.+...
T Consensus         5 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~v~iK~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   73 (261)
T cd05072           5 RESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTL-QHDKLVRLYAVVTKE   73 (261)
T ss_pred             hHHeEEeeecCCcCCceEEEEEecCCceEEEEEccCCchhHHHHHHHHHHHHhC-CCCCeeeEEEEEcCC
Confidence            46789999999999999999975421       0               11555 789999999887543


No 65 
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=96.09  E-value=0.0058  Score=42.26  Aligned_cols=48  Identities=23%  Similarity=0.404  Sum_probs=36.5

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh-------hh----------------hhccCcchheeEEEeEee
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK-------LL----------------QKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~~----------------~~~~~~~~~~~~~~~~~~   71 (77)
                      ...++|+.++.||+|+||.|++|.++..       ++                .+-+..|+|++.+++.+.
T Consensus        15 ~~~~~~~~~~~lg~g~~~~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~e~~~l~~l~~h~~i~~~~~~~~   85 (286)
T cd06638          15 DPSDTWEIIETIGKGTYGKVFKVLNKKNGSKAAVKILDPIHDIDEEIEAEYNILKALSDHPNVVKFYGMYY   85 (286)
T ss_pred             CcccceeeeeeeccCCCcEEEEEEECCCCceeEEEeeccccchHHHHHHHHHHHHHHhcCCCeeeeeeeee
Confidence            3568999999999999999999987521       11                123446899999999875


No 66 
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=96.08  E-value=0.0071  Score=42.49  Aligned_cols=46  Identities=15%  Similarity=0.270  Sum_probs=34.8

Q ss_pred             CcccccccCCCCCcceEEEEechh--------h-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------L-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +|+.++.||+|+||.||.|.+..+        +                   +-+.+ .|+|++.+++.+..+.
T Consensus         1 ~y~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~~   73 (285)
T cd05605           1 TFRHYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKV-NSRFVVSLAYAYETKD   73 (285)
T ss_pred             CceEEEEEecCCCeEEEEEEEcCCCceEEEEEEehhhhhhhhhHHHHHHHHHHHHhc-CCCCEeeeeeeecCCC
Confidence            478889999999999999987521        1                   11455 6889999999886543


No 67 
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=96.04  E-value=0.005  Score=42.61  Aligned_cols=48  Identities=21%  Similarity=0.378  Sum_probs=37.6

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh-------h-----------------hhhccCcchheeEEEeEeeC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK-------L-----------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~-----------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ....+|+..+.||.|+||.|++|.+...       +                 + +.+..|+|++.+++.|+.
T Consensus        13 ~~~~~~~~~~~lg~g~~~~v~~~~~~~~~~~~a~K~~~~~~~~~~~~~~e~~~l-~~~~~h~~i~~~~~~~~~   84 (282)
T cd06636          13 DPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINML-KKYSHHRNIATYYGAFIK   84 (282)
T ss_pred             ChhhhhhhheeeccCCCeEEEEEEEcCCCcEEEEEEEecChHHHHHHHHHHHHH-HHhcCCCcEEEEeeehhc
Confidence            4567899999999999999999987431       1                 1 334479999999999874


No 68 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=96.04  E-value=0.0065  Score=47.60  Aligned_cols=47  Identities=13%  Similarity=0.121  Sum_probs=36.9

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-----------------h-hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-----------------L-LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~-~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..+|...+.||+|+||.|+.|.+...                 + +.+.+ .|+|||.+++++...
T Consensus       168 ~~gy~i~~~Lg~G~~G~Vy~a~~~~~~~~vavK~~~~~~~~~E~~iL~~L-~HpnIv~l~~~~~~~  232 (461)
T PHA03211        168 GLGFAIHRALTPGSEGCVFESSHPDYPQRVVVKAGWYASSVHEARLLRRL-SHPAVLALLDVRVVG  232 (461)
T ss_pred             cCCeEEEEEEccCCCeEEEEEEECCCCCEEEEecccccCHHHHHHHHHHC-CCCCCCcEEEEEEEC
Confidence            45799999999999999999998531                 1 22456 799999999986543


No 69 
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=95.99  E-value=0.0069  Score=44.01  Aligned_cols=47  Identities=17%  Similarity=0.274  Sum_probs=36.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+..+.||.|+||.|+.|.|..+       +                  +-+.+ .|+|+|.+++.+...
T Consensus         4 ~~~y~~~~~lg~g~~g~V~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~   75 (333)
T cd06650           4 DDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHEC-NSPYIVGFYGAFYSD   75 (333)
T ss_pred             hhhhheeccccCCCCEEEEEEEECCCCcEEEEEEeecccCHHHHHHHHHHHHHHHHC-CCCcccceeEEEEEC
Confidence            46899999999999999999987521       1                  11455 689999999988754


No 70 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=95.99  E-value=0.0066  Score=44.48  Aligned_cols=46  Identities=20%  Similarity=0.302  Sum_probs=34.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||+|+||.|+.|.++.+       +                    +.+.+ .|.|+|.+++.+...
T Consensus         1 ~~y~~~~~LG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~E~~il~~~-~~~~iv~~~~~~~~~   73 (363)
T cd05628           1 EDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEA-DSLWVVKMFYSFQDK   73 (363)
T ss_pred             CCceEeEEEEeCCCEEEEEEEECCCCCEEEEEEEEHHHHHHhhHHHHHHHHHHHHHhC-CCCCcceEEEEEecC
Confidence            4688999999999999999987521       1                    01344 688999999887543


No 71 
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=95.98  E-value=0.01  Score=40.28  Aligned_cols=45  Identities=13%  Similarity=0.303  Sum_probs=34.0

Q ss_pred             CcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+.++.||.|+||.|+.+.+...-                          .-+.+ .|+|++.+++.+...
T Consensus         1 ~y~~~~~ig~g~~g~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~~   71 (256)
T cd08221           1 HYIPIRVLGKGAFGEATLYRRTEDDSLVVWKEVNLTRLSEKERRDALNEIVILSLL-QHPNIIAYYNHFMDD   71 (256)
T ss_pred             CceEeeEecccCCceEEEEEEcCCCcEEEEEEEeecccchhHHHHHHHHHHHHHhC-CCCCeeEEEeEEecC
Confidence            7999999999999988777664211                          11455 689999999988653


No 72 
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=95.97  E-value=0.0071  Score=43.78  Aligned_cols=46  Identities=20%  Similarity=0.266  Sum_probs=34.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||+|+||.|+.|.++..       +                    +.+. ..|.|++.+++.+..+
T Consensus         1 ~~y~~~~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~-~~~~~i~~~~~~~~~~   73 (331)
T cd05597           1 DDFEILKVIGRGAFGEVAVVKMKNTGQVYAMKILNKWEMLKRAETACFREERDVLVN-GDRRWITNLHYAFQDE   73 (331)
T ss_pred             CCceEEEEEEecCCeEEEEEEECCCCCEEEEEEEEHHHHhhhhhHHHHHHHHHHHHh-CCCCCCCceEEEEecC
Confidence            4799999999999999999987531       0                    0122 3789999999987654


No 73 
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=95.97  E-value=0.0075  Score=41.95  Aligned_cols=50  Identities=24%  Similarity=0.313  Sum_probs=37.8

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +..++|+..+.||.|+||.|+.|.+..+-                          +.+.+ .|+|++.+++++..+.
T Consensus         9 ~~~~~y~~~~~lg~g~~~~v~~~~~~~~~~~~aik~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~~   84 (310)
T cd07865           9 DEVSKYEKLAKIGQGTFGEVFKARHKKTKQIVALKKVLMENEKEGFPITALREIKILQLL-KHENVVNLIEICRTKA   84 (310)
T ss_pred             chhhheEEEEEeecCCCEEEEEEEECCCCcEEEEEEEeccCCcCCchhHHHHHHHHHHhC-CCCCccceEEEEeccc
Confidence            45678999999999999999999875211                          11344 6899999999876553


No 74 
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=95.95  E-value=0.01  Score=42.96  Aligned_cols=47  Identities=17%  Similarity=0.249  Sum_probs=34.8

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------h--------hh-----hccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------L--------LQ-----KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------~--------~~-----~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||+|+||.|+.|.++.+             +        ++     .....|+|++.+++.+..+
T Consensus         1 d~y~i~~~lG~G~fg~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~i~~l~~~~~~~   73 (331)
T cd05624           1 DDFEIIKVIGRGAFGEVAVVKMKHTERIYAMKILNKWEMLKRAETACFREERNVLVNGDCQWITTLHYAFQDE   73 (331)
T ss_pred             CCceEEEEEeeCCCeEEEEEEECCCCCEEEEEEEeHHHHHhhHHHHHHHHHHHHHHhCCCCCEeeEEEEEEcC
Confidence            4799999999999999999986521             1        00     1223789999999988654


No 75 
>PHA03207 serine/threonine kinase US3; Provisional
Probab=95.94  E-value=0.0074  Score=44.97  Aligned_cols=46  Identities=17%  Similarity=0.210  Sum_probs=34.6

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh-----h----------------hhhccCcchheeEEEeEee
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK-----L----------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~-----~----------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      +..+|..++.||+|+||.|+.|.+..+     +                ..+.+ .|+|+|.+++.|.
T Consensus        90 ~~~~y~i~~~Lg~G~~g~Vy~~~~~~~~~~~~v~vK~~~~~~~~~~E~~il~~l-~h~~iv~~~~~~~  156 (392)
T PHA03207         90 VRMQYNILSSLTPGSEGEVFVCTKHGDEQRKKVIVKAVTGGKTPGREIDILKTI-SHRAIINLIHAYR  156 (392)
T ss_pred             ccCceEEEEeecCCCCeEEEEEEEcCCccceeEEEEeccccccHHHHHHHHHhc-CCCCccceeeeEe
Confidence            456899999999999999998864210     0                12556 6899999998764


No 76 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=95.93  E-value=0.0068  Score=43.84  Aligned_cols=47  Identities=11%  Similarity=0.167  Sum_probs=36.3

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------h--------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------L--------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------~--------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..|+..+.||+|+||.|+.|.++.+             +              +.+.+ .|+|+|.+++.|....
T Consensus        18 ~~y~~~~~lg~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~E~~~l~~l-~hp~iv~~~~~~~~~~   91 (329)
T PTZ00263         18 SDFEMGETLGTGSFGRVRIAKHKGTGEYYAIKCLKKREILKMKQVQHVAQEKSILMEL-SHPFIVNMMCSFQDEN   91 (329)
T ss_pred             hheEEEEEEEecCCeEEEEEEECCCCCEEEEEEEEHHHHhhhhhHHHHHHHHHHHHhC-CCCCCCcEEEEEEcCC
Confidence            5699999999999999999987521             0              11445 6899999999887654


No 77 
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=95.93  E-value=0.011  Score=41.65  Aligned_cols=41  Identities=20%  Similarity=0.355  Sum_probs=30.4

Q ss_pred             cccCCCCCcceEEEEechh-----h-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-----L-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-----~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.++..     +                   +-+.+ .|+|+|.+++++..+.
T Consensus         7 ~~lG~G~~g~Vy~~~~~~~~~~~~~a~k~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~~   71 (317)
T cd07867           7 CKVGRGTYGHVYKAKRKDGKDEKEYALKQIEGTGISMSACREIALLREL-KHPNVIALQKVFLSHS   71 (317)
T ss_pred             eEeccCCCeeEEEEEecCCCccceEEEEEecCCCCcHHHHHHHHHHHhC-CCCCeeeEEEEEeccC
Confidence            4699999999999985420     0                   11445 6899999999997654


No 78 
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=95.89  E-value=0.0066  Score=46.30  Aligned_cols=53  Identities=23%  Similarity=0.259  Sum_probs=38.0

Q ss_pred             EEEeC-CCcccccccCCCCCcceEEEEech------------h-------------hhh-----hccCcchheeEEEeEe
Q psy1710          22 TFEVG-PRYTNLAYIGEGAYGMVVSEAPMK------------K-------------LLQ-----KGAGTNEQLVLLYMWW   70 (77)
Q Consensus        22 ~f~V~-~RY~~lk~IG~GAYG~VcSA~D~~------------~-------------~~~-----~~~~~~~~~~~~~~~~   70 (77)
                      .|.++ ++|...+.||+|+||.|+.|.+..            |             +++     ..++.|+|+|.+++.+
T Consensus        31 ~~~~~~~~~~~~~~lG~G~fG~Vy~~~~~~~~~~~~~~~vavK~l~~~~~~~~~~~~~~E~~~l~~l~~H~niv~~~~~~  110 (401)
T cd05107          31 AWEMPRDNLVLGRTLGSGAFGRVVEATAHGLSHSQSTMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNIVNLLGAC  110 (401)
T ss_pred             cceecHHHeehhhhccCCCceeEEEEEEcCCCCCCCceEEEEEecCCCCChhHHHHHHHHHHHHHhcCCCCCeEEEEEEE
Confidence            46664 568888999999999999997421            0             000     3354599999999988


Q ss_pred             eCCC
Q psy1710          71 ISPT   74 (77)
Q Consensus        71 ~~~~   74 (77)
                      ..+.
T Consensus       111 ~~~~  114 (401)
T cd05107         111 TKGG  114 (401)
T ss_pred             ccCC
Confidence            7653


No 79 
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=95.88  E-value=0.0084  Score=40.94  Aligned_cols=46  Identities=20%  Similarity=0.257  Sum_probs=34.2

Q ss_pred             CCcccccccCCCCCcceEEEEechhh----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..|..++.||+|+||.|+.|..+.+.                      ..+.+ .|+|++.+++.+...
T Consensus         4 ~~~~~~~~lg~G~~~~vy~~~~~~~~~~a~K~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   71 (256)
T cd05114           4 SELTFMKELGSGQFGVVHLGKWRAQIKVAIKAINEGAMSEEDFIEEAKVMMKL-SHPKLVQLYGVCTQQ   71 (256)
T ss_pred             HHcEEeeEecCCcCceEEEEEeccCceEEEEecccCCccHHHHHHHHHHHHHC-CCCCceeEEEEEccC
Confidence            45778899999999999988664321                      11445 689999999987654


No 80 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=95.87  E-value=0.0092  Score=42.80  Aligned_cols=46  Identities=26%  Similarity=0.342  Sum_probs=34.4

Q ss_pred             CcccccccCCCCCcceEEEEech----------h------h---------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK----------K------L---------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~----------~------~---------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .|+.++.||+|+||.|+.|.+..          |      +               +.+++..|+|++.+++++...
T Consensus         1 ~y~~~~~lg~G~~g~Vy~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~~e~~~l~~l~~~~~i~~~~~~~~~~   77 (332)
T cd05614           1 NFELLKVLGTGAYGKVFLVRKVTGHDTGKLYAMKVLQKAALVQKAKTVEHTRTERNVLEHVRQSPFLVTLHYAFQTE   77 (332)
T ss_pred             CceEEEEEeecCCEEEEEEEEcccCCCCCEEEEEEEEHHHHhhhhhHHHHHHHHHHHHHhccCCCCcccEEEEEecC
Confidence            47889999999999999876521          0      0               115666789999999887654


No 81 
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=95.84  E-value=0.01  Score=40.51  Aligned_cols=46  Identities=15%  Similarity=0.195  Sum_probs=35.7

Q ss_pred             CCcccccccCCCCCcceEEEEechh----------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK----------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~----------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||.|+||.|+.|.++.+                      +     +.+.+ .|+|++.++|.+..+
T Consensus         2 ~~~~i~~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   74 (267)
T cd08228           2 ANFQIEKKIGRGQFSEVYRATCLLDRKPVALKKVQIFEMMDAKARQDCVKEIDLLKQL-NHPNVIKYLDSFIED   74 (267)
T ss_pred             cceeeeeeeccCCCeeEEEEEEeCCCCEEEEEEeeccccCCHHHHHHHHHHHHHHHhC-CCcceeeeeeeEEEC
Confidence            5789999999999999999986421                      0     11555 689999999988754


No 82 
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=95.84  E-value=0.0076  Score=41.66  Aligned_cols=49  Identities=16%  Similarity=0.267  Sum_probs=37.8

Q ss_pred             eCCCcccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..++|+.++.||.|+||.|+.|.+..+-                        +-+.+ .|+|++.+++.+..+.
T Consensus         3 ~~~~~~i~~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   75 (280)
T cd06611           3 PNDIWEIIGELGDGAFGKVYKAQHKETGLFAAAKIIQIESEEELEDFMVEIDILSEC-KHPNIVGLYEAYFYEN   75 (280)
T ss_pred             chhHHHHHHHhcCCCCceEEEEEEcCCCcEEEEEEEeeCCHHHHHHHHHHHHHHHhC-CCCceeEEEEEEecCC
Confidence            4578999999999999999999875210                        11455 4999999999987653


No 83 
>KOG0597|consensus
Probab=95.83  E-value=0.0017  Score=54.73  Aligned_cols=45  Identities=18%  Similarity=0.338  Sum_probs=37.4

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|.....||+|+||.||+++-+.+|                          +++.+ .|+|+|..+|||=+
T Consensus         2 e~yhv~e~iG~Gsfg~VYKgrrK~t~~~vAik~i~K~gr~~k~l~~l~~ev~i~r~l-kHpniv~m~esfEt   72 (808)
T KOG0597|consen    2 EQYHVYEMIGEGSFGRVYKGRRKYTIQVVAIKFIDKSGRNEKELKNLRQEVRILRSL-KHPNIVEMLESFET   72 (808)
T ss_pred             cchhHHHHhcCCccceeeecccccceeEEEEEEehhcCCchHHHHHHHHHHHHHHhc-CCcchhhHHHhhcc
Confidence            57999999999999999999766554                          33777 89999999999844


No 84 
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=95.83  E-value=0.014  Score=40.21  Aligned_cols=48  Identities=21%  Similarity=0.210  Sum_probs=35.2

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------hhh-----hccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------LLQ-----KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~~~-----~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.|+.++.||+|+||.|+.|.|+.+                    +++     .-...|+|+|.+++.+....
T Consensus         1 ~~~~~~~~ig~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~~~~~~~~~~iv~~~~~~~~~~   73 (283)
T cd06617           1 DDLEVIEELGRGAYGVVDKMRHVPTGTIMAVKRIRATVNSQEQKRLLMDLDISMRSVDCPYTVTFYGALFREG   73 (283)
T ss_pred             CCceEEEEecccCCeEEEEEEEcCCCcEEEEEEEecCCCcHHHHHHHHHHHHHHHHcCCCCeeeeeEEEecCC
Confidence            3688899999999999999987521                    111     11237899999999886543


No 85 
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=95.83  E-value=0.0078  Score=41.31  Aligned_cols=47  Identities=19%  Similarity=0.195  Sum_probs=35.4

Q ss_pred             CCCcccccccCCCCCcceEEEEechh------------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK------------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~------------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|...+.||+|+||.|+.|.++..            +                  +-+.+ .|+|++.++|.+...
T Consensus         5 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~~~aik~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   81 (277)
T cd05032           5 REKITLIRELGQGSFGMVYEGLAKGVVKGEPETRVAIKTVNENASMRERIEFLNEASVMKEF-NCHHVVRLLGVVSTG   81 (277)
T ss_pred             hHHeeEEeEecCCCCceEEEEEEeccCCCCcceeEEEEecCCccCHHHHHHHHHHHHHHHhC-CCCceeEEEEEEcCC
Confidence            46788899999999999998876420            0                  11445 689999999987654


No 86 
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=95.82  E-value=0.0096  Score=42.82  Aligned_cols=46  Identities=22%  Similarity=0.315  Sum_probs=34.8

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------hh--------------------hhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------LL--------------------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~~--------------------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|+.++.||+|+||.|+.|.+..+       ++                    .+.+ .|+|++.+++.+..+
T Consensus         1 ~~y~~~~~ig~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~e~~~l~~~-~h~~iv~~~~~~~~~   73 (333)
T cd05600           1 KDFQILTQVGQGGYGQVFLAKKKDTGEIVALKRMKKSLLFKLNEVRHVLTERDILTTT-KSEWLVKLLYAFQDD   73 (333)
T ss_pred             CCcEEEEEEeecCCeEEEEEEECCCCCEEEEEEEEHHHHhhhhHHHHHHHHHHHHHhC-CCCCCccEEEEEEcC
Confidence            3689999999999999999987531       10                    0334 489999999887654


No 87 
>KOG0585|consensus
Probab=95.82  E-value=0.012  Score=48.49  Aligned_cols=49  Identities=22%  Similarity=0.232  Sum_probs=38.2

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh-------h--------------------------hh-----hccCcchheeEE
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------------LQ-----KGAGTNEQLVLL   66 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------------~~-----~~~~~~~~~~~~   66 (77)
                      ....|+.++.||+|.||.|-.|+|...       |                          ++     |-+ .|+|||.|
T Consensus        95 ~lNqy~l~~eiG~G~yGkVkLar~~~~~~l~AiKil~K~~~~~~~~~~~~~a~~~~~~ekv~~EIailKkl-~H~nVV~L  173 (576)
T KOG0585|consen   95 QLNQYELIKEIGSGQYGKVKLARDEVDGKLYAIKILPKKELRRQYGFPRQPAMKLMPIEKVRREIAILKKL-HHPNVVKL  173 (576)
T ss_pred             ehhheehhhhhcCCccceEEEEeecCCCcEEEEEeechhhhhhhcccccccccccCcHHHHHHHHHHHHhc-CCcCeeEE
Confidence            457799999999999999999988721       1                          11     566 78999999


Q ss_pred             EeEeeCCC
Q psy1710          67 YMWWISPT   74 (77)
Q Consensus        67 ~~~~~~~~   74 (77)
                      +.+.=.|.
T Consensus       174 iEvLDDP~  181 (576)
T KOG0585|consen  174 IEVLDDPE  181 (576)
T ss_pred             EEeecCcc
Confidence            98766664


No 88 
>KOG0663|consensus
Probab=95.80  E-value=0.0069  Score=48.29  Aligned_cols=46  Identities=22%  Similarity=0.250  Sum_probs=36.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .+.|+.+..|++|+||+||.|.|+++=                          .-+++ .|+|+|.+=.+++-
T Consensus        75 v~efe~lnrI~EGtyGiVYRakdk~t~eIVALKr~kmekek~GFPItsLREIniLl~~-~H~NIV~vkEVVvG  146 (419)
T KOG0663|consen   75 VEEFEKLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINILLKA-RHPNIVEVKEVVVG  146 (419)
T ss_pred             HHHHHHHhhcccCcceeEEEeccCCcceeEEeeecccccccCCCcchhHHHHHHHHhc-CCCCeeeeEEEEec
Confidence            355899999999999999999998542                          11677 49999998777653


No 89 
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=95.79  E-value=0.0094  Score=51.91  Aligned_cols=47  Identities=15%  Similarity=0.257  Sum_probs=37.1

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..+|..++.||.|+||.|+.|.|+..-                          +.+.+ .|+|+|.++|+|+..
T Consensus        12 l~~YeIl~kLG~GgFGtVYLAkdk~tg~~vAlKvIk~~~l~e~~~~~~~~EI~IL~~L-~HPNIVrl~d~f~de   84 (1021)
T PTZ00266         12 LNEYEVIKKIGNGRFGEVFLVKHKRTQEFFCWKAISYRGLKEREKSQLVIEVNVMREL-KHKNIVRYIDRFLNK   84 (1021)
T ss_pred             cCCEEEEEEEecCCCeEEEEEEECCCCeEEEEEEEeccccCHHHHHHHHHHHHHHHHc-CCCCcCeEEEEEEec
Confidence            468999999999999999999875211                          11456 689999999998754


No 90 
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=95.78  E-value=0.0093  Score=41.28  Aligned_cols=47  Identities=19%  Similarity=0.181  Sum_probs=35.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------------h-----------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------------L-----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------------~-----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+..+.||+|+||.|+.|.+...             +                 +.+.+ .|+|++.+++.+...
T Consensus         5 ~~~~~~~~~ig~G~~g~v~~~~~~~~~~~~~~~~~aik~~~~~~~~~~~~~~~~e~~~l~~l-~~~~iv~~~~~~~~~   81 (277)
T cd05062           5 REKITMSRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEF-NCHHVVRLLGVVSQG   81 (277)
T ss_pred             HHHceeeeeeccccCCeEEEEEeccCCCCCceeEEEEEeccccCCHHHHHHHHHHHHHHHhC-CCCCeeeEEEEEcCC
Confidence            46899999999999999998865311             0                 11455 689999999987544


No 91 
>KOG0580|consensus
Probab=95.77  E-value=0.003  Score=48.23  Aligned_cols=49  Identities=18%  Similarity=0.348  Sum_probs=39.0

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |.+ ++++.=++||+|-||.|+.|+.+++.                           .|-|+ +|+|+..||-+|+--
T Consensus        19 ~~l-~dfeigr~LgkgkFG~vYlarekks~~IvalKVlfKsqi~~~~v~~qlrREiEIqs~L-~hpnilrlY~~fhd~   94 (281)
T KOG0580|consen   19 WTL-DDFEIGRPLGKGKFGNVYLAREKKSLFIVALKVLFKSQILKTQVEHQLRREIEIQSHL-RHPNILRLYGYFHDS   94 (281)
T ss_pred             cch-hhccccccccCCccccEeEeeeccCCcEEEEeeeeHHHHHHhcchhhhhheeEeeccc-CCccHHhhhhheecc
Confidence            443 44778899999999999999866433                           34788 999999999998753


No 92 
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=95.75  E-value=0.014  Score=40.14  Aligned_cols=46  Identities=28%  Similarity=0.386  Sum_probs=35.5

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +||+..+.||+|+||.||.|.++..-                          ..+.+ .|+|++.+++.+..+
T Consensus         1 ~~y~~~~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~~   72 (286)
T cd07847           1 EKYEKLSKIGEGSYGVVFKCRNRETGQIVAIKKFVESEDDPVIKKIALREIRMLKQL-KHPNLVNLIEVFRRK   72 (286)
T ss_pred             CceeeeeeecccCCeEEEEEEECCCCcEEEEEEEeecccCccccHHHHHHHHHHHhC-CCCCEeeeeeEEeeC
Confidence            57999999999999999999875210                          11445 689999999987654


No 93 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=95.75  E-value=0.0069  Score=44.11  Aligned_cols=46  Identities=15%  Similarity=0.135  Sum_probs=34.8

Q ss_pred             CCCcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ...|+.++.||+|+||.|+.|.+...                    +     +.+.+ .|+|+|.++++|..
T Consensus        73 ~~~~~~~~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~  143 (353)
T PLN00034         73 LSELERVNRIGSGAGGTVYKVIHRPTGRLYALKVIYGNHEDTVRRQICREIEILRDV-NHPNVVKCHDMFDH  143 (353)
T ss_pred             HHHHhhhhhccCCCCeEEEEEEECCCCCEEEEEEEecCCcHHHHHHHHHHHHHHHhC-CCCCcceeeeEecc
Confidence            35688889999999999999987521                    0     11445 68999999998754


No 94 
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.74  E-value=0.0088  Score=43.05  Aligned_cols=52  Identities=25%  Similarity=0.373  Sum_probs=38.4

Q ss_pred             EEEeC-CCcccccccCCCCCcceEEEEech--------------hh------------------hhhccCcchheeEEEe
Q psy1710          22 TFEVG-PRYTNLAYIGEGAYGMVVSEAPMK--------------KL------------------LQKGAGTNEQLVLLYM   68 (77)
Q Consensus        22 ~f~V~-~RY~~lk~IG~GAYG~VcSA~D~~--------------~~------------------~~~~~~~~~~~~~~~~   68 (77)
                      .|++. .||+..+.||+|+||.|+.|.+..              |+                  ..+.+..|+|++.+++
T Consensus         6 ~~~~~~~~~~i~~~ig~G~~g~v~~~~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l~~h~~iv~~~~   85 (334)
T cd05100           6 KWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDKPNKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLG   85 (334)
T ss_pred             ccccCHhHeeecceeccccCCcEEEEEEeccCCccCCcceeEEEEEcccccCHHHHHHHHHHHHHHHhhcCCCCeeeeeE
Confidence            46664 479999999999999999986421              00                  1155667999999999


Q ss_pred             EeeCC
Q psy1710          69 WWISP   73 (77)
Q Consensus        69 ~~~~~   73 (77)
                      .+...
T Consensus        86 ~~~~~   90 (334)
T cd05100          86 ACTQD   90 (334)
T ss_pred             EEccC
Confidence            87653


No 95 
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=95.73  E-value=0.011  Score=40.70  Aligned_cols=46  Identities=24%  Similarity=0.258  Sum_probs=34.7

Q ss_pred             CCcccccccCCCCCcceEEEEechhh----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|..++.||+|+||.|+.|.+..+.                      ..+.+ +|+|++.+++++...
T Consensus         4 ~~~~~~~~lg~G~~~~vy~~~~~~~~~~aik~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   71 (256)
T cd05113           4 KDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMKL-SHEKLVQLYGVCTKQ   71 (256)
T ss_pred             HHeEEeeEecCcccceEEEEEecCCCcEEEEEcCCCcccHHHHHHHHHHHhcC-CCCCeeeEEEEEccC
Confidence            46888999999999999998653211                      11556 699999999987543


No 96 
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=95.73  E-value=0.0092  Score=40.81  Aligned_cols=44  Identities=23%  Similarity=0.230  Sum_probs=34.0

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-----------------h-----hhhccCcchheeEEEeEe
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-----------------L-----LQKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~-----~~~~~~~~~~~~~~~~~~   70 (77)
                      .++|+.++.||.|+||.|+.|.+...                 +     +.+.+ +|+|++.+++.+
T Consensus         5 ~~~~~~~~~ig~G~~g~v~~~~~~~~~~~a~K~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~   70 (260)
T cd05067           5 RETLKLVKKLGAGQFGEVWMGYYNGHTKVAIKSLKQGSMSPEAFLAEANLMKQL-QHPRLVRLYAVV   70 (260)
T ss_pred             hHHceeeeeeccCccceEEeeecCCCceEEEEEecCCCCcHHHHHHHHHHHHhc-CCcCeeeEEEEE
Confidence            46789999999999999999986421                 1     22555 689999999875


No 97 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=95.71  E-value=0.0078  Score=41.79  Aligned_cols=47  Identities=21%  Similarity=0.255  Sum_probs=34.8

Q ss_pred             CcccccccCCCCCcceEEEEechh--------h------------h-----hhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------L------------L-----QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------~------------~-----~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .|+.++.||+|+||.|+.+.|..+        +            +     -..+..|+|+|.+++.+..+.
T Consensus         5 ~~~~~~~lg~G~~g~vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~e~~~l~~~~~~~~iv~~~~~~~~~~   76 (288)
T cd06616           5 DLKDLGEIGRGAFGTVNKMLHKPSGTIMAVKRIRSTVDEKEQKRLLMDLDVVMRSSDCPYIVKFYGALFREG   76 (288)
T ss_pred             HhHHHHHhCCCCceEEEEEEECCCCCEEEEEEehhccChHHHHHHHHHHHHHHHhcCCCCEeeeeeEEecCC
Confidence            567788999999999999887531        0            0     034546899999999877654


No 98 
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=95.70  E-value=0.014  Score=41.30  Aligned_cols=49  Identities=20%  Similarity=0.355  Sum_probs=37.5

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh--------h----------------hhhccCcchheeEEEeEeeCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK--------L----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +...||..++.||.|+||.|+.|+|...        +                ..+.+ .|+||+.+++.|...
T Consensus        17 ~~~~~y~~~~~lg~g~~~~v~~~~~~~~~~~v~ik~~~~~~~~~~~~~~~e~~~l~~~-~h~~v~~~~~~~~~~   89 (296)
T cd06654          17 DPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMREN-KNPNIVNYLDSYLVG   89 (296)
T ss_pred             CcccceeeEEEecCCCCeEEEEEEECCCCcEEEEEEEecCCcchHHHHHHHHHHHHhC-CCCCEeeEEEEEEeC
Confidence            4567999999999999999999987421        0                11344 689999999987653


No 99 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=95.69  E-value=0.01  Score=44.09  Aligned_cols=47  Identities=21%  Similarity=0.251  Sum_probs=36.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+..+.||+|+||.|+.|.++.+-                           +.+.+ .|+|++.+++.|...
T Consensus        42 ~~~y~i~~~lG~G~fg~Vy~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~e~~i~~~~-~hp~iv~~~~~~~~~  115 (371)
T cd05622          42 AEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFA-NSPWVVQLFYAFQDD  115 (371)
T ss_pred             hhhcEEEEEEeecCCeEEEEEEECCCCcEEEEEEEEHHHhhhhHHHHHHHHHHHHHHhC-CCCCCCeEEEEEEcC
Confidence            478999999999999999999875210                           11333 689999999988654


No 100
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=95.69  E-value=0.015  Score=41.22  Aligned_cols=51  Identities=14%  Similarity=0.247  Sum_probs=39.1

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechh----------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKK----------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~----------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .++..+|..++.||.|+||.|+.|.+...                      +     +.+.+ .|+|++.+++.+....
T Consensus        11 ~~~~~~y~~~~~lg~g~~g~vy~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~~~Ei~~l~~l-~h~niv~~~~~~~~~~   88 (307)
T cd06607          11 DDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQQL-RHPNTIEYKGCYLREH   88 (307)
T ss_pred             CCcchhhhhheeecCCCCeEEEEEEEcCCCcEEEEEEEeccccCcHHHHHHHHHHHHHHHhC-CCCCEEEEEEEEEeCC
Confidence            34668899999999999999999976410                      1     12556 7999999999887643


No 101
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.68  E-value=0.0076  Score=42.65  Aligned_cols=47  Identities=26%  Similarity=0.328  Sum_probs=35.0

Q ss_pred             CCCcccccccCCCCCcceEEEEech--------------h-------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK--------------K-------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~--------------~-------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .++|...+.||+|+||.|+.|.+..              |             +     +.+.+..|.|++.+++.+..
T Consensus        17 ~~~~~i~~~lg~G~~g~V~~~~~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~e~~~l~~l~~h~~i~~~~~~~~~   95 (307)
T cd05098          17 RDRLVLGKPLGEGCFGQVVMAEAIGLDKEKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQ   95 (307)
T ss_pred             hHHeEEeeeeccCCCeeEEEeEEeccCCcccCccceEEEEeccCCCChHHHHHHHHHHHHHHHhcCCCCEeeEEEEEec
Confidence            4789999999999999999886421              0             1     11445578999999987643


No 102
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=95.67  E-value=0.011  Score=43.99  Aligned_cols=48  Identities=23%  Similarity=0.286  Sum_probs=36.6

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..+|+.++.||+|+||.|+.|.++.+       +                    +.+.+ .|+|+|.+++.|..+.
T Consensus        42 ~~~y~~~~~lG~G~fg~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~i~~~~-~hp~iv~~~~~~~~~~  116 (370)
T cd05621          42 AEDYDVVKVIGRGAFGEVQLVRHKSSQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFA-NSPWVVQLFCAFQDDK  116 (370)
T ss_pred             HHHCeEEEEEEecCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhhHHHHHHHHHHHHhC-CCCCEeeEEEEEEcCC
Confidence            47899999999999999999987531       1                    11233 6899999999887543


No 103
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=95.67  E-value=0.011  Score=40.98  Aligned_cols=47  Identities=11%  Similarity=0.015  Sum_probs=34.3

Q ss_pred             CCcccccccCCCCCcceEEEEech----------hh------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK----------KL------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~----------~~------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|+..+.||+|+||.||.|.++.          |.                  .-+.+ .|+|+|.+++.+....
T Consensus         5 ~~~~~~~~ig~G~fg~V~~~~~~~~~~~~~~vaik~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~~   79 (266)
T cd05064           5 KSIKIERILGTGRFGELCRGCLKLPSKRELPVAIHTLRAGCSDKQRRGFLAEALTLGQF-DHSNIVRLEGVITRGN   79 (266)
T ss_pred             HHeEEeeeecccCCCeEEEEEEecCCCceeeEEEEecCCCCCHHHHHHHHHHHHHHhcC-CCCCcCeEEEEEecCC
Confidence            468888999999999999986430          00                  00334 6899999999887543


No 104
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=95.64  E-value=0.0083  Score=44.10  Aligned_cols=47  Identities=15%  Similarity=0.218  Sum_probs=35.1

Q ss_pred             CCCcccccccCCCCCcceEEEEechh----h------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK----L------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~----~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.|+.++.||+|+||.|+.|.+..+    .                        +-+.+ .|+|+|.+++.+...
T Consensus        29 ~~~y~~~~~ig~G~~g~Vy~a~~~~~~~~~vavK~~~~~~~~~~~~~~~~~~E~~~l~~l-~hp~Iv~~~~~~~~~  103 (340)
T PTZ00426         29 YEDFNFIRTLGTGSFGRVILATYKNEDFPPVAIKRFEKSKIIKQKQVDHVFSERKILNYI-NHPFCVNLYGSFKDE  103 (340)
T ss_pred             hhhcEEEEEEeecCCeEEEEEEEECCCCeEEEEEEEEHHHhhhhhhHHHHHHHHHHHHhC-CCCCCcceEEEEEeC
Confidence            35689999999999999999975321    0                        00445 689999999987654


No 105
>KOG0598|consensus
Probab=95.62  E-value=0.013  Score=46.13  Aligned_cols=47  Identities=23%  Similarity=0.293  Sum_probs=34.9

Q ss_pred             eCCCcccccccCCCCCcceEEEE--echhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEA--PMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~--D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      -++.|+.++.||+|+||.||...  |+.+|                          |++  ..|+.+|.|+.-|=.+
T Consensus        23 ~~~dF~~lkviGkG~fGkV~~Vrk~dt~kiYAmKvl~K~~iv~~~e~~~~~~Er~IL~~--v~hPFiv~l~ysFQt~   97 (357)
T KOG0598|consen   23 GPDDFEILKVIGKGSFGKVFQVRKKDTGKIYAMKVLKKKKIVEKKEVRHTKAERNILSK--IKHPFIVKLIYSFQTE   97 (357)
T ss_pred             ChhheeeeeeeeccCCceEEEEEEcccCceeehhhhhhhHhhhhhhHHHHHHHHHHHHh--CCCCcEeeeEEecccC
Confidence            36779999999999999999986  44444                          334  3788888888766443


No 106
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=95.62  E-value=0.019  Score=39.38  Aligned_cols=22  Identities=32%  Similarity=0.547  Sum_probs=19.6

Q ss_pred             cccccccCCCCCcceEEEEech
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      |+..+.||+|+||.|+.|.+..
T Consensus         2 y~~~~~ig~G~~~~v~~~~~~~   23 (269)
T cd08528           2 YAVLEHLGSGAFGCVYKVRKKN   23 (269)
T ss_pred             chhhhhhcCCCCceEEEEEEcC
Confidence            7888999999999999998754


No 107
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=95.61  E-value=0.016  Score=38.88  Aligned_cols=46  Identities=22%  Similarity=0.325  Sum_probs=34.5

Q ss_pred             CcccccccCCCCCcceEEEEechhh-------h-------------------hhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL-------L-------------------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~-------~-------------------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +|+.++.||.|+||.|++|.+..+-       +                   -+.+ .|+|++.+++.+..+.
T Consensus         1 ~y~~~~~lg~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~~   72 (265)
T cd08217           1 DYEVLETIGKGSFGTVRKVRRKSDGKILVWKEIDYGNMTEKEKQQLVSEVNILREL-KHPNIVRYYDRIIDRS   72 (265)
T ss_pred             CceeeeeeccCCCeEEEEeeecCCCCEEEEEEEecccCCHHHHHHHHHHHHHHHhc-CCCccceeeeeeecCC
Confidence            5888999999999999999775311       0                   0334 6899999999877543


No 108
>KOG0605|consensus
Probab=95.60  E-value=0.0081  Score=49.44  Aligned_cols=48  Identities=23%  Similarity=0.310  Sum_probs=34.3

Q ss_pred             CCCcccccccCCCCCcceEEEE--echhh-----------hh----h---------ccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEA--PMKKL-----------LQ----K---------GAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~--D~~~~-----------~~----~---------~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.|+.|+.||+||||.|+.|.  |+.+|           ++    +         +....+.||.||=-|=.+
T Consensus       140 ~~DFe~Lk~IgkGAfGeVrLarKk~Tg~iyAmK~LkKS~M~~~~Qv~hV~aERdiL~~~ds~~vVKLyYsFQD~  213 (550)
T KOG0605|consen  140 LDDFELLKVIGKGAFGEVRLARKKDTGEIYAMKILKKSEMLKKNQVEHVRAERDILAEVDSPWVVKLYYSFQDK  213 (550)
T ss_pred             cccchhheeeccccceeEEEEEEccCCcEEeeecccHHHHHhhhhHHHHHHHHHHhhhcCCCcEEEEEEEecCC
Confidence            4569999999999999999985  44444           11    1         225678899988665443


No 109
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=95.60  E-value=0.01  Score=44.01  Aligned_cols=48  Identities=21%  Similarity=0.248  Sum_probs=37.0

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .++|+.++.||+|+||.|+.|.++.+-                           +-+++ .|+|++.+++.+..+.
T Consensus        42 ~~~y~~~~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~il~~~-~h~~iv~~~~~~~~~~  116 (370)
T cd05596          42 AEDFDVIKVIGRGAFGEVQLVRHKSSKQVYAMKLLSKFEMIKRSDSAFFWEERDIMAHA-NSEWIVQLHYAFQDDK  116 (370)
T ss_pred             HHHcEEEEEEeeCCCEEEEEEEECCCCCEEEEEEEEHHHhhhhhhHHHHHHHHHHHHhC-CCCCcceEEEEEecCC
Confidence            467999999999999999999875210                           11455 7899999999886553


No 110
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=95.57  E-value=0.017  Score=40.14  Aligned_cols=47  Identities=23%  Similarity=0.232  Sum_probs=35.9

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+..+.||.|+||.|+.|.++..-                         +.+.+ .|+|++.+++++...
T Consensus         4 ~~~y~~~~~lg~g~~~~vy~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~~   75 (291)
T cd07844           4 LETYKKLDKLGEGSYATVYKGRSKLTGQLVALKEIRLEHEEGAPFTAIREASLLKDL-KHANIVTLHDIIHTK   75 (291)
T ss_pred             ccceeEEEEEeecCCeEEEEEEEcCCCcEEEEEEEecccccCCchhHHHHHHHHhhC-CCcceeeEEEEEecC
Confidence            367999999999999999999875210                         11344 688999999987643


No 111
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=95.57  E-value=0.016  Score=39.40  Aligned_cols=45  Identities=18%  Similarity=0.287  Sum_probs=33.6

Q ss_pred             CcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|+..+.||.|+||.|+.|.++.+-                         ..+.+ .|+|++.++|.+...
T Consensus         1 ~y~~~~~lg~g~~g~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   70 (255)
T cd08219           1 QYNVLRVVGEGSFGRALLVQHVNSDQKYAMKEIRLPKSSSAVEDSRKEAVLLAKM-KHPNIVAFKESFEAD   70 (255)
T ss_pred             CceEEEEeeccCCeEEEEEEEcCCCceEEEEEEEcCcchHHHHHHHHHHHHHHhC-CCCCcceEEEEEEEC
Confidence            5888999999999999998765211                         11334 689999999987643


No 112
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=95.56  E-value=0.018  Score=40.20  Aligned_cols=45  Identities=24%  Similarity=0.401  Sum_probs=35.6

Q ss_pred             CcccccccCCCCCcceEEEEech---------hhhh--------------------hccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK---------KLLQ--------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~---------~~~~--------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||..++.||+|+||.|+.|.++.         |++.                    +.+ .|+|++.+++.+..+
T Consensus         1 ~y~~~~~ig~g~~g~v~~~~~~~~~~~~~~alK~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   74 (316)
T cd07842           1 KYEIEGCIGRGTYGRVYKAKRKNGKDGKEYAIKKFKGDKEQYTGISQSACREIALLREL-KHENVVSLVEVFLEH   74 (316)
T ss_pred             CceEEEEeccCCcEEEEEEEecCCCCCCeEEEEEeccccccccCccHHHHHHHHHHHhc-CCCCccceEEEEeCC
Confidence            68889999999999999999865         1111                    334 689999999998766


No 113
>KOG1151|consensus
Probab=95.56  E-value=0.0023  Score=53.10  Aligned_cols=48  Identities=21%  Similarity=0.393  Sum_probs=38.7

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechhh---------------------hh----------hccCcchheeEEEeEeeC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKKL---------------------LQ----------KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~~---------------------~~----------~~~~~~~~~~~~~~~~~~   72 (77)
                      .+.+||..+..||+|.|..||+|+|..+-                     |-          |-+ .|.-+|.|||+|--
T Consensus       460 tLn~RYLlLhLLGrGGFSEVyKAFDl~EqRYvAvKIHqlNK~WrdEKKeNYhKHAcREyrIHKeL-DHpRIVKlYDyfsl  538 (775)
T KOG1151|consen  460 TLNDRYLLLHLLGRGGFSEVYKAFDLTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIHKEL-DHPRIVKLYDYFSL  538 (775)
T ss_pred             chHHHHHHHHHhccccHHHHHHhcccchhheeeEeeehhccchhhHhhhhHHHHHHHHHhhhhcc-Ccceeeeeeeeeee
Confidence            35789999999999999999999997432                     22          445 67889999999843


No 114
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=95.56  E-value=0.013  Score=39.82  Aligned_cols=45  Identities=18%  Similarity=0.225  Sum_probs=32.1

Q ss_pred             cccccccCCCCCcceEEEEech----------hhh-------------------hhccCcchheeEEEeEeeCCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK----------KLL-------------------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~----------~~~-------------------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      |+..+.||+|+||.|+.|.+..          |++                   -+.+ .|+|++.+++.+....
T Consensus         1 ~~~~~~lg~G~~g~v~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~~   74 (273)
T cd05035           1 LKLGKILGEGEFGSVMEGQLSQDDGSQLKVAVKTMKLDIHTYSEIEEFLSEAACMKDF-DHPNVMKLIGVCFEAS   74 (273)
T ss_pred             CccccccCcCCCceEEEEEEecCCCCcceEEEEEeccCcCCHHHHHHHHHHHHHHHhC-CCCCeeeEEeeeccCC
Confidence            5677899999999999987532          000                   0445 6899999998765543


No 115
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=95.52  E-value=0.0045  Score=44.57  Aligned_cols=50  Identities=28%  Similarity=0.545  Sum_probs=37.5

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |.+..+|+..+.||.|+||.|+.|.++.+-                          ..+.+ .|+|++.+++++..+
T Consensus         1 ~~~~~~y~~~~~lg~g~~g~v~~~~~~~~~~~valK~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~   76 (334)
T cd07855           1 FDVGSRYKPIENIGSGAYGVVCSAIDTRSGKKVAIKKIPHAFDVPTLAKRTLRELKILRHF-KHDNIIAIRDILRPP   76 (334)
T ss_pred             CchhhceeeeeeeecCCCeEEEEEEEcCCCCEEEEEEeccccccccchHHHHHHHHHHHhc-CCCCccCHHHhcccc
Confidence            356688999999999999999999866310                          11556 489999988877543


No 116
>KOG0666|consensus
Probab=95.50  E-value=0.0034  Score=49.96  Aligned_cols=48  Identities=25%  Similarity=0.393  Sum_probs=36.7

Q ss_pred             EeCCCcccccccCCCCCcceEEEEec-----h-------hh------------------hhhccCcchheeEEEeEeeC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPM-----K-------KL------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~-----~-------~~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +.-..|+.+.+||+|.||.|++|.-+     .       ++                  |-|-+ .|||||-|-.+||+
T Consensus        21 e~l~~ye~ig~Ig~GTYG~VykA~~~~~n~kr~k~yAiKkfk~~kd~tGiS~SAcREiaL~REl-~h~nvi~Lv~Vfl~   98 (438)
T KOG0666|consen   21 EDLFEYEGIGKIGRGTYGKVYKAVRKNTNDKRTKEYAIKKFKGEKDGTGISMSACREIALLREL-KHPNVISLVKVFLS   98 (438)
T ss_pred             HHHHHhhccceecccccceeeEeeeccCCcccchhhHHHHHhccCCCCCcCHHHHHHHHHHHHh-cCCcchhHHHHHhc
Confidence            34567999999999999999999522     1       11                  22666 79999999888876


No 117
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=95.49  E-value=0.011  Score=40.73  Aligned_cols=46  Identities=17%  Similarity=0.161  Sum_probs=34.4

Q ss_pred             CCCcccccccCCCCCcceEEEEec---hh-----h--------------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM---KK-----L--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~---~~-----~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ..+|+..+.||+|+||.|+.|.++   .+     +                    ..+.+ .|+|++.+++.+..
T Consensus         3 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   76 (267)
T cd05066           3 ASCIKIEKVIGAGEFGEVCSGRLKLPGKREIPVAIKTLKAGYTEKQRRDFLSEASIMGQF-DHPNIIHLEGVVTK   76 (267)
T ss_pred             HHHeEeeeeecccCCCceEEEEEecCCCCceEEEEEECCCCCCHHHHHHHHHHHHHHHhC-CCCCcceEEEEEec
Confidence            357888999999999999998763   10     0                    11455 68999999998754


No 118
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=95.49  E-value=0.015  Score=39.36  Aligned_cols=47  Identities=19%  Similarity=0.381  Sum_probs=36.2

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+..+.||.|+||.|+.|.+..+                   +     +.+.+ .|+|++.+++.++..
T Consensus         2 ~~~~~~~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~~   72 (262)
T cd06613           2 QEDYELIQRIGSGTYGDVYKARDIATGELVAIKVIKLEPGDDFEIIQQEISMLKEC-RHPNIVAYFGSYLRR   72 (262)
T ss_pred             ccceEEEEEecCCCceEEEEeEecCCCCEEEEEEEEcCchhhHHHHHHHHHHHHhC-CCCChhceEEEEEeC
Confidence            46899999999999999999987421                   1     11455 789999999887643


No 119
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=95.48  E-value=0.011  Score=41.80  Aligned_cols=47  Identities=19%  Similarity=0.294  Sum_probs=36.2

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..||..++.||.|+||.|++|.+..+-                        ..+.+ .|+|++.+++.+..+
T Consensus        18 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~e~~~l~~l-~hp~i~~~~~~~~~~   88 (293)
T cd06647          18 KKKYTRFEKIGQGASGTVYTAIDVATGQEVAIKQMNLQQQPKKELIINEILVMREN-KHPNIVNYLDSYLVG   88 (293)
T ss_pred             hhhceeeeEecCCCCeEEEEEEEcCCCCEEEEEEeccccchHHHHHHHHHHHHhhc-CCCCeeehhheeeeC
Confidence            478999999999999999999764210                        11556 589999999887654


No 120
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=95.47  E-value=0.018  Score=39.39  Aligned_cols=44  Identities=18%  Similarity=0.218  Sum_probs=32.5

Q ss_pred             cccccccCCCCCcceEEEEech----------h--------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK----------K--------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~----------~--------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |...+.||+|+||.|+.|.++.          |              +     .-+-+ .|+|++++++.++.+
T Consensus         1 ~~~~~~ig~g~~g~v~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~~   73 (273)
T cd05074           1 FTLGRMLGKGEFGSVREAQLKSEDGSFQKVAVKMLKADIFSSSDIEEFLREAACMKEF-DHPNVIKLIGVSLRS   73 (273)
T ss_pred             CcchhcccCCCCCCEEeeEeeccCCCceEEEEEEeccccCChHHHHHHHHHHHHHhcC-CCCCcceEEEEEccC
Confidence            5667889999999999997431          0              0     11445 689999999987654


No 121
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=95.47  E-value=0.016  Score=39.68  Aligned_cols=47  Identities=19%  Similarity=0.381  Sum_probs=34.8

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h-----------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L-----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~-----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..+|+..+.||+|+||.|++|.++.+       +                 ..+.+ .|+|++.+++.+...
T Consensus         8 ~~~y~~~~~lg~g~~g~vy~~~~~~~~~~~aik~~~~~~~~~~~~~~~e~~~l~~~-~h~~ii~~~~~~~~~   78 (267)
T cd06646           8 QHDYELIQRVGSGTYGDVYKARNLHTGELAAVKIIKLEPGDDFSLIQQEIFMVKEC-KHCNIVAYFGSYLSR   78 (267)
T ss_pred             hhhcchhheeecCCCeEEEEEEECCCCeEEEEEEEecCccchHHHHHHHHHHHHhc-CCCCeeeeeEEEEeC
Confidence            45799999999999999999986421       1                 00333 678999999887643


No 122
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=95.44  E-value=0.018  Score=39.72  Aligned_cols=46  Identities=17%  Similarity=0.284  Sum_probs=35.5

Q ss_pred             CCcccccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +||+..+.||.|+||.|++|.+...-                         ..+.+ .|+|++.+++.++..
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   71 (274)
T cd06609           1 ELFTLLECIGKGSFGEVYKAIDKRTNQVVAIKVIDLEEAEDEIEDIQQEIQFLSQC-RSPYITKYYGSFLKG   71 (274)
T ss_pred             ChhhhhhhhcCCCCeEEEEEEECCCCeEEEEEEeeccccchHHHHHHHHHHHHHHc-CCCCeeeeeEEEEEC
Confidence            48999999999999999999875311                         11445 489999999987654


No 123
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=95.43  E-value=0.013  Score=40.25  Aligned_cols=46  Identities=28%  Similarity=0.423  Sum_probs=35.6

Q ss_pred             CCcccccccCCCCCcceEEEEech-------hhhh-------------------hccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK-------KLLQ-------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~-------~~~~-------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      +||+..+.||.|.||.|+.|.+..       |.+.                   +.+ +|+|++.+.+.+..+
T Consensus         1 ~~y~~~~~i~~g~~~~v~~~~~~~~~~~v~vK~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   72 (288)
T cd07833           1 NKYEVLGVVGEGAYGVVLKCRNKATGEIVAIKKFKESEDDEDVKKTALREVKVLRQL-RHENIVNLKEAFRRK   72 (288)
T ss_pred             CceeEEEEecccCCeeEEEEEeCCCCcEEEEehhhhhcccccchhHHHHHHHHHHhc-CCCCeeehhheEEEC
Confidence            479999999999999999998753       1111                   345 589999999988764


No 124
>KOG1035|consensus
Probab=95.41  E-value=0.0095  Score=53.08  Aligned_cols=42  Identities=26%  Similarity=0.532  Sum_probs=33.3

Q ss_pred             ccccccCCCCCcceEEEEec--------hhh--------hh---------hccCcchheeEEEeEeeC
Q psy1710          30 TNLAYIGEGAYGMVVSEAPM--------KKL--------LQ---------KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        30 ~~lk~IG~GAYG~VcSA~D~--------~~~--------~~---------~~~~~~~~~~~~~~~~~~   72 (77)
                      +-++.||+|+||.|++++++        +||        ++         -.+ .|||||.-|--||-
T Consensus       482 EEL~lLGkGGFG~VvkVRNKlDGr~YAIKKIpl~~s~~~~skI~rEVk~LArL-nHpNVVRYysAWVE  548 (1351)
T KOG1035|consen  482 EELELLGKGGFGSVVKVRNKLDGREYAIKKIPLKASDKLYSKILREVKLLARL-NHPNVVRYYSAWVE  548 (1351)
T ss_pred             HHHHHhcCCCCceEEEEeecccchhhhhhhccCchHHHHHHHHHHHHHHHhhc-CCcceeeeehhhhc
Confidence            66899999999999999887        344        11         234 69999999998874


No 125
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=95.41  E-value=0.016  Score=40.20  Aligned_cols=46  Identities=26%  Similarity=0.224  Sum_probs=34.7

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||.|.||.|+.|.+..+-                          ..+-+.+|+|++.+++.+..
T Consensus         1 ~~y~~~~~lg~g~~g~vy~~~~~~~~~~v~lK~~~~~~~~~~~~~~~~~E~~~l~~l~~~~~i~~~~~~~~~   72 (295)
T cd07837           1 DAYEKLEKIGEGTYGKVYKARDKNTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSESIYIVRLLDVEHV   72 (295)
T ss_pred             CCceEeeEecccCCeEEEEEEECCCCcEEEEEeehhhccccCCchHHHHHHHHHHHccCCCCccceeeeEee
Confidence            47999999999999999999875310                          01334467999999987764


No 126
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=95.40  E-value=0.023  Score=41.00  Aligned_cols=48  Identities=23%  Similarity=0.308  Sum_probs=34.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------hh--------------h-----hccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------LL--------------Q-----KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~~--------------~-----~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ++|+.++.||+|+||.|+.|.++.+       ++              .     .....|.|++.+++.+..+.
T Consensus         1 ~~y~~~~~lG~G~fg~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~i~~~~~~~~~~~   74 (332)
T cd05623           1 EDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNQWITTLHYAFQDEN   74 (332)
T ss_pred             CCceEEEEEEeCCCeEEEEEEECCCCCEEEEEEEeHHHHHHhhHHHHHHHHHHHHhhCCCCCEeeEEEEEecCC
Confidence            4688999999999999999876421       00              0     12247889999998876654


No 127
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=95.39  E-value=0.0082  Score=41.48  Aligned_cols=45  Identities=33%  Similarity=0.472  Sum_probs=34.1

Q ss_pred             CcccccccCCCCCcceEEEEechh-------h-------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------L-------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~-------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+.++.||.|+||.|+.|.++.+       .                   +.+.+ .|+|++.++|.+...
T Consensus         1 ~y~~~~~l~~g~~~~vy~~~~~~~g~~~~~k~~~~~~~~~~~~~~~~~ei~~l~~l-~h~~i~~~~~~~~~~   71 (284)
T cd07839           1 KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKEL-KHKNIVRLYDVLHSD   71 (284)
T ss_pred             CceeEEEecccCCeEEEEEEECCCCcEEEEEEeecccccccCccchhHHHHHHHhc-CCCCeeeHHHHhccC
Confidence            689999999999999999987521       0                   11334 678999998887654


No 128
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=95.38  E-value=0.0061  Score=42.28  Aligned_cols=46  Identities=20%  Similarity=0.258  Sum_probs=33.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||+|+||.|+.|.+...                    +     ..+.+ .|+|++.+++.+..+
T Consensus         1 ~~~~~~~~ig~g~~g~v~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   71 (286)
T cd06622           1 DEIEVLDELGKGNYGSVYKVLHRPTGVTMAMKEIRLELDESKFNQIIMELDILHKA-VSPYIVDFYGAFFIE   71 (286)
T ss_pred             ChhhhhhhhcccCCeEEEEEEEcCCCcEEEEEEeecccCHHHHHHHHHHHHHHHhc-CCCcHHhhhhheecC
Confidence            4789999999999999999987511                    1     11334 678999988876543


No 129
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=95.37  E-value=0.013  Score=40.54  Aligned_cols=47  Identities=13%  Similarity=0.161  Sum_probs=34.8

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|..++.||+|+||.||.|.+...                         +     +.+.+ .|+|+|.+++.+..+.
T Consensus         5 ~~~~~~~~lg~G~~g~V~~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~~~~l-~h~~iv~~~~~~~~~~   81 (283)
T cd05091           5 STVRFMEELGEDRFGKVYKGHLFGTAPGEQTQAVAIKTLKDKAEGPLREEFKHEAMMRSRL-QHPNIVCLLGVVTKEQ   81 (283)
T ss_pred             HHHHHHHHhCCCCCCeEEEEEEecCCCCCceeEEEEEEccCCCCHHHHHHHHHHHHHHhcC-CCCCcCeEEEEEcCCC
Confidence            3588899999999999999875310                         0     11345 6899999999876654


No 130
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=95.36  E-value=0.018  Score=40.23  Aligned_cols=51  Identities=16%  Similarity=0.254  Sum_probs=38.6

Q ss_pred             EEEeCCCcccccccCCCCCcceEEEEechh--h----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          22 TFEVGPRYTNLAYIGEGAYGMVVSEAPMKK--L----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        22 ~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~--~----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ...+.++|+.++.||.|+||.|+.|.+...  .                      .-+.+ .|+|++.++|.+...
T Consensus         7 ~~~~~~~y~i~~~lg~g~~g~vy~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   81 (292)
T cd06644           7 DLDPNEVWEIIGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYMVEIEILATC-NHPYIVKLLGAFYWD   81 (292)
T ss_pred             ccCcchhhhhhheecCCCCeEEEEEEECCCCceEEEEEeccCCHHHHHHHHHHHHHHHhC-CCCcEeeeEEEEEeC
Confidence            345567899999999999999999976531  1                      01456 589999999987654


No 131
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=95.35  E-value=0.0093  Score=42.85  Aligned_cols=50  Identities=22%  Similarity=0.377  Sum_probs=38.6

Q ss_pred             EeCCCcccccccCCCCCcceEEEEech--h------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMK--K------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~--~------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.+||+..+.||.|+||.|+.|.|..  +      +                  +.+.++.|+|++.+++.+...
T Consensus         4 ~~~~~y~~~~~lg~g~~~~v~~~~~~~~~~~~~vK~~~~~~~~~~~~~~~~~E~~~l~~l~~h~ni~~~~~~~~~~   79 (337)
T cd07852           4 HILRKYEILQKLGKGAYGIVWKAIDRRTKEVVALKKIFDAFRNATDAQRTFREIMFLQELGDHPNIVKLLNVIKAE   79 (337)
T ss_pred             hhhhHHHHhHhhcCCCCeeEEEEEEcCCCeEEEEEeeccccCcchhhhhhhHHHHHHHHhcCCCCccceeeeeccC
Confidence            467899999999999999999998752  1      1                  114556899999999987543


No 132
>KOG0583|consensus
Probab=95.35  E-value=0.019  Score=44.12  Aligned_cols=52  Identities=17%  Similarity=0.238  Sum_probs=39.9

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh-------------------hhh----------hccCcchheeEEEeEeeCCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK-------------------LLQ----------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~-------------------~~~----------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ....+|...+.||+|+||.|..|.+..+                   .++          +.+--|.|++.|++++-+|+
T Consensus        14 ~~~g~y~~~~~lG~GsfgkV~~a~~~~t~~~vAiKii~~~~~~~~~~~~~~~i~rEi~~~~~~~~HpnI~~l~ev~~t~~   93 (370)
T KOG0583|consen   14 LSIGKYELGRTLGSGSFGKVKLAKHRLTGEKVAIKIIDRKKVSSKSQKLDELIKREISILRRLRSHPNIIRLLEVFATPT   93 (370)
T ss_pred             cccCceeeeeeecCCCCeeEEEeeeccCCCeEEEEEechhcccccccccchhhHHHHHHHHHhccCCCEeEEEEEEecCC
Confidence            4567899999999999999999976432                   111          33323789999999999887


Q ss_pred             c
Q psy1710          75 Q   75 (77)
Q Consensus        75 ~   75 (77)
                      .
T Consensus        94 ~   94 (370)
T KOG0583|consen   94 K   94 (370)
T ss_pred             e
Confidence            5


No 133
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=95.34  E-value=0.019  Score=40.65  Aligned_cols=47  Identities=26%  Similarity=0.383  Sum_probs=35.3

Q ss_pred             CCcccccccCCCCCcceEEEEech-----------hh------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK-----------KL------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~-----------~~------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|+.++.||+|+||.|+.|.+..           |+                  +.+.+ .|+|++.+++++..+.
T Consensus         7 ~~~~~~~~lg~G~~g~vy~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~~~~l-~h~niv~~~~~~~~~~   82 (303)
T cd05110           7 TELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASM-DHPHLVRLLGVCLSPT   82 (303)
T ss_pred             hhceeccccccCCCccEEEEEEecCCCcceeeEEEEeccccCCHHHHHHHHHHHHHHHhC-CCCCcccEEEEEcCCC
Confidence            457888999999999999987521           10                  11445 6999999999987654


No 134
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=95.33  E-value=0.015  Score=39.84  Aligned_cols=46  Identities=20%  Similarity=0.235  Sum_probs=34.5

Q ss_pred             CCcccccccCCCCCcceEEEEechh-----------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-----------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||.|+||.|+.|.+...                 +     ..+.+ .|+|++.+++++...
T Consensus         6 ~~~~~~~~lg~g~~~~v~~~~~~~~~~v~iK~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   73 (261)
T cd05068           6 TSIQLLRKLGAGQFGEVWEGLWNNTTPVAVKTLKPGTMDPKDFLAEAQIMKKL-RHPKLIQLYAVCTLE   73 (261)
T ss_pred             hheeeEEEecccCCccEEEEEecCCeEEEEEeeCCCcccHHHHHHHHHHHHHC-CCCCccceeEEEecC
Confidence            6788999999999999999875321                 1     11445 689999999987543


No 135
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.31  E-value=0.016  Score=41.22  Aligned_cols=47  Identities=28%  Similarity=0.327  Sum_probs=35.4

Q ss_pred             CCCcccccccCCCCCcceEEEEech--------------h-------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK--------------K-------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~--------------~-------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .+||...+.||+|+||.|+.|.+..              |             +     +.+.+..|+|+|.+++++..
T Consensus        11 ~~~~~~~~~lg~G~~g~vy~~~~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~E~~~l~~l~~h~~iv~~~~~~~~   89 (314)
T cd05099          11 RDRLVLGKPLGEGCFGQVVRAEAYGIDKSRPDQTVTVAVKMLKDNATDKDLADLISEMELMKLIGKHKNIINLLGVCTQ   89 (314)
T ss_pred             HHHeeeeeeecCCCcccEEEeeecccCCccCCcceEEEEEecCCCCChHHHHHHHHHHHHHHhccCCCCeeeEEEEEcc
Confidence            4689999999999999999886410              0             0     11556679999999997654


No 136
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=95.29  E-value=0.014  Score=40.07  Aligned_cols=45  Identities=16%  Similarity=0.259  Sum_probs=33.7

Q ss_pred             CCcccccccCCCCCcceEEEEech------------hh------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK------------KL------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~------------~~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .+|+.++.||+|+||.|+.|.++.            |.                  ..+.+ .|+|++.+++++..
T Consensus         5 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~   79 (275)
T cd05046           5 SNLQEITTLGRGEFGEVFLAKAKGIEEEGGETLVLVKALQKTKDENLQSEFRRELDMFRKL-SHKNVVRLLGLCRE   79 (275)
T ss_pred             HhceeeeeecccceeEEEEEEeccCCcCCCcceEEEEccCCccchHHHHHHHHHHHHHHhc-CCcceeeeEEEECC
Confidence            578899999999999999998531            00                  11334 68899999998754


No 137
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=95.28  E-value=0.016  Score=40.37  Aligned_cols=48  Identities=19%  Similarity=0.250  Sum_probs=37.1

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .++|+..+.||.|+||.|+.|.++.+-                          ..+.+ .|.|++.+++++..+.
T Consensus         6 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~~e~~~~~~l-~h~~i~~~~~~~~~~~   79 (302)
T cd07864           6 VDKFDIIGQIGEGTYGQVYKARDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQL-NHRNIVNLKEIVTDKQ   79 (302)
T ss_pred             hhhhheeeeecccCCEEEEEEEECCCCcEEEEEEEeecccccCchHHHHHHHHHHHhC-CCCCeeeeeheecCcc
Confidence            457889999999999999999875310                          12556 6899999999887653


No 138
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=95.26  E-value=0.026  Score=41.21  Aligned_cols=46  Identities=20%  Similarity=0.317  Sum_probs=34.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------h------hhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------L------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------~------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.|+.++.||+|+||.|+.|.++.+       +              +      -+.+ .|.|++.+++.|...
T Consensus         1 ~~f~~~~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~iv~~~~~~~~~   73 (360)
T cd05627           1 DDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEA-DGAWVVKMFYSFQDK   73 (360)
T ss_pred             CCceEEEEEeeCCCEEEEEEEECCCCCEEEEEEEEHHHHhhhhhHHHHHHHHHHHHhC-CCCCEeeEEEEEEcC
Confidence            3688899999999999999987521       1              0      0234 578999999887654


No 139
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=95.24  E-value=0.02  Score=40.74  Aligned_cols=47  Identities=17%  Similarity=0.298  Sum_probs=34.6

Q ss_pred             CCCcccccccCCCCCcceEEEEech-----------hh------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK-----------KL------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~-----------~~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..+|+.++.||+|+||.|+.|.+..           |+                  +.+-+ .|+|++.+++.+...
T Consensus         6 ~~~f~~~~~lg~G~~g~Vy~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~niv~~~g~~~~~   81 (316)
T cd05108           6 ETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASV-DNPHVCRLLGICLTS   81 (316)
T ss_pred             hhhceeeeeeecCCCceEEEEEEecCCCccceeEEEEeccccCCHHHHHHHHHHHHHHHhC-CCCCCCeEEEEEcCC
Confidence            3569999999999999999997421           10                  11344 689999999987654


No 140
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=95.22  E-value=0.025  Score=40.25  Aligned_cols=46  Identities=17%  Similarity=0.262  Sum_probs=34.7

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------hh-----hhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------LL-----QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~~-----~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.|+..+.||+|+||.|+.|.+..+                    ++     -+.+ .|+|++.+++.+..+
T Consensus         1 ~~~~~~~~lg~G~~g~v~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~   71 (308)
T cd06615           1 DDFEKLGELGAGNGGVVTKVLHRPSGLIMARKLIHLEIKPAIRNQIIRELKVLHEC-NSPYIVGFYGAFYSD   71 (308)
T ss_pred             CCceEEeeccCCCCeEEEEEEEcCCCeEEEEEEeccccCHHHHHHHHHHHHHHHhC-CCCCCCeEEEEEeeC
Confidence            3688899999999999999876521                    11     1455 688999999987654


No 141
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=95.22  E-value=0.02  Score=38.66  Aligned_cols=45  Identities=18%  Similarity=0.367  Sum_probs=33.7

Q ss_pred             CcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+.++.||+|+||.|+.|.++.+-                          .-+.+ .|+|++.+++.+...
T Consensus         1 ~y~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   71 (256)
T cd08220           1 KYEKIRVVGRGAFGIVHLCRRKADQKLVIIKQIPVEQMTKDERLAAQNECQVLKLL-SHPNIIEYYENFLED   71 (256)
T ss_pred             CceEEEEecccCceEEEEEEEcCCCcEEEEEEEeccccccHHHHHHHHHHHHHhhC-CCCchhheeeeEecC
Confidence            6899999999999999998874111                          00344 589999999887643


No 142
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=95.20  E-value=0.011  Score=41.06  Aligned_cols=48  Identities=23%  Similarity=0.275  Sum_probs=36.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .++|...+.||.|+||.|+.|.++.+-                          ..+.+ .|+|++.++++++.+.
T Consensus         7 ~~~y~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   80 (311)
T cd07866           7 LRDYEILGKLGEGTFGEVYKARQIKTGRVVALKKILMHNEKDGFPITALREIKILKKL-KHPNVVPLIDMAVERP   80 (311)
T ss_pred             cccEEEEEEeccCCCEEEEEEEECCCCcEEEEEEEEeccCCCCcchhHHHHHHHHHhc-CCCCccchhhheeccc
Confidence            478999999999999999999875320                          11445 6889999988776543


No 143
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=95.18  E-value=0.023  Score=40.23  Aligned_cols=48  Identities=21%  Similarity=0.349  Sum_probs=36.3

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh--------h----------------hhhccCcchheeEEEeEeeCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK--------L----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ...+|..++.||.|+||.|+.|.|...        +                ..+.+ .|+|++.+++.+...
T Consensus        17 ~~~~y~~~~~lg~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~~   88 (297)
T cd06656          17 PKKKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMREN-KNPNIVNYLDSYLVG   88 (297)
T ss_pred             hhhhceeeeeeccCCCeEEEEEEECCCCCEEEEEEEecCccchHHHHHHHHHHHHhC-CCCCEeeEEEEEecC
Confidence            457899999999999999999987421        0                11233 789999999987653


No 144
>KOG0591|consensus
Probab=95.17  E-value=0.0037  Score=49.04  Aligned_cols=42  Identities=26%  Similarity=0.416  Sum_probs=33.8

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEeE
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYMW   69 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~~   69 (77)
                      ..|+.++.||.|+||.|++|.+..+        |                  +-|-+ .|+|+|+-|+|
T Consensus        19 ~~y~Il~~IG~GsFg~vykv~~~~~g~l~a~K~i~f~~md~k~rq~~v~Ei~lLkQL-~HpNIVqYy~~   86 (375)
T KOG0591|consen   19 ADYQILKKIGRGSFGEVYKVQCLLDGKLVALKKIQFGMMDAKARQDCVKEISLLKQL-NHPNIVQYYAH   86 (375)
T ss_pred             HHHHHHHHHcCCcchheEEeeeccCcchhhhhhcchhhccHHHHHHHHHHHHHHHhc-CCchHHHHHHH
Confidence            4599999999999999999986621        1                  22777 89999999984


No 145
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=95.16  E-value=0.034  Score=38.38  Aligned_cols=46  Identities=17%  Similarity=0.293  Sum_probs=35.7

Q ss_pred             CCCcccccccCCCCCcceEEEEech-----h-------h-----------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK-----K-------L-----------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~-----~-------~-----------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .++|+..+.||+|+||.|+.|.+..     .       +                 ..+.+ .|+|++.+++..+.
T Consensus         5 ~~~~~~~~~i~~g~~g~V~~~~~~~~~~~~~~~v~~k~~~~~~~~~~~~~~~~e~~~l~~l-~h~ni~~~~~~~~~   79 (280)
T cd05043           5 RDRVTLSDLLQEGTFGRIFYGILIDEKPGKEEEVFVKTVKDHASEIQVTLLLQESCLLYGL-SHQNILPILHVCIE   79 (280)
T ss_pred             hhheEEeeeecccCCceEEEEEEecCCCCceeEEEEEEccCCCCHHHHHHHHHHHHHHHhC-CCCCCCeEEEEEec
Confidence            4689999999999999999998654     0       0                 01445 79999999998665


No 146
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=95.11  E-value=0.035  Score=37.69  Aligned_cols=46  Identities=24%  Similarity=0.335  Sum_probs=34.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh------------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.|...+.||+|++|.|+.|.+..+                        +     ..+.+ .|+|++.+++++...
T Consensus         2 ~~~~~~~~lg~g~~~~vy~~~~~~~~~~~~lk~~~~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   76 (263)
T cd06625           2 TNWRRGKLLGQGAFGRVYLCYDVDTGRELAVKQVPFDPDSPETKKEVNALECEIQLLKNL-QHERIVQYYGCLRDD   76 (263)
T ss_pred             CcccccceecCCCceEEEEEEEcCCCcEEEEEEEeecccchhhHHHHHHHHHHHHHHHhC-CCCCeeeeEEEEccC
Confidence            4688899999999999999976421                        0     11456 699999999987643


No 147
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=95.09  E-value=0.025  Score=39.67  Aligned_cols=22  Identities=23%  Similarity=0.299  Sum_probs=19.5

Q ss_pred             CCcccccccCCCCCcceEEEEe
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAP   48 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D   48 (77)
                      .||+..+.||+|+||.|+.|.+
T Consensus         5 ~~~~~~~~lg~G~~g~v~~~~~   26 (295)
T cd05097           5 QQLRLKEKLGEGQFGEVHLCEA   26 (295)
T ss_pred             HhCeehhccCCCCCceEEeccc
Confidence            5899999999999999998765


No 148
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=95.07  E-value=0.027  Score=39.10  Aligned_cols=44  Identities=16%  Similarity=0.267  Sum_probs=34.2

Q ss_pred             cccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |+.++.||.|.||.|++|.+...-                        ..+.+ .|+|++.+++.+...
T Consensus         7 ~~i~~~lg~g~~g~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~l-~h~~ii~~~~~~~~~   74 (282)
T cd06643           7 WEIIGELGDGAFGKVYKAQNKETGVLAAAKVIDTKSEEELEDYMVEIDILASC-DHPNIVKLLDAFYYE   74 (282)
T ss_pred             HHHHhhcccCCCeEEEEEEECCCCeEEEEEEeCCCCHHHHHHHHHHHHHHHHC-CCCCeeeEEEEEeeC
Confidence            778899999999999999875311                        11556 689999999987754


No 149
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.06  E-value=0.016  Score=40.79  Aligned_cols=48  Identities=23%  Similarity=0.314  Sum_probs=35.8

Q ss_pred             CCCcccccccCCCCCcceEEEEech--------------hh------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK--------------KL------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~--------------~~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|...+.||+|+||.|+.|.+..              |+                  ..+.++.|+|++.+++.+...
T Consensus        14 ~~~~~~~~~lg~G~~g~Vy~~~~~~~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~E~~~l~~l~~h~~i~~~~~~~~~~   93 (304)
T cd05101          14 RDKLTLGKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQD   93 (304)
T ss_pred             HHHeeecceeeccCCceEEEEEEeccCCCCCCcceeEEeeecccccchHHHHHHHHHHHHHHhhccCCCchheeEEEecC
Confidence            4678888999999999999886310              11                  115566899999999987654


No 150
>PHA02882 putative serine/threonine kinase; Provisional
Probab=95.06  E-value=0.014  Score=41.33  Aligned_cols=26  Identities=23%  Similarity=0.359  Sum_probs=22.5

Q ss_pred             CCCcccccccCCCCCcceEEEEechh
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK   51 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~   51 (77)
                      ..+|+..+.||+|+||.|+.|.+..+
T Consensus        11 ~~~y~i~~~LG~G~fG~Vy~~~~~~~   36 (294)
T PHA02882         11 GKEWKIDKLIGCGGFGCVYETQCASD   36 (294)
T ss_pred             CCceEEeeEEecCCCceEEEEEEcCC
Confidence            47899999999999999999986543


No 151
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=95.04  E-value=0.023  Score=38.86  Aligned_cols=44  Identities=20%  Similarity=0.244  Sum_probs=33.4

Q ss_pred             CCCcccccccCCCCCcceEEEEechh------h----------------hhhccCcchheeEEEeEe
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK------L----------------LQKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~------~----------------~~~~~~~~~~~~~~~~~~   70 (77)
                      .++|+.++.||+|+||.|+.|.+...      +                ..+-+ .|.|++.+++.+
T Consensus         5 ~~~~~~~~~ig~g~~~~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~E~~~l~~l-~~~~i~~~~~~~   70 (260)
T cd05070           5 RESLQLIKKLGNGQFGEVWMGTWNGNTKVAVKTLKPGTMSPESFLEEAQIMKKL-RHDKLVQLYAVV   70 (260)
T ss_pred             hHHhhhhheeccccCceEEEEEecCCceeEEEEecCCCCCHHHHHHHHHHHHhc-CCCceEEEEeEE
Confidence            57899999999999999999876421      1                11345 578999998875


No 152
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=95.04  E-value=0.023  Score=40.11  Aligned_cols=48  Identities=21%  Similarity=0.279  Sum_probs=36.4

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh-------hh-------------------hhccCcchheeEEEeEeeCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK-------LL-------------------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~~-------------------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..++|+..+.||.|+||.|+.|.|+.+       .+                   -+.+ .|+|++.+++++...
T Consensus         5 ~~~~y~~~~~ig~g~~~~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~~   78 (309)
T cd07845           5 SVTEFEKLNRIGEGTYGIVYRARDTTSGEIVALKKVRMDNERDGIPISSLREITLLLNL-RHPNIVELKEVVVGK   78 (309)
T ss_pred             cccceeEeeeeeecCCEEEEEEEECCCCcEEEEEEEEeccCCCCCcchhhHHHHHHHhC-CCCCCcceEEEEecC
Confidence            346799999999999999999988531       10                   0334 688999999988754


No 153
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=95.04  E-value=0.027  Score=39.93  Aligned_cols=47  Identities=23%  Similarity=0.314  Sum_probs=35.9

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..||...+.||.|.||.||.|.|..+-                        ..+.+ .|+|++.+++.+...
T Consensus        18 ~~~y~~~~~lg~g~~g~vy~~~~~~~~~~v~iK~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~   88 (296)
T cd06655          18 KKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKEL-KNPNIVNFLDSFLVG   88 (296)
T ss_pred             cceEEEEEEEecCCCeEEEEEEEcCCCcEEEEEEEecccCchHHHHHHHHHHHHhc-CCCceeeeeeeEecC
Confidence            357999999999999999999864210                        11445 789999999987653


No 154
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=95.00  E-value=0.018  Score=40.52  Aligned_cols=46  Identities=20%  Similarity=0.222  Sum_probs=34.1

Q ss_pred             CCcccccccCCCCCcceEEEEechh---------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK---------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~---------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||+|+||.|+.|.++..         +                  .-+.+..|+|++.+++.+..
T Consensus         2 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~E~~~l~~l~~hp~iv~~~~~~~~   74 (297)
T cd05089           2 EDIKFEDVIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEFASENDHRDFAGELEVLCKLGHHPNIINLLGACEN   74 (297)
T ss_pred             ccceeeeeecCCCcceEEEEEecCCCCcceeEEEEccccCCHHHHHHHHHHHHHHHhhcCCCchhheEEEEcc
Confidence            5688889999999999999876421         0                  00345568999999998754


No 155
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=94.98  E-value=0.021  Score=39.60  Aligned_cols=46  Identities=20%  Similarity=0.317  Sum_probs=34.7

Q ss_pred             CCCcccccccCCCCCcceEEEEech-----------hh------------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK-----------KL------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~-----------~~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ..+|+..+.||+|+||.|+.|.++.           |.                  ..+.+ .|.|++.+++++.+
T Consensus         6 ~~~~~~~~~ig~g~~g~v~~~~~~~~~~~~~~~~aik~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   80 (279)
T cd05057           6 ETELEKIKVLGSGAFGTVYKGVWIPEGEKVKIPVAIKVLREETSPKANKEILDEAYVMASV-DHPHVVRLLGICLS   80 (279)
T ss_pred             HHHcEEcceecCCCCccEEEEEEecCCCCcceEEEEEeccCCCCHHHHHHHHHHHHHHHhC-CCCCcceEEEEEec
Confidence            4678999999999999999987531           00                  11344 68999999998875


No 156
>KOG0608|consensus
Probab=94.97  E-value=0.024  Score=48.73  Aligned_cols=25  Identities=28%  Similarity=0.511  Sum_probs=21.3

Q ss_pred             cccccccCCCCCcceEEE--Eechhhh
Q psy1710          29 YTNLAYIGEGAYGMVVSE--APMKKLL   53 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA--~D~~~~~   53 (77)
                      |..++.||.||||.||.|  .|+.++|
T Consensus       631 Fvkik~iGvGAFGeV~Lv~KvDT~~lY  657 (1034)
T KOG0608|consen  631 FVKIKTIGVGAFGEVCLVRKVDTRALY  657 (1034)
T ss_pred             eEEEeeecccccceeEEEeecchhhHH
Confidence            577899999999999998  4777773


No 157
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=94.97  E-value=0.024  Score=39.43  Aligned_cols=51  Identities=27%  Similarity=0.389  Sum_probs=36.5

Q ss_pred             EEe-CCCcccccccCCCCCcceEEEEech------------hh------------------hhhccCcchheeEEEeEee
Q psy1710          23 FEV-GPRYTNLAYIGEGAYGMVVSEAPMK------------KL------------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        23 f~V-~~RY~~lk~IG~GAYG~VcSA~D~~------------~~------------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      |++ ..+|+..+.||+|+||.|+.|.+..            |+                  ..+.++.|+|++.+++.+.
T Consensus         7 ~~~~~~~~~~~~~ig~g~~g~v~~~~~~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~~l~~h~~i~~~~~~~~   86 (293)
T cd05053           7 WELPRDRLTLGKPLGEGAFGQVVKAEAVGLDNPNETSTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGVCT   86 (293)
T ss_pred             cccCHhHeEEeeEecccccccEEEEEEecCCCCCCceeEEEEEccCCCCHHHHHHHHHHHHHHHhhcCCCCeeeEEEEEc
Confidence            444 3678899999999999999886431            10                  1134557999999999765


Q ss_pred             CC
Q psy1710          72 SP   73 (77)
Q Consensus        72 ~~   73 (77)
                      ..
T Consensus        87 ~~   88 (293)
T cd05053          87 QE   88 (293)
T ss_pred             CC
Confidence            43


No 158
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=94.96  E-value=0.035  Score=38.51  Aligned_cols=45  Identities=22%  Similarity=0.309  Sum_probs=31.8

Q ss_pred             CCc-ccccccCCCCCcceEEEE-ec------------------h---------hh-hhhccCcchheeEEEeEeeC
Q psy1710          27 PRY-TNLAYIGEGAYGMVVSEA-PM------------------K---------KL-LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY-~~lk~IG~GAYG~VcSA~-D~------------------~---------~~-~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +|| +.++.||+|+||.|+.+. +.                  .         ++ ..+.+ .|+|++.+++.+..
T Consensus         3 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~   77 (283)
T cd05080           3 KRYLKKIRVLGEGHFGKVSLYCYDPANDGTGEMVAVKTLKRECGQQNTSGWKKEINILKTL-YHENIVKYKGCCSE   77 (283)
T ss_pred             hhhceeceecccCCCcEEEEeeEccccCCCCceEEEEEeccccChHHHHHHHHHHHHHHhC-CCCCEeeEEEEEec
Confidence            577 899999999999997642 10                  0         00 11456 78999999998654


No 159
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=94.94  E-value=0.023  Score=38.65  Aligned_cols=47  Identities=17%  Similarity=0.204  Sum_probs=35.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh------h-----------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------L-----------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------~-----------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..|+..+.||.|+||.|++|.++..      +                 ..+.+ .|+|++.+++++....
T Consensus         6 ~~y~~~~~ig~g~~~~vy~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~~   75 (261)
T cd05148           6 EEFTLERKLGSGYFGEVWEGLWKNRVRVAIKILKSDDLLKQQDFQKEVQALKRL-RHKHLISLFAVCSVGE   75 (261)
T ss_pred             HHHHHhhhhccCCCccEEEeEecCCCcEEEEeccccchhhHHHHHHHHHHHhcC-CCcchhheeeeEecCC
Confidence            3588899999999999999987531      0                 11556 7899999999876543


No 160
>KOG0668|consensus
Probab=94.94  E-value=0.007  Score=46.73  Aligned_cols=63  Identities=17%  Similarity=0.135  Sum_probs=48.5

Q ss_pred             CCceEEeecceEEEeCCCcccccccCCCCCcceEEEEec----------------hh------hhhhccCcchheeEEEe
Q psy1710          11 LAGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPM----------------KK------LLQKGAGTNEQLVLLYM   68 (77)
Q Consensus        11 ~~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~----------------~~------~~~~~~~~~~~~~~~~~   68 (77)
                      ..++.++.....|--.+.|+..+.+|+|.|..|+.+++.                +|      ||+. +-.+.|+|.|+|
T Consensus        22 ~eYWdYE~~~i~wg~~ddYeivrk~GRGKYSEVFeg~~~~~~eK~ViKiLKPVkkkKIkREikIL~n-L~gg~NIi~L~D  100 (338)
T KOG0668|consen   22 REYWDYESLVIDWGNQDDYEIVRKVGRGKYSEVFEGINITNNEKCVIKILKPVKKKKIKREIKILQN-LRGGPNIIKLLD  100 (338)
T ss_pred             hhhcchhheeeeccccchHHHHHHHcCccHhhHhcccccCCCceEEEeeechHHHHHHHHHHHHHHh-ccCCCCeeehhh
Confidence            456677766667888999999999999999999998733                12      2443 335789999999


Q ss_pred             EeeCCC
Q psy1710          69 WWISPT   74 (77)
Q Consensus        69 ~~~~~~   74 (77)
                      ++--|.
T Consensus       101 iV~Dp~  106 (338)
T KOG0668|consen  101 IVKDPE  106 (338)
T ss_pred             hhcCcc
Confidence            998774


No 161
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=94.92  E-value=0.032  Score=38.34  Aligned_cols=45  Identities=27%  Similarity=0.319  Sum_probs=34.8

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|+..+.||.|+||.|+.|.+...                     +     ..+.+ .|+|++.+++++...
T Consensus         1 ~y~~~~~l~~g~~~~v~~~~~~~~~~~~~vK~~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   71 (286)
T cd07832           1 RYKILGRIGEGAHGIVFKAKDRETGETVALKKVALRRLEGGIPNQALREIKALQAC-QHPYVVKLLDVFPHG   71 (286)
T ss_pred             CceEEeecccCCCcEEEEEEECCCCceEEEEEEEcccccchhhHHHHHHHHHHHhC-CCCCCcceeeEEecC
Confidence            688999999999999999986421                     0     22556 499999999987654


No 162
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=94.90  E-value=0.04  Score=38.12  Aligned_cols=46  Identities=17%  Similarity=0.179  Sum_probs=33.6

Q ss_pred             CCcccccccCCCCCcceEEEEe----ch-------------------hh------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAP----MK-------------------KL------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D----~~-------------------~~------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|+.++.||+|+||.|+.|..    ..                   .+      + +-+ .|+|++.+++.+..+.
T Consensus         4 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~e~~~l-~~l-~h~~iv~~~~~~~~~~   78 (284)
T cd05081           4 RHLKFIQQLGKGNFGSVELCRYDPLQDNTGEVVAVKKLQHSTAEHLRDFEREIEIL-KSL-QHDNIVKYKGVCYSAG   78 (284)
T ss_pred             ccceeeeeccCCCCceEEEEEecCCcCCCCcEEEEEEeccCCHHHHHHHHHHHHHH-HhC-CCCCeeEEEEEEccCC
Confidence            4788999999999999998751    10                   00      1 334 6899999999876553


No 163
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=94.90  E-value=0.035  Score=39.86  Aligned_cols=44  Identities=18%  Similarity=0.304  Sum_probs=33.2

Q ss_pred             cccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      |..++.||+|+||.|+.|.++.+       +                    ..+..+.+.+++.+++.+-.
T Consensus         2 f~~~~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~~i~~~~~~~~~   72 (323)
T cd05616           2 FNFLMVLGKGSFGKVMLAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQT   72 (323)
T ss_pred             ceEEEEEeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhccCCCeEeeEEEEEec
Confidence            77889999999999999987631       1                    01455678899999887654


No 164
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=94.89  E-value=0.034  Score=37.82  Aligned_cols=46  Identities=20%  Similarity=0.145  Sum_probs=35.1

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh---------------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL---------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~---------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ...|+..+.||.|+||.|+.|.+....                     +.+.+ .|+|++.+++++..
T Consensus         5 ~~~~~~~~~ig~g~~g~v~~~~~~~~~v~iK~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   71 (256)
T cd05039           5 SKELKLGATIGKGEFGDVMLGDYRGQKVAVKCLKDDSTAAQAFLAEASVMTTL-RHPNLVQLLGVVLQ   71 (256)
T ss_pred             hhhccceeeeecCCCceEEEEEecCcEEEEEEeccchhHHHHHHHHHHHHHhc-CCcceeeeEEEEcC
Confidence            356888999999999999998765221                     11445 58999999999874


No 165
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=94.87  E-value=0.04  Score=37.94  Aligned_cols=46  Identities=33%  Similarity=0.445  Sum_probs=34.7

Q ss_pred             CcccccccCCCCCcceEEEEech-------hh-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK-------KL-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~-------~~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .|+.++.||.|.||.|+.|.++.       |.                   +.+.+ .|+|++.+++.+..+.
T Consensus         1 ~y~~~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   72 (285)
T cd07861           1 DYTKIEKIGEGTYGVVYKGRNKKTGQIVAMKKIRLESEEEGVPSTAIREISLLKEL-QHPNIVCLQDVLMQES   72 (285)
T ss_pred             CceEeeEecccCceEEEEEEECCCCcEEEEEEeccccccCCchHHHHHHHHHHHhc-CCCCEeeeEEEEeeCC
Confidence            37888999999999999998752       11                   11344 4899999999987654


No 166
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=94.87  E-value=0.022  Score=38.99  Aligned_cols=47  Identities=17%  Similarity=0.330  Sum_probs=35.8

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|...+.||+|+||.|+.|.+..+-                        ..+.+ .|+|++.+++.+...
T Consensus         8 ~~~~~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~e~~~~~~l-~h~~ii~~~~~~~~~   78 (267)
T cd06645           8 QEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDC-KHSNIVAYFGSYLRR   78 (267)
T ss_pred             HHHHHHHHHhCCCCCeEEEEEEEcCCCcEEEEEEEecCchhHHHHHHHHHHHHHhC-CCCCeeeEEEEEEeC
Confidence            357999999999999999999874210                        11445 789999999987653


No 167
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=94.86  E-value=0.039  Score=38.42  Aligned_cols=46  Identities=11%  Similarity=0.163  Sum_probs=34.1

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------hhh-----hccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------LLQ-----KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~~~-----~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||.|+||.|+.|.|..+                    +..     +.+ .|+|++.+++.+..+
T Consensus         1 ~~~~~~~~lg~g~~~~v~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~   71 (279)
T cd06619           1 QDIQYQEILGHGNGGTVYKAYHLLTRRILAVKVIPLDITVELQKQIMSELEILYKC-DSPYIIGFYGAFFVE   71 (279)
T ss_pred             CcchheeeeccCCCeEEEEEEEcCCCcEEEEEEEecCCChHHHHHHHHHHHHHHhC-CCCCeeeEEEEEEEC
Confidence            3688899999999999999987411                    100     334 689999999987654


No 168
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=94.86  E-value=0.0099  Score=41.00  Aligned_cols=46  Identities=35%  Similarity=0.505  Sum_probs=33.9

Q ss_pred             CCcccccccCCCCCcceEEEEech-------hhhh-------------------hccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK-------KLLQ-------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~-------~~~~-------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||.|+||.|+.|.+..       |.+.                   +.+ .|+|++.+++.+..+
T Consensus         1 ~~y~~~~~lg~g~~~~vy~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   72 (286)
T cd07846           1 EKYENLGLVGEGSYGMVMKCKHKETGQIVAIKKFLESEDDKMVKKIAMREIRMLKQL-RHENLVNLIEVFRRK   72 (286)
T ss_pred             CceeEeeeeccCCCeEEEEEEECCCCCEEEEEeHhhccCcchhhHHHHHHHHHHHhc-CCcchhhHHHhcccC
Confidence            478999999999999999998852       1111                   334 578888888877544


No 169
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=94.85  E-value=0.043  Score=38.32  Aligned_cols=46  Identities=17%  Similarity=0.220  Sum_probs=33.8

Q ss_pred             CCcccccccCCCCCcceEEEEech-----------h-h-----------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK-----------K-L-----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~-----------~-~-----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..|+.++.||+|+||.|+.|.+..           | +                 ..+.+ .|+|+|.+++.+..+
T Consensus         7 ~~~~~~~~lg~G~~~~vy~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~l~~l-~h~~iv~~~~~~~~~   81 (279)
T cd05111           7 TELRKLKLLGSGVFGTVHKGIWIPEGDSIKIPVAIKTIQDRSGRQTFQEITDHMLAMGSL-DHAYIVRLLGICPGA   81 (279)
T ss_pred             hhceeccccCccCCcceEEEEEcCCCCceeeEEEEeecccccchHHHHHHHHHHHHHhcC-CCCCcceEEEEECCC
Confidence            467888999999999999987521           0 0                 00344 689999999987654


No 170
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=94.84  E-value=0.03  Score=40.13  Aligned_cols=46  Identities=11%  Similarity=0.143  Sum_probs=34.2

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|...+.||+|+||.|+.|.++.+       +                    +.+. ..|+|++.+++.+...
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~i~~~-~~~~~i~~~~~~~~~~   73 (330)
T cd05601           1 KDFDVKSLVGRGHFGEVQVVREKATGDIYAMKVMKKSVLLAQETVSFFEEERDILSI-SNSPWIPQLQYAFQDK   73 (330)
T ss_pred             CCceEEEEEEeccCEEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHh-CCCCCCcceeeEEecC
Confidence            3688999999999999999987521       0                    1122 3789999999887654


No 171
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=94.84  E-value=0.033  Score=37.89  Aligned_cols=46  Identities=22%  Similarity=0.219  Sum_probs=35.0

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h---------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L---------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~---------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .++|...+.||.|+||.|+.|.+...       +               ..+.+ .|.|++.+++.+..
T Consensus         5 ~~~~~i~~~ig~g~~~~v~~~~~~~~~~~~vK~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   72 (261)
T cd05034           5 RESLKLERKLGAGQFGEVWMGTWNGTTKVAVKTLKPGTMSPEAFLQEAQIMKKL-RHDKLVQLYAVCSE   72 (261)
T ss_pred             hhheeeeeeeccCcceEEEEEEEcCCceEEEEEecCCccCHHHHHHHHHHHhhC-CCCCEeeeeeeeec
Confidence            46889999999999999999976431       0               11455 58999999987654


No 172
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=94.82  E-value=0.05  Score=36.65  Aligned_cols=47  Identities=21%  Similarity=0.354  Sum_probs=36.6

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-----------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-----------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|+..+.||.|+||.|+.|.+...                 +     ..+.+ .|+|++.+++.+...
T Consensus         2 ~~~y~~~~~i~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~e~~~~~~l-~~~~i~~~~~~~~~~   70 (256)
T cd06612           2 EEVFDILEKLGEGSYGSVYKAIHKETGQVVAIKVVPVEEDLQEIIKEISILKQC-DSPYIVKYYGSYFKN   70 (256)
T ss_pred             cccchhhhhhcCCCCeEEEEEEEcCCCcEEEEEEeecHHHHHHHHHHHHHHHhC-CCCcEeeeeeeeecC
Confidence            46899999999999999999987531                 1     11445 889999999988765


No 173
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=94.81  E-value=0.046  Score=37.57  Aligned_cols=48  Identities=23%  Similarity=0.279  Sum_probs=36.2

Q ss_pred             CCCcccccccCCCCCcceEEEEech-------hh----------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK-------KL----------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~-------~~----------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.+|...+.||+|+||.|+.|.|+.       |+                      ..+.+ .|+|++.+++.+..+.
T Consensus         1 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~~~ei~~l~~l-~h~~i~~~~~~~~~~~   77 (264)
T cd06653           1 PVNWRLGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPDSQETSKEVNALECEIQLLKNL-RHDRIVQYYGCLRDPE   77 (264)
T ss_pred             CCceeeeeeEccCCCeEEEEEEEcCCCCEEEEEEEecCcccchhhHHHHHHHHHHHHHHHc-CCCCcceEEEEEEcCC
Confidence            3578889999999999999998753       11                      11445 6899999999876653


No 174
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=94.81  E-value=0.034  Score=40.31  Aligned_cols=42  Identities=26%  Similarity=0.308  Sum_probs=30.1

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------hh------hccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------LQ------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------~~------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.++.+       +              ++      ..+..|+|+|.+++.+..+.
T Consensus         1 ~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~E~~~l~~~~~hp~iv~~~~~~~~~~   69 (329)
T cd05618           1 RVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTES   69 (329)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEhhHhcchhHHHHHHHHHHHHHhcCCCCcCCceeeEEEeCC
Confidence            4699999999999986521       0              00      22347999999999887654


No 175
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=94.80  E-value=0.016  Score=42.04  Aligned_cols=49  Identities=24%  Similarity=0.428  Sum_probs=37.1

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeC
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      |++..||...+.||.|+||.|+.|.|+.+-                        ..+-+ .|+|++.+++.+..
T Consensus         1 ~~~~~~y~~~~~Lg~g~~g~vy~~~~~~~~~~v~iK~i~~~~~~~~~~~~~Ei~~l~~l-~h~~i~~~~~~~~~   73 (342)
T cd07854           1 FDLGSRYMDLRPLGCGSNGLVFSAVDSDCDKRVAVKKIVLTDPQSVKHALREIKIIRRL-DHDNIVKVYEVLGP   73 (342)
T ss_pred             CCcCcceEEEEEecCCCCEEEEEEEECCCCcEEEEEEEecCCCchHHHHHHHHHHHHhc-CCCcchhhHhhhcc
Confidence            356789999999999999999999886321                        11445 68899998876543


No 176
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=94.79  E-value=0.041  Score=38.34  Aligned_cols=49  Identities=18%  Similarity=0.289  Sum_probs=36.8

Q ss_pred             eCCCcccccccCCCCCcceEEEEechhh-----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKKL-----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~~-----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..++|.....||+|+||.|+.|.+...-                       ..+.+-.|+|++.+++.+..+
T Consensus        20 ~~~~y~~~~~l~~g~~~~vy~~~~~~~~~~~aik~~~~~~~~~~~~~~e~~~l~~l~~h~ni~~~~~~~~~~   91 (291)
T cd06639          20 PTDTWEIIETIGKGTYGKVYKVTNKKDGSLAAVKILDPISDVDEEIEAEYNILQSLPNHPNVVKFYGMFYKA   91 (291)
T ss_pred             CCCCeEEEEEeecCCCeEEEEEEECCCCCEEEEEEecccccHHHHHHHHHHHHHHhcCCCCeEEEEEEEEec
Confidence            4678999999999999999999874211                       002233689999999988654


No 177
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=94.77  E-value=0.027  Score=48.66  Aligned_cols=45  Identities=20%  Similarity=0.235  Sum_probs=35.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------hh--------------------hhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------LL--------------------QKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~~--------------------~~~~~~~~~~~~~~~~~~~   72 (77)
                      .||+..+.||+|+||.|+.|.|..+       .+                    .+.+ .|+|+|.+|+.+..
T Consensus         2 grYeIi~~LGkGgfG~VYlA~d~~tg~~VAIK~I~~~l~~~e~~~~rflrEi~ILs~L-~HPNIVkl~~v~~d   73 (932)
T PRK13184          2 QRYDIIRLIGKGGMGEVYLAYDPVCSRRVALKKIREDLSENPLLKKRFLREAKIAADL-IHPGIVPVYSICSD   73 (932)
T ss_pred             CCeEEEEEEecCCCEEEEEEEECCCCcEEEEEEECcccccCHHHHHHHHHHHHHHHhC-CCcCcCeEEEEEee
Confidence            5899999999999999999987631       11                    1344 58999999987654


No 178
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=94.77  E-value=0.024  Score=39.43  Aligned_cols=47  Identities=13%  Similarity=0.258  Sum_probs=35.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|+.++.||+|+||.|+.|.+...                    +     +-+.+ .|+|++.+++.+..+.
T Consensus         5 ~~~~~~~~ig~g~~g~v~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~~~   76 (284)
T cd06620           5 EDLETISDLGAGNGGSVSKVKHIPTGTVMAKKVVHIGAKSSVRKQILRELQIMHEC-RSPYIVSFYGAFLNEN   76 (284)
T ss_pred             HHHHHHHHcCCCCCeEEEEEEEcCCCcEEEEEEEEecCcchHHHHHHHHHHHHHHc-CCCCcceEeeeEecCC
Confidence            4689999999999999999887511                    0     11445 7899999999887653


No 179
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=94.76  E-value=0.041  Score=37.88  Aligned_cols=45  Identities=24%  Similarity=0.301  Sum_probs=35.0

Q ss_pred             CcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|+.++.||.|++|.|+.|.|...                    +     +.+.+ +|+|++.+++.+...
T Consensus         1 ~y~~~~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~~   70 (284)
T cd07836           1 NFKQLEKLGEGTYATVYKGRNRTTGEIVALKEIHLDAEEGTPSTAIREISLMKEL-KHENIVRLHDVIHTE   70 (284)
T ss_pred             CceEeeeeccCCceEEEEEEECCCCeEEEEEEecccccccchHHHHHHHHHHHhh-cCCCEeeeeeeEeeC
Confidence            588899999999999999997521                    0     11456 689999999988754


No 180
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=94.76  E-value=0.028  Score=40.38  Aligned_cols=45  Identities=24%  Similarity=0.383  Sum_probs=32.9

Q ss_pred             cccccccCCCCCcceEEEEechh-------h--------------hh---------hccCcchheeEEEeEeeCCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK-------L--------------LQ---------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~-------~--------------~~---------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      |..++.||+|+||.|+.|.+..+       +              +.         +.+ .|+|++.+++++....
T Consensus         1 y~i~~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~l~~e~~~~~~~~~l-~hp~i~~~~~~~~~~~   75 (324)
T cd05589           1 FRCLAVLGRGHFGKVLLAEYKKTGELYAIKALKKGDIIARDEVESLMCEKRIFETANSE-RHPFLVNLFACFQTED   75 (324)
T ss_pred             CeEEEEEeecCCEEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhcccc-CCCChhceeeEEEcCC
Confidence            67789999999999999976521       0              00         122 5899999999886543


No 181
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=94.73  E-value=0.057  Score=36.82  Aligned_cols=45  Identities=24%  Similarity=0.315  Sum_probs=33.4

Q ss_pred             CcccccccCCCCCcceEEEEechh----------------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK----------------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~----------------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||...+.||.|+||.|+.|.|...                            +     ..+.+ .|+|++.++|.+...
T Consensus         1 ~~~~~~~ig~g~~~~v~~a~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   78 (267)
T cd06628           1 KWIKGALIGSGSFGSVYLGMNASSGELMAVKQVELPSVSASSKDRKRSMLDALAREIALLKEL-QHENIVQYLGSSLDA   78 (267)
T ss_pred             CccccceeecCCCeEEEEEEecCCCcEEEEEEecCCCcccchhHHHHHHHHHHHHHHHHHHhc-CCCCeeeEEEEEEeC
Confidence            577788999999999999986421                            0     11344 689999999987653


No 182
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=94.72  E-value=0.042  Score=37.26  Aligned_cols=45  Identities=24%  Similarity=0.310  Sum_probs=33.8

Q ss_pred             CCcccccccCCCCCcceEEEEechh-----------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-----------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ..|...+.||.|+||.|+.|.+...                 +     ..+.+ .|+|++.+++.+..
T Consensus         4 ~~~~~~~~ig~g~~g~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   70 (256)
T cd05112           4 SELTLVQEIGSGQFGLVWLGYWLEKRKVAIKTIREGAMSEEDFIEEAQVMMKL-SHPKLVQLYGVCTE   70 (256)
T ss_pred             hHeEEEeeecCcccceEEEEEEeCCCeEEEEECCCCCCCHHHHHHHHHHHHhC-CCCCeeeEEEEEcc
Confidence            4688889999999999999976410                 0     11455 68899999988754


No 183
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=94.72  E-value=0.042  Score=39.44  Aligned_cols=46  Identities=20%  Similarity=0.304  Sum_probs=33.5

Q ss_pred             CcccccccCCCCCcceEEEEechh-------hhh--------------------hccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------LLQ--------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~~~--------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      .|+.++.||+|+||.|+.|.+..+       ++.                    +++..+.+++.+++.+...
T Consensus         1 ~y~~~~~lg~G~~g~Vy~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~~i~~~~~~~~~~   73 (324)
T cd05587           1 DFNFLMVLGKGSFGKVMLAERKGTDELYAIKILKKDVIIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTM   73 (324)
T ss_pred             CceEEEEEeeccCeEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhcCCCCceeeeEEEEEcC
Confidence            378899999999999999987632       110                    3455566788888877543


No 184
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=94.72  E-value=0.039  Score=38.76  Aligned_cols=22  Identities=32%  Similarity=0.360  Sum_probs=19.2

Q ss_pred             CCCcccccccCCCCCcceEEEE
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~   47 (77)
                      ..||+..+.||+|+||.|+.|.
T Consensus         4 ~~~~~~~~~lg~G~~g~v~~~~   25 (296)
T cd05095           4 RKRLTFKEKLGEGQFGEVHLCE   25 (296)
T ss_pred             hhhceeeeeccCCCCCeEEecc
Confidence            3579999999999999999874


No 185
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=94.67  E-value=0.047  Score=38.17  Aligned_cols=45  Identities=22%  Similarity=0.349  Sum_probs=34.7

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|..++.||.|+||.|++|.|..+                    +     ..+.+ .|+|++.+++.+..
T Consensus         1 ~~~~~~~~lg~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~   70 (287)
T cd06621           1 EKIVELSRLGEGAGGSVTKCRLKNTGMIFALKTITTDPNPDLQKQILRELEINKSC-KSPYIVKYYGAFLD   70 (287)
T ss_pred             CceEEEEEeccCCceEEEEEEECCCCeEEEEEEEecCCchHHHHHHHHHHHHHHhC-CCCCeeeeeeEEEc
Confidence            4688899999999999999998531                    1     11456 58999999987754


No 186
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=94.64  E-value=0.065  Score=36.83  Aligned_cols=45  Identities=24%  Similarity=0.328  Sum_probs=34.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh------------------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------------------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------------------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      -.|+..+.||+|+||.||.|.|..+                        +     ..+.+ .|+|++.+++.+..
T Consensus         2 ~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   75 (266)
T cd06651           2 INWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPESPETSKEVSALECEIQLLKNL-QHERIVQYYGCLRD   75 (266)
T ss_pred             CCccccceecCCCCEEEEEEEEcCCCcEEEEEEeecCcCCchhHHHHHHHHHHHHHHHHc-CCCCeeeEEEEEEc
Confidence            4588889999999999999987521                        0     11455 68999999987653


No 187
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=94.60  E-value=0.043  Score=37.20  Aligned_cols=46  Identities=15%  Similarity=0.241  Sum_probs=34.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------h-------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------L-------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------~-------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||+|+||.|+.|.+..+        +                   ..+.+ .|+|++.+++.+...
T Consensus         2 ~~y~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~ei~~l~~~-~~~~i~~~~~~~~~~   74 (267)
T cd08224           2 GNFKIEKKIGKGQFSVVYKAICLLDGRVVALKKVQIFEMMDAKARQDCLKEIDLLKQL-DHPNVIKYLASFIEN   74 (267)
T ss_pred             CceeeeeeeccCCceEEEEEEEcCCCCEEEEEEeecccccchhhHHHHHHHHHHHHhC-CCCCeeeeeeeeecC
Confidence            5799999999999999999987611        0                   01344 688999999987653


No 188
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=94.55  E-value=0.045  Score=37.43  Aligned_cols=46  Identities=24%  Similarity=0.266  Sum_probs=34.1

Q ss_pred             CCcccccccCCCCCcceEEEEechh------h----------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------L----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------~----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|...+.||+|+||.|+.|.++.+      +                ..+.+ .|+|++.+++.+...
T Consensus         4 ~~~~~~~~lg~G~~~~v~~~~~~~~~~~~iK~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   71 (256)
T cd05059           4 SELTFLKELGSGQFGVVHLGKWRGKIDVAIKMIREGAMSEDDFIEEAKVMMKL-SHPNLVQLYGVCTKQ   71 (256)
T ss_pred             HHcchhhhhccCCCceEEEeEecCCccEEEEEeccCCCCHHHHHHHHHHHHhC-CCCCEEEEEEEEcCC
Confidence            3578889999999999998876421      1                11556 689999999886543


No 189
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=94.54  E-value=0.051  Score=38.16  Aligned_cols=44  Identities=14%  Similarity=0.275  Sum_probs=32.0

Q ss_pred             cccccccCCCCCcceEEEEechh-------------h--------------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK-------------L--------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~-------------~--------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |..++.||+|+||.|+.|.+..+             +              +-+.+ .|.|++.+++.+...
T Consensus         2 f~~~~~lg~G~~g~V~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~E~~il~~l-~~~~iv~~~~~~~~~   72 (285)
T cd05631           2 FRHYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRILEKV-NSRFVVSLAYAYETK   72 (285)
T ss_pred             ceEEEEEecCCCEEEEEEEEecCCceEEEEEeeHhhhhhhhhHHHHHHHHHHHHhc-CCCcEEEEEEEEccC
Confidence            67789999999999999876421             1              01344 678999998877543


No 190
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=94.54  E-value=0.04  Score=39.65  Aligned_cols=41  Identities=20%  Similarity=0.225  Sum_probs=29.7

Q ss_pred             cccCCCCCcceEEEEechh-------hh--------------------hhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------LL--------------------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~~--------------------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.+..+       ++                    ......|+|++.+++.+-..
T Consensus         1 ~~lG~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~e~~~l~~~~~hp~i~~~~~~~~~~   68 (316)
T cd05592           1 KVLGKGSFGKVMLAELKGTNEFFAIKALKKDVVLEDDDVECTMVERRVLALAWEHPFLTHLFCTFQTK   68 (316)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhhHHHHHHHHHHHHhccCCCCccceeeEEEcC
Confidence            4699999999999976421       10                    02245899999999987654


No 191
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=94.54  E-value=0.058  Score=38.11  Aligned_cols=45  Identities=20%  Similarity=0.280  Sum_probs=34.3

Q ss_pred             CcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .|+.++.||+|.||.|+.|.+...-                           +.+.+ .|+|++.+++.+...
T Consensus         2 ~y~~~~~l~~g~~~~v~~~~~~~~~~~v~ik~~~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   73 (305)
T cd05609           2 DFETIKLISNGAYGAVYLVRHKETRQRFAMKKINKQNLILRNQIQQVFVERDILTFA-ENPFVVSMFCSFETK   73 (305)
T ss_pred             CceEeeEeecCCCeeEEEEEECCCCcEEEEEEeehhhhhhHHHHHHHHHHHHHHHhC-CCCCeeeeEEEEecC
Confidence            5888999999999999998765210                           11445 689999999987654


No 192
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=94.48  E-value=0.042  Score=38.11  Aligned_cols=46  Identities=24%  Similarity=0.215  Sum_probs=34.9

Q ss_pred             CCcccccccCCCCCcceEEEEech------------h-------------hh-----hhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK------------K-------------LL-----QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~------------~-------------~~-----~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|...+.||+|+||.|+.|.++.            |             ++     .+.+ .|+|++.+++.+...
T Consensus         6 ~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~~~v~ik~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   81 (277)
T cd05036           6 DSITLLRALGHGAFGEVYEGLYRGRDGDAVELQVAVKTLPESCSEQDESDFLMEALIMSKF-NHQNIVRLIGVSFER   81 (277)
T ss_pred             HHcEeeeECCCCCCCcEEEEEEecCCCCCCceeEEEEEcCCCCCHHHHHHHHHHHHHHHhC-CCCCEeeEEEEEccC
Confidence            468888999999999999998754            0             01     1455 688999999987643


No 193
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=94.47  E-value=0.055  Score=36.96  Aligned_cols=44  Identities=32%  Similarity=0.393  Sum_probs=33.8

Q ss_pred             cccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |+.++.||.|+||.|+.|.+...                     +     .-+.+ .|+|++.+++++..+
T Consensus         1 y~~~~~l~~g~~~~vy~~~~~~~~~~~~~K~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   70 (287)
T cd07840           1 YEKIAQIGEGTYGQVYKARNKKTGELVALKKIRMENEKEGFPITAIREIKLLQKL-RHPNIVRLKEIVTSK   70 (287)
T ss_pred             CeeeEEeccCCCeEEEEEEECCCCeEEEEEEEecccccccchHHHHHHHHHHHhc-cCCCeeeheeeEecC
Confidence            67788999999999999987641                     1     11445 489999999998765


No 194
>KOG0611|consensus
Probab=94.47  E-value=0.012  Score=48.57  Aligned_cols=48  Identities=19%  Similarity=0.379  Sum_probs=37.0

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEec-------------hhh--------------hhhccCcchheeEEEeEee
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPM-------------KKL--------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~-------------~~~--------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      -...-||+..+.||+|.||-|-.|++.             .+|              .-.-+ .|+|+|++|.+|=
T Consensus        49 hnlkHRyE~~etLGkGTYGKVk~A~e~~sgR~VAiKsIrKdkIkdeqDlvhIRREIeIMSsL-NHPhII~IyEVFE  123 (668)
T KOG0611|consen   49 HNLKHRYEITETLGKGTYGKVKLAYEHKSGREVAIKSIRKDKIKDEQDLVHIRREIEIMSSL-NHPHIIQIYEVFE  123 (668)
T ss_pred             cchhhHHHHHHHhcCCcccceeehhhccCCcEeehhhhhhhhcccHHHHHHHHHHHHHHhhc-CCCceeehhhhhc
Confidence            456789999999999999999999873             122              00234 7899999999874


No 195
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=94.47  E-value=0.049  Score=39.24  Aligned_cols=42  Identities=24%  Similarity=0.421  Sum_probs=30.1

Q ss_pred             cccCCCCCcceEEEEechh-------hhh--------------------hccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------LLQ--------------------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~~~--------------------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.++.+       ++.                    +.+..|+|++.+++.+....
T Consensus         1 ~~lg~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~~~~h~~iv~~~~~~~~~~   69 (320)
T cd05590           1 RVLGKGSFGKVMLARLKESGRLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLYCCFQTPD   69 (320)
T ss_pred             CeeeeCCCeEEEEEEEcCCCCEEEEEEEEHHHHhhccHHHHHHHHHHHHHhccCCCchhceeeEEEcCC
Confidence            4689999999999987532       110                    22336899999999886553


No 196
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=94.46  E-value=0.028  Score=39.08  Aligned_cols=45  Identities=22%  Similarity=0.239  Sum_probs=33.7

Q ss_pred             CCcccccccCCCCCcceEEEEech------------h-------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK------------K-------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~------------~-------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .+|+..+.||.|+||.|+.|.+..            |             +     +.+.+ .|+|++.+++++..
T Consensus         5 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~ei~~l~~l-~h~~iv~~~~~~~~   79 (288)
T cd05050           5 NNIEYVRDIGQGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEF-DHPNIVKLLGVCAV   79 (288)
T ss_pred             HhceecccccccccccEEEEEEcccCCCCcceeEEEEecCCCcCHHHHHHHHHHHHHHHhc-CCCchheEEEEEcC
Confidence            578889999999999999997632            0             1     11556 68999999987643


No 197
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=94.44  E-value=0.052  Score=36.78  Aligned_cols=44  Identities=16%  Similarity=0.308  Sum_probs=33.2

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ||+.++.||.|+||.++.|.+...                     +     ..+-+ .|+|++.+++.+..
T Consensus         1 ~y~~~~~lg~g~~g~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   70 (256)
T cd08218           1 KYVKVKKIGEGSFGKAILVKSKEDGKQYVIKEINISKMSPKEREESRKEVAVLSNM-KHPNIVQYQESFEE   70 (256)
T ss_pred             CceEEEEeccCCceEEEEEEEcCCCCEEEEEEEEhHhCChHHHHHHHHHHHHHHhC-CCCCeeeeEeeecC
Confidence            689999999999999999876421                     0     11344 57899999988754


No 198
>KOG0194|consensus
Probab=94.41  E-value=0.057  Score=43.62  Aligned_cols=55  Identities=20%  Similarity=0.245  Sum_probs=36.8

Q ss_pred             EEeecceEEEeC-CCcccccccCCCCCcceEEEEechh---------h----------------------hhhccCcchh
Q psy1710          15 AELVRGQTFEVG-PRYTNLAYIGEGAYGMVVSEAPMKK---------L----------------------LQKGAGTNEQ   62 (77)
Q Consensus        15 ~~~v~~~~f~V~-~RY~~lk~IG~GAYG~VcSA~D~~~---------~----------------------~~~~~~~~~~   62 (77)
                      ...+....|++. +.-...+.||+||||.||++.-+.+         +                      +.+-+ .|.|
T Consensus       144 ~~PI~r~~Wel~H~~v~l~kkLGeGaFGeV~~G~l~~~~~~~~~~VAvK~~k~~~~~~~~~~~e~m~EArvMr~l-~H~N  222 (474)
T KOG0194|consen  144 KRPIPRQKWELSHSDIELGKKLGEGAFGEVFKGKLKLKNGFKVVPVAVKTTKGSSELTKEQIKEFMKEARVMRQL-NHPN  222 (474)
T ss_pred             cccccccccEEeccCccccceeecccccEEEEEEEEecCCceeeeeEEEeecccccccHHHHHHHHHHHHHHHhC-CCCC
Confidence            334455567663 3345559999999999999742211         1                      22557 8999


Q ss_pred             eeEEEeEe
Q psy1710          63 LVLLYMWW   70 (77)
Q Consensus        63 ~~~~~~~~   70 (77)
                      ||.||-+-
T Consensus       223 VVr~yGVa  230 (474)
T KOG0194|consen  223 VVRFYGVA  230 (474)
T ss_pred             EEEEEEEE
Confidence            99999753


No 199
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=94.41  E-value=0.036  Score=38.46  Aligned_cols=47  Identities=17%  Similarity=0.325  Sum_probs=35.8

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-----h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-----L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-----~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ...|+.++.||.|.||.|+.|.|...     |                    ..+.+ .|+|++.+++.+...
T Consensus         3 ~~~y~~~~~lg~g~~~~vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   74 (277)
T cd06640           3 EELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQC-DSPYVTKYYGSYLKG   74 (277)
T ss_pred             HHhhhhhhhcccCCCeEEEEEEEccCCEEEEEEEEeccccHHHHHHHHHHHHHHHhC-CCCCEeeEEEEEEEC
Confidence            45789999999999999999987531     0                    01445 689999999987654


No 200
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=94.40  E-value=0.062  Score=37.47  Aligned_cols=46  Identities=28%  Similarity=0.327  Sum_probs=35.7

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h-------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L-------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~-------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||+|.+|.|+.|.|+.+       +                   ..+.+ .|+|++.+++.+...
T Consensus         2 ~~y~~~~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   73 (294)
T PLN00009          2 DQYEKVEKIGEGTYGVVYKARDRVTNETIALKKIRLEQEDEGVPSTAIREISLLKEM-QHGNIVRLQDVVHSE   73 (294)
T ss_pred             CceEEEEEecCCCCEEEEEEEecCCCcEEEEEehhhccccccchHHHHHHHHHHHhc-cCCCEeeEEEEEecC
Confidence            5799999999999999999987521       1                   11445 689999999988654


No 201
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=94.35  E-value=0.052  Score=37.23  Aligned_cols=45  Identities=20%  Similarity=0.317  Sum_probs=33.6

Q ss_pred             cccccccCCCCCcceEEEEechh-------hh------------------hhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK-------LL------------------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~-------~~------------------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |+.++.||+|.||.|+.|.+..+       .+                  .+.+..|+|++.+++.+..+
T Consensus         1 y~~~~~lg~g~~~~v~~~~~~~~~~~~aik~~~~~~~~~~~~~~~~e~~~l~~l~~h~~i~~~~~~~~~~   70 (282)
T cd07831           1 YKILGKIGEGTFSEVLKAQSRKTGKYYAIKCMKKHFKSLEQVNNLREIQALRRLSPHPNILRLIEVLFDR   70 (282)
T ss_pred             CceEeeccccccceEEEEEEcCCCcEEEEEEehhccCCchhhhHHHHHHHHhhcCCCCCccceEEEEecC
Confidence            66788999999999999986421       10                  13344589999999998765


No 202
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=94.34  E-value=0.041  Score=39.48  Aligned_cols=41  Identities=24%  Similarity=0.322  Sum_probs=30.0

Q ss_pred             cccCCCCCcceEEEEechh-------h---------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L---------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~---------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.|+.+       +                     +.+.+ .|+|+|.+++.+..+.
T Consensus         1 ~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~e~~~~~~~l-~hp~iv~~~~~~~~~~   69 (323)
T cd05575           1 KVIGKGSFGKVLLAKHKADGKFYAVKVLQKKAILKKKEQKHIMAERNVLLKNV-KHPFLVGLHYSFQTAD   69 (323)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHHhhhhHHHHHHHHHHHHHhhC-CCCCCCCeeEEEEeCC
Confidence            4689999999999987521       1                     11334 7899999999887654


No 203
>PTZ00284 protein kinase; Provisional
Probab=94.31  E-value=0.024  Score=43.27  Aligned_cols=24  Identities=33%  Similarity=0.589  Sum_probs=22.0

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      ..||+.++.||+|+||.|+.|.|.
T Consensus       128 ~~~y~i~~~lG~G~fg~V~~a~~~  151 (467)
T PTZ00284        128 TQRFKILSLLGEGTFGKVVEAWDR  151 (467)
T ss_pred             CCcEEEEEEEEeccCEEEEEEEEc
Confidence            578999999999999999999875


No 204
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=94.26  E-value=0.048  Score=38.08  Aligned_cols=22  Identities=27%  Similarity=0.454  Sum_probs=18.9

Q ss_pred             CcccccccCCCCCcceEEEEec
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      +|+..+.||+|.||.|+.|.+.
T Consensus         1 ~~~~~~~lg~g~~g~vy~~~~~   22 (290)
T cd05045           1 NLVLGKTLGEGEFGKVVKATAF   22 (290)
T ss_pred             CccccccccCcCCcceEEEEEe
Confidence            4777889999999999998764


No 205
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=94.25  E-value=0.081  Score=35.69  Aligned_cols=45  Identities=16%  Similarity=0.220  Sum_probs=34.7

Q ss_pred             CcccccccCCCCCcceEEEEechh-------h----------------h--hhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------L----------------L--QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~----------------~--~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .|+..+.||+|+||.|+.|.+...       +                +  -+.+ .|+|++.+++.+..+
T Consensus         2 ~~~~~~~i~~g~~~~v~~~~~~~~~~~~~vk~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   71 (264)
T cd06623           2 DLERVKVLGQGSSGVVYKVRHKPTGKIYALKKIHVDGDEEFRKQLLRELKTLRSC-ESPYVVKCYGAFYKE   71 (264)
T ss_pred             cceeeeeeeecCCeEEEEEEEcCCCcEEEEEEeccCcchHHHHHHHHHHHHHHhc-CCCCeeeEEEEEccC
Confidence            477889999999999999987641       1                0  0344 489999999998765


No 206
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=94.25  E-value=0.059  Score=43.85  Aligned_cols=46  Identities=20%  Similarity=0.217  Sum_probs=34.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------hh-----------h---------hccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------LL-----------Q---------KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~~-----------~---------~~~~~~~~~~~~~~~~~~   72 (77)
                      .++|..++.||+|+||.||.|.|...       ++           +         +.+ .|+|+|.+++.+..
T Consensus         3 ~~~y~i~~~LG~G~fg~Vy~a~~~~~~~~vAiKvi~~~~~~~~~~~~~~~~E~~~l~~l-~hp~Iv~~~~~~~~   75 (669)
T cd05610           3 IEEFVIVKPISRGAFGKVYLGRKKNNSKLYAVKVVKKADMINKNMVHQVQAERDALALS-KSPFIVHLYYSLQS   75 (669)
T ss_pred             cCCEEEEEEEecCCCeEEEEEEECCCCcEEEEEEEehhhccCHHHHHHHHHHHHHHHhc-CCCCcCeEEEEEEE
Confidence            36799999999999999999988611       00           0         333 68999999987654


No 207
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=94.22  E-value=0.053  Score=37.81  Aligned_cols=46  Identities=22%  Similarity=0.276  Sum_probs=35.9

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.|+..+.||.|.||.|+.|.+..+-                          ..+-+ .|+|++.+++.+..+
T Consensus         5 ~~y~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~h~ni~~~~~~~~~~   76 (293)
T cd07843           5 DEYEKLNRIEEGTYGVVYRARDKKTGEIVALKKLKMEKEKEGFPITSLREINILLKL-QHPNIVTVKEVVVGS   76 (293)
T ss_pred             hhhhhhhhhcCCCCeEEEEEEECCCCcEEEEEEEeeccccccchhhHHHHHHHHHhc-CCCCEEEEEEEEEec
Confidence            57999999999999999999875210                          01334 489999999998876


No 208
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=94.21  E-value=0.039  Score=37.56  Aligned_cols=46  Identities=11%  Similarity=0.170  Sum_probs=33.8

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h---------hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L---------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~---------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +|+..+.||+|+||.|+.|.|..+                     +         ..+.+ .|+|+|.+++.+..+.
T Consensus         1 ~~~~~~~lg~g~~~~v~~~~~~~~~~~~alk~~~~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~~   76 (268)
T cd06630           1 EWLKGQQLGTGAFSSCYQARDVKTGTLMAVKQVTYVRNTSSEQEEVVEALRKEIRLMARL-NHPHIIRMLGATCEDS   76 (268)
T ss_pred             CccccceecCcCceEEEEEEEcCCCcEEEEEEeecccCCchhHHHHHHHHHHHHHHHHHc-CCCceehhhceeccCC
Confidence            477788999999999999876321                     0         11445 6899999999876543


No 209
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=94.19  E-value=0.013  Score=40.55  Aligned_cols=47  Identities=17%  Similarity=0.323  Sum_probs=35.6

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.|+.++.||.|.||.||.|.|...       +                  ..+.+ .|+|++.+++.+...
T Consensus         3 ~~~y~~~~~l~~g~~~~vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   74 (277)
T cd06642           3 EELFTKLERIGKGSFGEVYKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQC-DSPYITRYYGSYLKG   74 (277)
T ss_pred             HHHHHHHHHhcCCCCeeEEEEEEcCCCeEEEEEEeccccchHHHHHHHHHHHHHHcC-CCCccHhhhcccccC
Confidence            35688999999999999999987421       1                  11455 589999999987654


No 210
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=94.18  E-value=0.053  Score=38.90  Aligned_cols=42  Identities=19%  Similarity=0.273  Sum_probs=30.5

Q ss_pred             cccCCCCCcceEEEEechh-------hhh--------------------hccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------LLQ--------------------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~~~--------------------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.++.+       ++.                    +.+..|+|++.+++.|..+.
T Consensus         1 ~~lG~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~il~~~~~hp~i~~~~~~~~~~~   69 (321)
T cd05591           1 KVLGKGSFGKVMLAELKGTDEVYAIKVLKKDVILQDDDVDCTMTEKRILALAAKHPFLTALHCCFQTKD   69 (321)
T ss_pred             CccccCCCeEEEEEEECCCCCEEEEEEEeHHHhhhhhHHHHHHHHHHHHHhccCCCCccceeeEEEcCC
Confidence            4699999999999977532       110                    22447899999999987653


No 211
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=94.13  E-value=0.052  Score=39.02  Aligned_cols=45  Identities=29%  Similarity=0.437  Sum_probs=34.2

Q ss_pred             CcccccccCCCCCcceEEEEechh----h------------------------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK----L------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~----~------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +|...+.||+|.||.|+.|.+...    .                        ..+.+..|+|++.+++.++.
T Consensus         1 ~y~~~~~lg~G~~g~vy~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~E~~~l~~l~~h~~iv~~~~~~~~   73 (332)
T cd07857           1 RYELIKELGQGAYGIVCSARNAETSEEETVAIKKITNVFSKKILAKRALRELKLLRHFRGHKNITCLYDMDIV   73 (332)
T ss_pred             CceEEEEccccCCeEEEEEEeCCCCcCceEEEEEeccccccchhHHHHHHHHHHHHHhcCCCChheeeeeeee
Confidence            588889999999999999987643    0                        01445568999999986553


No 212
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=94.10  E-value=0.058  Score=38.75  Aligned_cols=40  Identities=25%  Similarity=0.316  Sum_probs=29.2

Q ss_pred             cccCCCCCcceEEEEechh-------h---------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L---------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~---------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.++.+       +                     +.+.+ .|+|++.+++.+..+
T Consensus         1 ~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~~l~~~-~hp~iv~~~~~~~~~   68 (325)
T cd05604           1 KVIGKGSFGKVLLAKRKLDGKCYAVKVLQKKIVLNRKEQKHIMAERNVLLKNV-KHPFLVGLHYSFQTT   68 (325)
T ss_pred             CceeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHHhC-CCCCCccEEEEEecC
Confidence            4689999999999987521       1                     11334 689999999987654


No 213
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=94.09  E-value=0.07  Score=36.36  Aligned_cols=45  Identities=20%  Similarity=0.197  Sum_probs=33.7

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||+|+||.|+.|.+..+.                    ..+.+ .|+|++.+++.+..
T Consensus         6 ~~~~~~~~lg~g~~~~v~~~~~~~~~~~~k~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   70 (256)
T cd05082           6 KELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQL-RHSNLVQLLGVIVE   70 (256)
T ss_pred             HhCeeeeeecccCCCeEEEEEEcCCcEEEEEeCCCchHHHHHHHHHHHHhC-CCCCeeeEEEEEEc
Confidence            46888999999999999988654211                    11555 68999999987654


No 214
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=94.08  E-value=0.056  Score=41.75  Aligned_cols=45  Identities=9%  Similarity=0.026  Sum_probs=35.5

Q ss_pred             CcccccccCCCCCcceEEEEechh----h---------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK----L---------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~----~---------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|...+.||+|++|.|+.|.+..+    +                     +.+.+ .|+|+|.+++.+...
T Consensus        68 ~y~~~~~lg~G~~g~vy~a~~~~~~~~~vv~K~~~~~~~~~~~~~~~E~~~l~~l-~Hpniv~~~~~~~~~  137 (478)
T PTZ00267         68 MYVLTTLVGRNPTTAAFVATRGSDPKEKVVAKFVMLNDERQAAYARSELHCLAAC-DHFGIVKHFDDFKSD  137 (478)
T ss_pred             eEEEEEEEEeCCCcEEEEEEEcCCCCeEEEEEEcccCCHHHHHHHHHHHHHHHhC-CCCCEeEEEEEEEEC
Confidence            489999999999999999986543    1                     11455 689999999998754


No 215
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=94.07  E-value=0.047  Score=39.36  Aligned_cols=22  Identities=23%  Similarity=0.510  Sum_probs=19.3

Q ss_pred             CcccccccCCCCCcceEEEEec
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .|+..+.||+|+||.|+.|.++
T Consensus         1 ~f~~~~~lg~G~~g~Vy~~~~~   22 (323)
T cd05615           1 DFNFLMVLGKGSFGKVMLAERK   22 (323)
T ss_pred             CceEEEEEEecCCeEEEEEEEC
Confidence            3677899999999999999876


No 216
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=94.04  E-value=0.066  Score=37.15  Aligned_cols=46  Identities=15%  Similarity=0.135  Sum_probs=33.4

Q ss_pred             CCcccccccCCCCCcceEEEEec----h---h-----------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPM----K---K-----------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~----~---~-----------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.|+..+.||+|+||.|+.|.+.    .   +                 +     +-+.+ .|+|+|.+++.+...
T Consensus         5 ~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~   79 (283)
T cd05090           5 SAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDINNPQQWGEFQQEASLMAEL-HHPNIVCLLGVVTQE   79 (283)
T ss_pred             hhceeeeeccccCCcceEEEEEecCCCCCcceEEEEeccCCCCHHHHHHHHHHHHHHhhC-CCCCeeeEEEEEecC
Confidence            45778899999999999998731    0   0                 0     11556 689999999887654


No 217
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=94.00  E-value=0.044  Score=38.97  Aligned_cols=47  Identities=23%  Similarity=0.272  Sum_probs=34.8

Q ss_pred             CCCcccccccCCCCCcceEEEEech---------------------h----h-----hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK---------------------K----L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~---------------------~----~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .++|...+.||+|+||.|+.|.+..                     +    +     ..+.++.|+|++.+++.+..
T Consensus        34 ~~~~~~~~~ig~G~~g~V~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l~~h~~iv~~~~~~~~  110 (302)
T cd05055          34 RNNLSFGKTLGAGAFGKVVEATAYGLSKSDAVMKVAVKMLKPTAHSSEREALMSELKIMSHLGNHENIVNLLGACTI  110 (302)
T ss_pred             HHHeEEcceeeccCCeeEEEEEEecCCCCCceeEEEEEecCccCChHHHHHHHHHHHHHHhccCCCCcceEEEEEec
Confidence            3578889999999999999886410                     0    1     11566689999999987653


No 218
>KOG1290|consensus
Probab=94.00  E-value=0.057  Score=44.75  Aligned_cols=57  Identities=23%  Similarity=0.223  Sum_probs=42.3

Q ss_pred             CCceEEeecceEEEeCCCcccccccCCCCCcceEEEEech------------------------hhhh-------hccCc
Q psy1710          11 LAGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMK------------------------KLLQ-------KGAGT   59 (77)
Q Consensus        11 ~~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~------------------------~~~~-------~~~~~   59 (77)
                      ++|+.+.+.+. | ...||..+++||=|-|.+||.|+|+.                        +|||       .+. .
T Consensus        64 GGYHpV~IGD~-F-~~gRY~v~rKLGWGHFSTVWLawDtq~~r~VAlKVvKSAqhYtEaAlDEIklL~~v~~~Dp~~~-~  140 (590)
T KOG1290|consen   64 GGYHPVRIGDV-F-NGGRYHVQRKLGWGHFSTVWLAWDTQNKRYVALKVVKSAQHYTEAALDEIKLLQQVREGDPNDP-G  140 (590)
T ss_pred             CCCceeecccc-c-cCceEEEEEeccccccceeEEEeeccCCeEEEEEEEehhhHHHHHHHHHHHHHHHHHhcCCCCC-C
Confidence            55666665542 3 35799999999999999999999982                        3355       233 4


Q ss_pred             chheeEEEeEe
Q psy1710          60 NEQLVLLYMWW   70 (77)
Q Consensus        60 ~~~~~~~~~~~   70 (77)
                      .+-||+|+|-|
T Consensus       141 ~~~VV~LlD~F  151 (590)
T KOG1290|consen  141 KKCVVQLLDHF  151 (590)
T ss_pred             Cceeeeeeccc
Confidence            56799999977


No 219
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=94.00  E-value=0.082  Score=43.63  Aligned_cols=46  Identities=15%  Similarity=0.152  Sum_probs=34.3

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------------h--hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------------L--LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------------~--~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..+.....||+|+||.||.|.++..                   +  + +.+ .|+|+|.+++.+..+.
T Consensus       690 ~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~~~~~~~~~~~~l-~~l-~HpnIv~~~~~~~~~~  756 (968)
T PLN00113        690 SSLKEENVISRGKKGASYKGKSIKNGMQFVVKEINDVNSIPSSEIADM-GKL-QHPNIVKLIGLCRSEK  756 (968)
T ss_pred             hhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccCCccccHHHHHHH-hhC-CCCCcceEEEEEEcCC
Confidence            3456667899999999999986411                   0  1 334 7999999999987654


No 220
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=93.96  E-value=0.07  Score=38.11  Aligned_cols=39  Identities=23%  Similarity=0.336  Sum_probs=28.9

Q ss_pred             cCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          35 IGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        35 IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ||+|+||.|+.|.|..+-                           ..+.+ .|+|+|.+++.+..+.
T Consensus         1 lg~G~~g~Vy~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~~   66 (312)
T cd05585           1 IGKGSFGKVMQVRKRDTQRIYALKTIRKAHIVSRSEVTHTLAERTVLAQV-NCPFIVPLKFSFQSPE   66 (312)
T ss_pred             CCcCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhC-CCCcEeceeeEEecCC
Confidence            699999999999875210                           11445 6899999999887653


No 221
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=93.91  E-value=0.033  Score=38.00  Aligned_cols=46  Identities=17%  Similarity=0.291  Sum_probs=34.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------h-------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------L-------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------~-------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||.|+||.|+.|.+..+        +                   ..+.+ .|+|++.+++.+..+
T Consensus         2 ~~y~~~~~ig~g~~g~v~~~~~~~~~~~~~vK~~~~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~~   74 (267)
T cd08229           2 ANFRIEKKIGRGQFSEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQL-NHPNVIKYYASFIED   74 (267)
T ss_pred             chhhhhhhhcccCCeEEEEEeecCCCceEEEEeeeehhhhhHHHHHHHHHHHHHHHHc-cCCchhhhhheeEeC
Confidence            4689999999999999999986310        0                   11556 689999998887654


No 222
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=93.89  E-value=0.067  Score=37.55  Aligned_cols=46  Identities=22%  Similarity=0.387  Sum_probs=35.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|...+.||.|++|.||.|.+...                   +     ..+.+ .|+||+.+++.+..+
T Consensus        19 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~e~~~l~~~-~h~~vv~~~~~~~~~   88 (285)
T cd06648          19 SYLDNFVKIGEGSTGIVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDY-QHPNIVEMYSSYLVG   88 (285)
T ss_pred             HhhhcceEeccCCCeEEEEEEECCCCCEEEEEEEeccchhHHHHHHHHHHHHHHc-CCCChheEEEEEEcC
Confidence            4677889999999999999987521                   1     12445 689999999987654


No 223
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=93.88  E-value=0.061  Score=38.63  Aligned_cols=41  Identities=20%  Similarity=0.280  Sum_probs=30.0

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.++.+       +                    ..+.+..|+|++.+++++..+
T Consensus         1 ~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~il~~~~~h~~i~~~~~~~~~~   68 (318)
T cd05570           1 KVLGKGSFGKVLLAELKGTDELYAVKVLKKDVILQDDDVECTMTEKRVLALAGKHPFLTQLHSCFQTK   68 (318)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHHhhhhHHHHHHHHHHHHHhccCCCCccceeeEEEcC
Confidence            4689999999999977531       0                    113445799999999987654


No 224
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=93.86  E-value=0.035  Score=39.79  Aligned_cols=46  Identities=22%  Similarity=0.323  Sum_probs=34.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|..++.||+|+||.|+.|.|..+       +                    +.+.+ .|+|++.+++.|...
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   73 (350)
T cd05573           1 DDFEVIKVIGRGAFGEVWLVRDKDTGQVYAMKVLRKSDMIKRNQIAHVRAERDILADA-DSPWIVKLYYSFQDE   73 (350)
T ss_pred             CCceEEEEEEeCCcEEEEEEEECCCCCEEEEEEEEHHHHhhccHHHHHHHHHHHHHhc-CCCCccchhhheecC
Confidence            4799999999999999999988611       0                    11444 589999998877543


No 225
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=93.82  E-value=0.064  Score=37.54  Aligned_cols=46  Identities=17%  Similarity=0.234  Sum_probs=34.8

Q ss_pred             CCcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+.++.||.|+||.|+.|.+...-                           .-+.+ .|+|++.+++.+...
T Consensus         1 ~~y~~~~~ig~g~~~~vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   73 (290)
T cd05580           1 DDFEFIKTLGTGSFGRVMLVRHKGSGKYYALKILSKAKIVKLKQVEHVLNEKRILQSI-RHPFLVNLYGSFQDD   73 (290)
T ss_pred             CceEEEEEeecCCCeEEEEEEEcCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhC-CCCCccceeeEEEcC
Confidence            46899999999999999999875310                           11445 489999999987543


No 226
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=93.79  E-value=0.054  Score=37.18  Aligned_cols=47  Identities=21%  Similarity=0.198  Sum_probs=34.9

Q ss_pred             CCcccccccCCCCCcceEEEEechh------------h------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------------L------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------------~------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|..++.||+|+||.|+.|.+...            +                  ..+.+ .|+|++.+++.+....
T Consensus         5 ~~~~~~~~lg~g~~~~v~~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~~   81 (280)
T cd05049           5 DTIVLKRELGEGAFGKVFLGECYHLEPENDKELVAVKTLKETASNDARKDFEREAELLTNF-QHENIVKFYGVCTEGD   81 (280)
T ss_pred             HHhhHHhhccccCCceEeeeeeccccCcCCcceEEEEeecccCCHHHHHHHHHHHHHHHhc-CCCCchheeeEEecCC
Confidence            4688899999999999999875321            0                  01345 5889999999887653


No 227
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=93.76  E-value=0.084  Score=37.72  Aligned_cols=42  Identities=17%  Similarity=0.305  Sum_probs=29.7

Q ss_pred             ccccCCCCCcceEEEEech-----h-----h-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          32 LAYIGEGAYGMVVSEAPMK-----K-----L-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~D~~-----~-----~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ++.||+|+||.|+.+.+..     +     +                   +-+.+ .|+|++.+++.+..+.
T Consensus         1 l~~lg~G~~g~Vy~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~E~~~l~~l-~h~niv~~~~~~~~~~   71 (318)
T cd05582           1 LKVLGQGSFGKVFLVRKITGPDAGQLYAMKVLKKATLKVRDRVRTKMERDILAEV-NHPFIVKLHYAFQTEG   71 (318)
T ss_pred             CceeeeCCCEEEEEEEEeccCCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHhC-CCCCcccEEEEEEcCC
Confidence            4679999999999876521     0     0                   11445 5899999999887653


No 228
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=93.72  E-value=0.044  Score=38.71  Aligned_cols=45  Identities=18%  Similarity=0.273  Sum_probs=34.1

Q ss_pred             CCcccccccCCCCCcceEEEEech-------hh--------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK-------KL--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~-------~~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||.|.||.|+.|.+..       |.                    .-+.+ .|+|++.+++.+..
T Consensus         1 ~~y~~~~~ig~g~~g~vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   72 (316)
T cd05574           1 KHFKKIKLLGKGDVGRVFLVRLKGTGKLFALKVLDKKEMIKRNKVKRVLTEQEILATL-DHPFLPTLYASFQT   72 (316)
T ss_pred             CceEEeeeecCCccEEEEEEEEcCCCcEEEEEEEeccccchHHHHHHHHHHHHHHHhC-CCCCchhheeeeec
Confidence            479999999999999999998753       11                    01455 48899999887654


No 229
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=93.71  E-value=0.044  Score=38.69  Aligned_cols=45  Identities=13%  Similarity=0.189  Sum_probs=33.8

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||+|+||.|+.|.++.+       +                    .-+.+ .|+|++.+++.+..
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~E~~~l~~l-~hp~iv~~~~~~~~   72 (291)
T cd05612           1 DDLERIKTVGTGTFGRVHLVRDRISEHYYALKVMAIPEVIRLKQEQHVHNEKRVLKEV-SHPFIIRLFWTEHD   72 (291)
T ss_pred             CCceeeeeeecCCCeEEEEEEEcCCCCEEEEEEEEHHHHhhhHHHHHHHHHHHHHHhC-CCCcHhhhHhhhcc
Confidence            4789999999999999999987621       0                    01445 68899998876654


No 230
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=93.64  E-value=0.072  Score=38.10  Aligned_cols=40  Identities=25%  Similarity=0.326  Sum_probs=28.9

Q ss_pred             cccCCCCCcceEEEEechh-------h---------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L---------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~---------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.|...       +                     +.+.+ .|+|+|.+++.+..+
T Consensus         1 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~~l~~~-~h~~iv~~~~~~~~~   68 (321)
T cd05603           1 KVIGKGSFGKVLLAKRKSDGSFYAVKVLQKKTILKKKEQNHIMAERNVLLKNL-KHPFLVGLHYSFQTA   68 (321)
T ss_pred             CeeeeCCCEEEEEEEECCCCCEEEEEEEEHHHHHHhhHHHHHHHHHHHHHHhC-CCCCccceeeEEEcC
Confidence            4689999999999987421       1                     11334 689999999987654


No 231
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=93.64  E-value=0.097  Score=36.49  Aligned_cols=47  Identities=13%  Similarity=0.123  Sum_probs=32.4

Q ss_pred             Cccccccc--CCCCCcceEEEEechhh-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYI--GEGAYGMVVSEAPMKKL-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~I--G~GAYG~VcSA~D~~~~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .|...+.+  |.|+||.|+.+.++..-                   ..+-...|+|++.+++.+..+.
T Consensus        15 ~~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~k~~~~~~~~~~e~~~~~~~~~h~~iv~~~~~~~~~~   82 (267)
T PHA03390         15 NCEIVKKLKLIDGKFGKVSVLKHKPTQKLFVQKIIKAKNFNAIEPMVHQLMKDNPNFIKLYYSVTTLK   82 (267)
T ss_pred             hhccccceeecCCCceEEEEEEEcCCCcEEEEEEEehhhcchhhHHHHHHhhcCCCEEEEEEEEecCC
Confidence            45555555  99999999998875321                   1112336899999999987654


No 232
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=93.63  E-value=0.081  Score=36.23  Aligned_cols=46  Identities=22%  Similarity=0.200  Sum_probs=34.4

Q ss_pred             CCCcccccccCCCCCcceEEEEech------h-h---------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK------K-L---------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~------~-~---------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .++|+..+.||+|+||.|+.|.+..      | +               +.+.+ .|+|++.+++.+..
T Consensus         5 ~~~~~~~~~lg~g~~~~vy~~~~~~~~~~~iK~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   72 (260)
T cd05073           5 RESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTL-QHDKLVKLHAVVTK   72 (260)
T ss_pred             ccceeEEeEecCccceEEEEEEecCCccEEEEecCCChhHHHHHHHHHHHHHhc-CCCCcceEEEEEcC
Confidence            5789999999999999999987531      1 0               11445 68899999887654


No 233
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=93.62  E-value=0.074  Score=38.47  Aligned_cols=42  Identities=26%  Similarity=0.320  Sum_probs=30.0

Q ss_pred             cccCCCCCcceEEEEechh-------hh--------------h------hccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------LL--------------Q------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~~--------------~------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.+..+       ++              +      +.+..|+|+|.+++.+..+.
T Consensus         1 ~~lG~G~~g~V~~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~e~~il~~~~~hp~Iv~~~~~~~~~~   69 (329)
T cd05588           1 RVIGRGSYAKVLLVELKKTRRIYAMKVIKKELVNDDEDIDWVQTEKHVFETASNHPFLVGLHSCFQTES   69 (329)
T ss_pred             CeEeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhccCCCCCCceEEEEEcCC
Confidence            4689999999999986521       10              1      23346899999999886654


No 234
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=93.62  E-value=0.091  Score=36.05  Aligned_cols=40  Identities=18%  Similarity=0.247  Sum_probs=27.6

Q ss_pred             cccCCCCCcceEEEEechh----------------------hh-----hhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK----------------------LL-----QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~----------------------~~-----~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.....                      ++     .+.+ .|+|++.+++.+...
T Consensus         1 ~~lg~G~fg~v~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~e~~~~~~l-~h~nii~~~~~~~~~   67 (269)
T cd05042           1 DEIGNGWFGKVLLGEAHRGMSKARVVVKELRASATPDEQLLFLQEVQPYREL-NHPNVLQCLGQCIES   67 (269)
T ss_pred             CcCCccCCceEEEEEEecCCCCeEEEEeecCccCChHHHHHHHHHHHHHHhC-CCCCcceEEEEECCC
Confidence            3589999999998843210                      01     1445 699999999987643


No 235
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=93.60  E-value=0.11  Score=35.56  Aligned_cols=47  Identities=23%  Similarity=0.268  Sum_probs=34.5

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-----------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-----------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-----------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +..|...+.||+|+||.|+.|.+..+-                             ..+.+ .|+|++.+++.|..+
T Consensus         1 ~~~~~~~~~l~~g~~g~v~~~~~~~~~~~v~ik~~~~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~~   76 (265)
T cd06652           1 PTNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVNALECEIQLLKNL-LHERIVQYYGCLRDP   76 (265)
T ss_pred             CCcceEeeEEecCCceEEEEEEEcCCCcEEEEEEeecCcCCcccHHHHHHHHHHHHHHHhc-CCCCeeeEEeEeccC
Confidence            356888899999999999998764310                             01344 588999999987654


No 236
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=93.55  E-value=0.065  Score=36.81  Aligned_cols=44  Identities=23%  Similarity=0.215  Sum_probs=33.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh------h----------------------hhhccCcchheeEEEeEee
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------L----------------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------~----------------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      .+|...+.||.|+||.|+.|.+...      +                      +.+.+ .|+|++.+++.+-
T Consensus         6 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~v~ik~~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~   77 (270)
T cd05056           6 EDITLGRCIGEGQFGDVYQGVYMSPENEKIAVAVKTCKNCTSPSVREKFLQEAYIMRQF-DHPHIVKLIGVIT   77 (270)
T ss_pred             hhceeeeeeCCccceeEEEEEEecCCCCCcceEEEecCCcCCHHHHHHHHHHHHHHHhC-CCCchhceeEEEc
Confidence            4688889999999999999975321      0                      11455 6899999999754


No 237
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=93.55  E-value=0.049  Score=37.10  Aligned_cols=45  Identities=20%  Similarity=0.308  Sum_probs=34.0

Q ss_pred             CcccccccCCCCCcceEEEEechh-------h----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------L----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||...+.||+|+||.|+.|.+...       +                      ..+.+ .|+|++.+++.+..+
T Consensus         1 ~y~i~~~ig~g~~g~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   74 (260)
T cd08222           1 RYILQQRLGKGSFGTVYLVKDKKAVAEERLKVLKEIPVGELNPNETVQANQEAQLLSKL-DHPAIVKFHASFLER   74 (260)
T ss_pred             CceeeeeecCCCCceEEEEEecCCCCcceEEEeccccccccCcchHHHHHHHHHHHHhC-CCCcHHHHHHHHhcC
Confidence            799999999999999999877632       1                      11444 688999888876544


No 238
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=93.53  E-value=0.078  Score=38.09  Aligned_cols=41  Identities=22%  Similarity=0.331  Sum_probs=29.5

Q ss_pred             cccCCCCCcceEEEEechh-------h---------------h------hhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L---------------L------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~---------------~------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.|..+       +               +      .+.+ .|+|++.+++.+....
T Consensus         1 ~~lg~G~fg~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~~l~~~-~h~~Iv~~~~~~~~~~   69 (325)
T cd05602           1 KVIGKGSFGKVLLARHKAEEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNV-KHPFLVGLHFSFQTAD   69 (325)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHHHhhhHHHHHHHHHHHHHHhC-CCCCCCceeEEEEcCC
Confidence            4699999999999987521       1               0      1223 6899999999886543


No 239
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=93.49  E-value=0.1  Score=36.35  Aligned_cols=46  Identities=20%  Similarity=0.172  Sum_probs=33.2

Q ss_pred             CCcccccccCCCCCcceEEEEechh------------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|...+.||+|+||.|+.|.+...                        +     +.+.+ +|+|++.+++.+...
T Consensus         5 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   79 (280)
T cd05092           5 RDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTVL-QHQHIVRFYGVCTEG   79 (280)
T ss_pred             HhceeccccCCccCCeEEEeEEecCCCCCCceEEEEEecCcCCHHHHHHHHHHHHHHhcC-CCCCCceEEEEEecC
Confidence            4677889999999999998853210                        0     11445 789999999887653


No 240
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=93.49  E-value=0.081  Score=36.33  Aligned_cols=46  Identities=13%  Similarity=0.052  Sum_probs=34.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh----------h------------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK----------L------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~----------~------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|+..+.||+|+||.||+|.++..          +                  ..+.+ .|+|++.+++.+...
T Consensus         4 ~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~ni~~~~~~~~~~   77 (269)
T cd05065           4 SCVKIEEVIGAGEFGEVCRGRLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQF-DHPNIIHLEGVVTKS   77 (269)
T ss_pred             HHeEEEeEecCCCCCeEEEEEEecCCCCceeEEEEEcCCCCCHHHHHHHHHHHHHHHhC-CCcCcceEEEEECCC
Confidence            3577889999999999999876421          1                  11445 689999999987543


No 241
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=93.47  E-value=0.09  Score=35.63  Aligned_cols=39  Identities=26%  Similarity=0.259  Sum_probs=28.7

Q ss_pred             cccCCCCCcceEEEEech-------hh------------------hhhccCcchheeEEEeEeeC
Q psy1710          33 AYIGEGAYGMVVSEAPMK-------KL------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~-------~~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +.||+|+||.|++|.++.       |+                  +.+.+ .|+|++.+++++..
T Consensus         1 ~~lg~g~~g~vy~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   64 (252)
T cd05084           1 ERIGRGNFGEVFSGRLRADNTPVAVKSCRETLPPDLKAKFLQEARILKQY-SHPNIVRLIGVCTQ   64 (252)
T ss_pred             CccCcccCccEEEEEEecCCceEEEEecCccCCHHHHHHHHHHHHHHHhC-CCCCcceEEEEEcC
Confidence            368999999999998742       11                  11555 68999999998754


No 242
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=93.47  E-value=0.032  Score=39.63  Aligned_cols=46  Identities=33%  Similarity=0.471  Sum_probs=35.0

Q ss_pred             CcccccccCCCCCcceEEEEechh--h------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--L------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--~------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ||...+.||.|+||.|+.|.+...  .                        ..+.+ .|+||+.+++++..+.
T Consensus         1 ~y~i~~~ig~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~~   72 (330)
T cd07834           1 RYELLKPIGSGAYGVVCSAVDKRTGRKVAIKKISNVFDDLIDAKRILREIKLLRHL-RHENIIGLLDILRPPS   72 (330)
T ss_pred             CceeeeeecCCCCeEEEEEEeCCCCcEEEEEeeccccccchhhhhHHHHHHHHHhc-CCcchhhhhhhhcccC
Confidence            789999999999999999987531  1                        11444 5889999998877653


No 243
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=93.45  E-value=0.053  Score=36.56  Aligned_cols=45  Identities=20%  Similarity=0.369  Sum_probs=34.0

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+..+.||.|+||.|+.+.++..                     +     ..+.+ .|+|++.+++.+...
T Consensus         1 ~~~~~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~E~~~l~~~-~h~~i~~~~~~~~~~   71 (257)
T cd08225           1 RYEIIKKIGEGSFGKIYLAKAKSDSEHCVIKEIDLTKMPVKEKEASKKEVILLAKM-KHPNIVTFFASFQEN   71 (257)
T ss_pred             CceEEEEecCCCcceEEEEEEcCCCceEEEEEeeHhhccchhhHHHHHHHHHHHhC-CCCChhhhhheeccC
Confidence            688899999999999999887531                     0     01455 588999999887543


No 244
>KOG0581|consensus
Probab=93.42  E-value=0.12  Score=40.87  Aligned_cols=46  Identities=22%  Similarity=0.283  Sum_probs=37.2

Q ss_pred             CcccccccCCCCCcceEEEEec--hhh------------------hh-----hccCcchheeEEEeEeeCCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM--KKL------------------LQ-----KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~--~~~------------------~~-----~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .-+.+..||+|+.|+|++|.++  .+|                  ++     +.. +++++|.-|..|-++-
T Consensus        80 dle~~~~lG~G~gG~V~kv~Hk~t~~i~AlK~I~~~~~~~~~~Qi~rEl~il~~~-~spyIV~~ygaF~~~~  150 (364)
T KOG0581|consen   80 DLERLGVLGSGNGGTVYKVRHKPTGKIYALKVILLNIDPALQKQILRELEILRSC-QSPYIVGFYGAFYSNG  150 (364)
T ss_pred             HhhhhhhcccCCCcEEEEEEEcCCCeEEEEEeecccCCHHHHHHHHHHHHHHhhC-CCCCeeeEeEEEEeCC
Confidence            4677899999999999999988  222                  11     556 9999999999998875


No 245
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=93.40  E-value=0.088  Score=37.94  Aligned_cols=41  Identities=22%  Similarity=0.271  Sum_probs=30.0

Q ss_pred             cccCCCCCcceEEEEechh-------hhh--------------------hccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------LLQ--------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~~~--------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.++.+       ++.                    +.+..|+|++.+++.+..+
T Consensus         1 ~~lG~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~e~~~l~~~~~hp~iv~~~~~~~~~   68 (316)
T cd05619           1 KMLGKGSFGKVFLAELKGTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHLYCTFQTK   68 (316)
T ss_pred             CeeeeCCCEEEEEEEECCCCCEEEEEEEEHHHhhhcchHHHHHHHHHHHHhccCCCcCcceEEEEEeC
Confidence            4689999999999987532       110                    2245899999999987654


No 246
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=93.36  E-value=0.091  Score=37.67  Aligned_cols=43  Identities=19%  Similarity=0.077  Sum_probs=31.1

Q ss_pred             cccccCCC--CCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          31 NLAYIGEG--AYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        31 ~lk~IG~G--AYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+..||+|  +++.|+.|.++.+=                          +.+.+ .|+|+|.+++.|..+.
T Consensus         2 ~~~~ig~G~~~~~~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~l~~l-~hpniv~~~~~~~~~~   72 (327)
T cd08227           2 LLTVIGRGFEDLMTVNLARYKPTGEYVTVRRINLEACTNEMVTFLQGELHVSKLF-NHPNIVPYRATFIADN   72 (327)
T ss_pred             hhhhccccccceEEEEEEeecccCcEEEEEEechhhccHHHHHHHHHHHHHHHhc-CCCCeeeEEEEEEECC
Confidence            46789999  56789888775210                          11456 7999999999987654


No 247
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=93.34  E-value=0.1  Score=36.16  Aligned_cols=44  Identities=18%  Similarity=0.374  Sum_probs=32.0

Q ss_pred             CcccccccCCCCCcceEEEEechh-------h------------h------hhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------L------------L------QKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~------------~------~~~~~~~~~~~~~~~~~~~   72 (77)
                      -|..++.||.|+||.|+.|.+...       +            +      .+.+ .|+|++.+++.+..
T Consensus         5 ~~~~~~~ig~G~~~~vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~   73 (277)
T cd06641           5 LFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQC-DSPYVTKYYGSYLK   73 (277)
T ss_pred             hhhhheeEeecCCeEEEEEEECCCCcEEEEEEeccccchHHHHHHHHHHHHHHhc-CCCCEeEEEEEEEe
Confidence            477888999999999999976421       0            0      0334 57899999988764


No 248
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=93.25  E-value=0.097  Score=35.97  Aligned_cols=45  Identities=27%  Similarity=0.462  Sum_probs=32.7

Q ss_pred             CcccccccCCCCCcceEEEEech-------hh------------hh------hcc--CcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK-------KL------------LQ------KGA--GTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~-------~~------------~~------~~~--~~~~~~~~~~~~~~~   72 (77)
                      -|+.++.||.|+||.|+.|.+..       |.            .+      +-+  ..|+|++.+++.+..
T Consensus         2 ~y~~~~~l~~g~~g~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~l~~l~~~~~~~vi~~~~~~~~   73 (277)
T cd06917           2 LYQRLELIGRGAYGAVYRGKHVPTGRVVALKIINLDTPDDDVSDIQREVALLSQLRQSQPPNITKYYGSYLK   73 (277)
T ss_pred             hhhhhhheeccCCceEEEEEEcCCCcEEEEEEecCCCCchhHHHHHHHHHHHHHhccCCCCCeeeEeeeeee
Confidence            47889999999999999998742       10            00      122  258999999997764


No 249
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=93.23  E-value=0.11  Score=37.49  Aligned_cols=41  Identities=27%  Similarity=0.300  Sum_probs=29.7

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.+...       +                    +-+.+..|+|++.+++.+...
T Consensus         1 ~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~i~~~~~~~~~~   68 (327)
T cd05617           1 RVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTT   68 (327)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhhcCCCCEeeEEEEEEeC
Confidence            4699999999999876421       0                    113455789999999987654


No 250
>KOG0589|consensus
Probab=93.21  E-value=0.037  Score=44.26  Aligned_cols=46  Identities=22%  Similarity=0.236  Sum_probs=34.5

Q ss_pred             CCCcccccccCCCCCcceEEEEec---------------------------hhhhhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM---------------------------KKLLQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~---------------------------~~~~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .++|..++.+|+||||.+....++                           ..|++| + .|+|+|.-+|-|+--
T Consensus         3 m~~Ye~~~~iG~GafG~a~lvrhk~~~~~~vlK~I~l~~~t~~~r~~A~~E~~lis~-~-~hP~iv~y~ds~~~~   75 (426)
T KOG0589|consen    3 MDNYEVLRQVGRGAFGSALLVRHKSDDKLYVLKKINLEKLTEPERRSAIQEMDLLSK-L-LHPNIVEYKDSFEED   75 (426)
T ss_pred             cchhhhhhhcCccccchhhhhhhccCCceEEEEEEeccccCchhhHHHHHHHHHHHh-c-cCCCeeeeccchhcC
Confidence            468999999999999988554322                           112446 6 899999999998743


No 251
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=93.19  E-value=0.12  Score=35.72  Aligned_cols=40  Identities=23%  Similarity=0.294  Sum_probs=29.2

Q ss_pred             ccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          34 YIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        34 ~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .||+|+||.|+.|.++.+       +                    .-+.++.|+|++.++|.+..-
T Consensus         2 ~lg~g~~g~v~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~E~~~l~~l~~h~~iv~~~~~~~~~   68 (270)
T cd05047           2 VIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHR   68 (270)
T ss_pred             cCCCCCCceEEEEEEcCCCCeeEEEEEEccccCCHHHHHHHHHHHHHHHhhccCCCeeeEEEEEecC
Confidence            589999999999875421       0                    014566799999999987653


No 252
>KOG0658|consensus
Probab=93.06  E-value=0.084  Score=41.73  Aligned_cols=44  Identities=25%  Similarity=0.496  Sum_probs=33.9

Q ss_pred             CcccccccCCCCCcceEEEEechh--------hhh------------hccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------LLQ------------KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------~~~------------~~~~~~~~~~~~~~~~~~   72 (77)
                      +|...+.+|.|+||.|+.|....+        .+|            +-+ .|.|+|.|-..|-+
T Consensus        25 ~~~~~~liG~GsFg~Vyq~~~~e~~~~vAIKKv~~d~r~knrEl~im~~l-~HpNIV~L~~~f~~   88 (364)
T KOG0658|consen   25 SYEAVRLIGSGSFGVVYQAKLRETEEEVAIKKVLQDKRYKNRELQIMRKL-DHPNIVRLLYFFSS   88 (364)
T ss_pred             EEEeeEEEeecccceEEEEEEcCCCceeEEEEecCCCCcCcHHHHHHHhc-CCcCeeeEEEEEEe
Confidence            688899999999999999986644        122            333 78999999776654


No 253
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=93.03  E-value=0.16  Score=35.00  Aligned_cols=41  Identities=20%  Similarity=0.165  Sum_probs=28.4

Q ss_pred             cccCCCCCcceEEEEechh----------h-----------------hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK----------L-----------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~----------~-----------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||+|+||.|+.|.+...          +                 .-+.+ .|+|+|.+++.+..+.
T Consensus         1 ~~lg~G~~g~Vy~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~~   68 (269)
T cd05087           1 KEIGNGWFGKVILGEVNSGYTPAQVVVKELRVSASVQEQMKFLEEAQPYRSL-QHSNLLQCLGQCTEVT   68 (269)
T ss_pred             CcccccCCceEEEEEEcCCCCceEEEEEecCCCCChHHHHHHHHHHHHHHhC-CCCCEeeEEEEEcCCC
Confidence            4689999999999853211          0                 11445 5899999998876554


No 254
>PRK09188 serine/threonine protein kinase; Provisional
Probab=93.01  E-value=0.061  Score=41.64  Aligned_cols=26  Identities=12%  Similarity=0.184  Sum_probs=23.1

Q ss_pred             EeCCCcccccccCCCCCcceEEEEec
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .+..+|...+.||+|+||.|+.|+++
T Consensus        15 ~~~~~Y~~~~~IG~G~fg~Vy~a~~~   40 (365)
T PRK09188         15 ALSARFVETAVLKRDVFSTVERGYFA   40 (365)
T ss_pred             cccCCceEccEEeecCcEEEEEEEEc
Confidence            45788999999999999999999864


No 255
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=92.98  E-value=0.18  Score=34.07  Aligned_cols=45  Identities=18%  Similarity=0.265  Sum_probs=33.2

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+..+.||.|+||.|+.|.+...       .                  ..+.+ .|+|++.+++.+..
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   70 (267)
T cd06610           1 DDYELIEVIGVGATAVVYAAICLPNNEKVAIKRIDLEKCQTSVDELRKEVQAMSQC-NHPNVVKYYTSFVV   70 (267)
T ss_pred             CcceeeeeecCCCCeEEEEEEEcCCCcEEEEEEeccCCcchHHHHHHHHHHHHHhc-CCCCEEEEEEEEee
Confidence            4688999999999999999975421       0                  11345 68999999887654


No 256
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=92.94  E-value=0.099  Score=36.37  Aligned_cols=45  Identities=24%  Similarity=0.330  Sum_probs=32.5

Q ss_pred             CcccccccCCCCCcceEEEEech----------hh---------------------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK----------KL---------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~----------~~---------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .|+..+.||.|+||.|+.|.+..          |+                     +.+.+..|.|++.+++.+-.
T Consensus         1 ~y~~~~~lg~G~~g~v~~~~~~~~~~~g~~~aiK~~~~~~~~~~~~~~~~~~~e~~~l~~l~~~~~i~~~~~~~~~   76 (290)
T cd05613           1 NFELLKVLGTGAYGKVFLVRKVSGHDSGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQT   76 (290)
T ss_pred             CceeeeeeccCCcceEEEEEeccCCCCCceEEEEEeehhhhhhcchHHHHHHHHHHHHHhcccCCChhceeeEeec
Confidence            37788999999999999987631          00                     11445568999999887643


No 257
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=92.91  E-value=0.17  Score=35.29  Aligned_cols=39  Identities=23%  Similarity=0.321  Sum_probs=28.6

Q ss_pred             cCCCCCcceEEEEechh--------h-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          35 IGEGAYGMVVSEAPMKK--------L-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        35 IG~GAYG~VcSA~D~~~--------~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ||+|+||.||.|.++.+        +                   +.+.+ .|+|++.+++.+....
T Consensus         1 lg~G~~g~Vy~~~~~~~~~~~a~K~~~~~~~~~~~~~~~~~~E~~il~~l-~hp~i~~~~~~~~~~~   66 (277)
T cd05607           1 LGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKSGEKMALLEKEILEKV-NSPFIVNLAYAFESKT   66 (277)
T ss_pred             CCCCCceEEEEEEEccCCcEEEEEEEcHHHhhcchhhHHHHHHHHHHHhc-CCCcEEEEEEEEecCC
Confidence            68999999998876421        0                   12556 6899999999887654


No 258
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=92.87  E-value=0.093  Score=37.76  Aligned_cols=41  Identities=22%  Similarity=0.367  Sum_probs=29.2

Q ss_pred             ccccCCCCCcceEEEEech----------hh---------------------hhhccCcchheeEEEeEeeCC
Q psy1710          32 LAYIGEGAYGMVVSEAPMK----------KL---------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~D~~----------~~---------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++.||+|+||.|+.|.+..          |+                     .-+.+ .|+|++.++++|...
T Consensus         1 ~~~lg~G~~g~V~~~~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~~E~~il~~l-~hp~iv~~~~~~~~~   72 (323)
T cd05584           1 LKVLGKGGYGKVFQVRKVTGADTGKIFAMKVLKKATIVRNQKDTAHTKAERNILEAV-KHPFIVDLIYAFQTG   72 (323)
T ss_pred             CceeeecCCeEEEEEEEcccCCCCCEEEEEEEEHHHHHhhhhhHHHHHHHHHHHHhC-CCCchhceeeEEecC
Confidence            4679999999999987521          00                     11445 689999999887643


No 259
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=92.86  E-value=0.09  Score=36.07  Aligned_cols=41  Identities=17%  Similarity=0.325  Sum_probs=29.5

Q ss_pred             cccCCCCCcceEEEEech--------------hh-----------------hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMK--------------KL-----------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~--------------~~-----------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||.|+||.|+.|.+..              |+                 +.+.+ .|+|+|.+++.+..+.
T Consensus         1 ~~lg~G~~~~Vy~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~~-~h~~iv~~~~~~~~~~   72 (258)
T cd05078           1 ESLGQGTFTKIFKGIRREVGDYGELHKTEVLLKVLDKSHRNYSESFFEAASMMSQL-SHKHLVLNYGVCVCGD   72 (258)
T ss_pred             CCCCcccchhheeeeecccccccccccchhhHHhhcchhHHHHHHHHHHHHHHHhC-CCCChhheeeEEEeCC
Confidence            368999999999997632              11                 11344 6899999999987653


No 260
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=92.83  E-value=0.12  Score=37.21  Aligned_cols=40  Identities=15%  Similarity=0.286  Sum_probs=28.5

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.++.+       +                    +-+.+ .|+|++.+++.+...
T Consensus         1 ~~lG~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~e~~~l~~l-~hp~i~~~~~~~~~~   67 (323)
T cd05571           1 KLLGKGTFGKVILVREKATGKYYAMKILKKEVIIAKDEVAHTLTESRVLQNT-RHPFLTALKYSFQTH   67 (323)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhhHHHHHHHHHHHHHHhC-CCCCCCCEEEEEEcC
Confidence            4689999999999987521       0                    01344 688999998877544


No 261
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=92.80  E-value=0.062  Score=37.71  Aligned_cols=56  Identities=25%  Similarity=0.329  Sum_probs=38.3

Q ss_pred             ecceEEEe-CCCcccccccCCCCCcceEEEEech--hh------------------hh-----hccCcchheeEEEeEee
Q psy1710          18 VRGQTFEV-GPRYTNLAYIGEGAYGMVVSEAPMK--KL------------------LQ-----KGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        18 v~~~~f~V-~~RY~~lk~IG~GAYG~VcSA~D~~--~~------------------~~-----~~~~~~~~~~~~~~~~~   71 (77)
                      +++..|.+ .+.|...+.||+|+||.|+.|.+..  +.                  +.     .....|+|++.+++.+.
T Consensus         5 ~~~~~~~~~~~~~~~~~~lg~g~~~~v~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~e~~~~~~~~~~~~i~~~~~~~~   84 (296)
T cd06618           5 IDGQKYPADLNDLENLGEIGSGTCGQVYKMRFKKTGHVMAVKQMRRTGNKEENKRILMDLDVVLKSHDCPYIVKCYGYFI   84 (296)
T ss_pred             ecceeccCCcchheeeeEeeccCCeEEEEEEECCCCeEEEEEEEeccCChHHHHHHHHHHHHHHhccCCCchHhhheeee
Confidence            34444433 4668999999999999999998762  11                  00     23335899999999876


Q ss_pred             CC
Q psy1710          72 SP   73 (77)
Q Consensus        72 ~~   73 (77)
                      ..
T Consensus        85 ~~   86 (296)
T cd06618          85 TD   86 (296)
T ss_pred             cC
Confidence            54


No 262
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=92.80  E-value=0.073  Score=36.24  Aligned_cols=45  Identities=22%  Similarity=0.248  Sum_probs=33.5

Q ss_pred             CCcccccccCCCCCcceEEEEechhh--------------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .+|+..+.||.|+||.|+.+....+.                    ..+.+ .|+|++.+++.+..
T Consensus         6 ~~~~~~~~lg~g~~g~v~~~~~~~~~~~iK~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~   70 (254)
T cd05083           6 QKLTLGEIIGEGEFGAVLQGEYTGQKVAVKNIKCDVTAQAFLEETAVMTKL-HHKNLVRLLGVILH   70 (254)
T ss_pred             HHceeeeeeccCCCCceEecccCCCceEEEeecCcchHHHHHHHHHHHHhC-CCCCcCeEEEEEcC
Confidence            46888899999999999886533211                    11556 78999999998754


No 263
>KOG0197|consensus
Probab=92.72  E-value=0.084  Score=42.82  Aligned_cols=50  Identities=24%  Similarity=0.280  Sum_probs=37.0

Q ss_pred             eEEEeCCCc-ccccccCCCCCcceEEEEechh----h-------------hh-----hccCcchheeEEEeEee
Q psy1710          21 QTFEVGPRY-TNLAYIGEGAYGMVVSEAPMKK----L-------------LQ-----KGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        21 ~~f~V~~RY-~~lk~IG~GAYG~VcSA~D~~~----~-------------~~-----~~~~~~~~~~~~~~~~~   71 (77)
                      ..|+++.+. ..++.||+|-||.|+.+.-..+    +             ++     |-+ +|+|+|+||-|.-
T Consensus       199 d~wei~r~~l~l~~~LG~G~FG~V~~g~~~~~~~vavk~ik~~~m~~~~f~~Ea~iMk~L-~H~~lV~l~gV~~  271 (468)
T KOG0197|consen  199 DPWEIPREELKLIRELGSGQFGEVWLGKWNGSTKVAVKTIKEGSMSPEAFLREAQIMKKL-RHEKLVKLYGVCT  271 (468)
T ss_pred             CCeeecHHHHHHHHHhcCCccceEEEEEEcCCCcccceEEeccccChhHHHHHHHHHHhC-cccCeEEEEEEEe
Confidence            357776554 6789999999999999853322    1             21     667 8999999998764


No 264
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=92.71  E-value=0.12  Score=35.84  Aligned_cols=41  Identities=27%  Similarity=0.438  Sum_probs=30.2

Q ss_pred             cccccCCCCCcceEEEEech-------hh-----------------hh-----hccCcchheeEEEeEeeC
Q psy1710          31 NLAYIGEGAYGMVVSEAPMK-------KL-----------------LQ-----KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        31 ~lk~IG~GAYG~VcSA~D~~-------~~-----------------~~-----~~~~~~~~~~~~~~~~~~   72 (77)
                      ..+.||.|+||.|+.|....       ++                 +.     +-+ .|+|+++++.+++.
T Consensus         3 ~~~~ig~G~fg~v~~~~~~~~~~~~~~~V~vk~~~~~~~~~~~~~~~~e~~~l~~l-~h~ni~~~~g~~~~   72 (259)
T PF07714_consen    3 LIKQIGEGSFGKVYRAEWKQKDNDKNQPVAVKILKPSSSEEEEEEFLNEIQILRKL-RHPNIVKLYGFCIE   72 (259)
T ss_dssp             EEEEEEEESSEEEEEEEEESTTTSSEEEEEEEEESTTSSHHHHHHHHHHHHHHHTH-SBTTBE-EEEEEES
T ss_pred             EeeEEccCCCcEEEEEEEEcccCCCCEEEEEEEeccccccccceeeeecccccccc-cccccccccccccc
Confidence            45789999999999987661       00                 00     456 89999999999983


No 265
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=92.69  E-value=0.18  Score=33.74  Aligned_cols=43  Identities=21%  Similarity=0.164  Sum_probs=32.3

Q ss_pred             ccccccCCCCCcceEEEEech------hh-----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          30 TNLAYIGEGAYGMVVSEAPMK------KL-----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        30 ~~lk~IG~GAYG~VcSA~D~~------~~-----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +..+.||.|.||.|+.|.+..      ..                       ..+.+ .|+|++.+++++...
T Consensus         2 ~~~~~lg~g~~g~v~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   73 (258)
T smart00219        2 TLGKKLGEGAFGEVYKGTLKGLSGEKEVEVAVKTLKEDADEQQIEEFLREARIMRKL-DHPNIVKLLGVCTEE   73 (258)
T ss_pred             cccceeccCCCcceEEEEecCCCCCCCceEEEEEccCCCChHHHHHHHHHHHHHHhc-CCCchheEEEEEcCC
Confidence            456789999999999997753      10                       11456 789999999988764


No 266
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=92.58  E-value=0.15  Score=34.07  Aligned_cols=39  Identities=28%  Similarity=0.315  Sum_probs=30.0

Q ss_pred             cccCCCCCcceEEEEechh----------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK----------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~----------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +.||+|+||.|+.|.+...          +                  ..+.+. |+|++.+++++..
T Consensus         1 ~~ig~g~~g~v~~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~~~-~~~i~~~~~~~~~   67 (262)
T cd00192           1 KKLGEGAFGEVYKGKLKGKDGKTTEVAVKTLKEDASEEERKDFLKEARVMKKLG-HPNVVRLLGVCTE   67 (262)
T ss_pred             CccccCCceEEEEEEEecCCCCCceEEeEeeccccchhHHHHHHHHHHHHhhcC-CCChheeeeeecC
Confidence            4689999999999988642          0                  115564 9999999998875


No 267
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=92.38  E-value=0.15  Score=34.93  Aligned_cols=40  Identities=18%  Similarity=0.250  Sum_probs=29.7

Q ss_pred             cccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..||+|+||.|++|.|...-                        ..+.+ .|+|++.+++.+...
T Consensus        14 ~~lg~g~~g~v~~~~~~~~~~~v~~k~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~   77 (268)
T cd06624          14 VVLGKGTYGIVYAARDLSTQVRIAIKEIPERDSRYVQPLHEEIALHSYL-KHRNIVQYLGSDSEN   77 (268)
T ss_pred             EEEecCCceEEEEeEecCCCcEEEEEEecCCCHHHHHHHHHHHHHHHhc-CCCCeeeeeeeeccC
Confidence            46999999999999865310                        11455 789999999887654


No 268
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=92.36  E-value=0.19  Score=34.99  Aligned_cols=44  Identities=16%  Similarity=0.173  Sum_probs=31.9

Q ss_pred             cccccccCCCCCcceEEEEech-------hh----------------------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK-------KL----------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~-------~~----------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |+.++.||+|+||.|+.|....       .+                      ..+.+ .|+|++.+++.+...
T Consensus         6 ~~~~~~lg~g~~g~v~~~~~~~~~~~~~~~va~K~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   78 (284)
T cd05079           6 LKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNL-YHENIVKYKGICTED   78 (284)
T ss_pred             hhhceecCCCCceeEEEEEEccCCCCccceEEEEEcCccccHHHHHHHHHHHHHHHhC-CCCCeeeeeeEEecC
Confidence            6889999999999999885210       00                      11445 689999999887654


No 269
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=92.35  E-value=0.18  Score=36.23  Aligned_cols=40  Identities=20%  Similarity=0.267  Sum_probs=28.5

Q ss_pred             cCCCCCcceEEEEechh-------------h---------------hh-hccCcchheeEEEeEeeCCC
Q psy1710          35 IGEGAYGMVVSEAPMKK-------------L---------------LQ-KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        35 IG~GAYG~VcSA~D~~~-------------~---------------~~-~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ||+|+||.|+.|.|+.+             +               ++ ..++.|+|++.++++|..+.
T Consensus         1 lG~G~~g~Vy~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~~p~i~~~~~~~~~~~   69 (330)
T cd05586           1 IGKGTFGQVYQVRKKDTRRIYAMKVLSKKEIVAKKEVAHTIGERNILVRTLLDESPFIVGLKFSFQTDS   69 (330)
T ss_pred             CCCCCceEEEEEEECCCCCEEEEEEEeHHHHhhhhHHHHHHHHHHHHHHhccCCCCcCcceEEEEecCC
Confidence            79999999999987521             1               11 12347899999999886553


No 270
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=92.35  E-value=0.14  Score=36.86  Aligned_cols=40  Identities=15%  Similarity=0.283  Sum_probs=28.9

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.|+..       +                    +-+.+ .|+|++.+++.|...
T Consensus         1 ~~lG~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~E~~~l~~l-~hp~i~~~~~~~~~~   67 (323)
T cd05595           1 KLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNT-RHPFLTALKYAFQTH   67 (323)
T ss_pred             CeeeeCCCEEEEEEEECCCCCEEEEEEEEHHHhhhhHHHHHHHHHHHHHHhC-CCCCCcceeeEEecC
Confidence            4689999999999987521       0                    11334 688999999887654


No 271
>KOG0201|consensus
Probab=92.26  E-value=0.071  Score=43.29  Aligned_cols=26  Identities=35%  Similarity=0.492  Sum_probs=23.0

Q ss_pred             eCCCcccccccCCCCCcceEEEEech
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      ....|..+..||+|+||.|++|+|..
T Consensus        11 ~~~~~~~~~~IgrGsfG~Vyk~~d~~   36 (467)
T KOG0201|consen   11 PELLYTKLELIGRGSFGEVYKAIDNK   36 (467)
T ss_pred             cccccccchhccccccceeeeeeecc
Confidence            45679999999999999999999874


No 272
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=92.25  E-value=0.088  Score=37.44  Aligned_cols=49  Identities=12%  Similarity=0.277  Sum_probs=36.4

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh--------h-------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK--------L-------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~--------~-------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ...+|..++.||.|+||.|+.|.++..        +                   +.+.+ .|+|++.+++.++.+.
T Consensus        13 ~~~~~~~~~~lg~g~~g~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   88 (308)
T cd06634          13 PEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKL-RHPNTIQYRGCYLREH   88 (308)
T ss_pred             cHHHHHHHHheeeCCCEEEEEEEEcCCCcEEEEEEEecccccChHHHHHHHHHHHHHHhC-CCCCcccEEEEEEcCC
Confidence            456788999999999999999987421        0                   11445 5889999998877653


No 273
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=92.23  E-value=0.093  Score=36.92  Aligned_cols=22  Identities=18%  Similarity=0.439  Sum_probs=19.1

Q ss_pred             CcccccccCCCCCcceEEEEec
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      +|+..+.||+|+||.|+.|.+.
T Consensus         1 ~f~~~~~ig~G~~g~v~~~~~~   22 (285)
T cd05630           1 TFRQYRVLGKGGFGEVCACQVR   22 (285)
T ss_pred             CceeeEEeecCCCeEEEEEEEc
Confidence            3778889999999999998875


No 274
>KOG4250|consensus
Probab=92.18  E-value=0.052  Score=46.12  Aligned_cols=38  Identities=21%  Similarity=0.254  Sum_probs=29.2

Q ss_pred             cccccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeE
Q psy1710          31 NLAYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMW   69 (77)
Q Consensus        31 ~lk~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~   69 (77)
                      .-+.||+||||.||.++++++=                         .-|-+ .|+|+|+++|+
T Consensus        17 ~~e~LG~Ga~g~V~rgrnketG~~vAvK~~~~~~~~r~~e~~~~EieilkKL-nh~NIVk~f~i   79 (732)
T KOG4250|consen   17 MDERLGKGAFGNVYRGRNKETGRLVAVKTFNKESSLRPRERWCREIEILKKL-NHPNIVKLFDI   79 (732)
T ss_pred             ehhhhcCCccceeeeecccccccchhHHhhhhhcccchHHHHHHHHHHHHHc-Cchhhhhhccc
Confidence            3467999999999999977321                         11667 49999999985


No 275
>KOG0193|consensus
Probab=92.18  E-value=0.082  Score=44.57  Aligned_cols=58  Identities=24%  Similarity=0.337  Sum_probs=39.3

Q ss_pred             cceEEEeCC-CcccccccCCCCCcceEEEEechhh--------------hh---------hccCcchheeEEEeEeeCCC
Q psy1710          19 RGQTFEVGP-RYTNLAYIGEGAYGMVVSEAPMKKL--------------LQ---------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        19 ~~~~f~V~~-RY~~lk~IG~GAYG~VcSA~D~~~~--------------~~---------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ....|+|+. -....+.||.|.||.|+.|.--.+.              +|         |-- .|||+++.--++-.|.
T Consensus       383 s~~~WeIp~~ev~l~~rIGsGsFGtV~Rg~whGdVAVK~Lnv~~pt~~qlqaFKnEVa~lkkT-RH~NIlLFMG~~~~p~  461 (678)
T KOG0193|consen  383 SLEEWEIPPEEVLLGERIGSGSFGTVYRGRWHGDVAVKLLNVDDPTPEQLQAFKNEVAVLKKT-RHENILLFMGACMNPP  461 (678)
T ss_pred             cccccccCHHHhhccceeccccccceeecccccceEEEEEecCCCCHHHHHHHHHHHHHHhhc-chhhheeeehhhcCCc
Confidence            345688764 4466789999999999998533221              22         333 6889887777777776


Q ss_pred             ccC
Q psy1710          75 QTI   77 (77)
Q Consensus        75 ~~~   77 (77)
                      +.|
T Consensus       462 ~AI  464 (678)
T KOG0193|consen  462 LAI  464 (678)
T ss_pred             eee
Confidence            543


No 276
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=92.16  E-value=0.096  Score=35.94  Aligned_cols=44  Identities=25%  Similarity=0.199  Sum_probs=31.9

Q ss_pred             CcccccccCCCCCcceEEEEechh------------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK------------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~------------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .|...+.||.|+||.|+.|.++..                  +     +-+.+ .|+|++.+++.+..
T Consensus         7 ~~~~~~~ig~g~~~~v~~~~~~~~~~~~~~K~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   73 (263)
T cd05052           7 DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEI-KHPNLVQLLGVCTR   73 (263)
T ss_pred             HeEEeeecCCcccceEEEEEEecCCceEEEEEecCCchHHHHHHHHHHHHHhC-CCCChhheEEEEcC
Confidence            477788899999999999987521                  1     11344 68899999887643


No 277
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=92.14  E-value=0.19  Score=34.39  Aligned_cols=47  Identities=17%  Similarity=0.154  Sum_probs=34.6

Q ss_pred             CCcccccccCCCCCcceEEEEechh------------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK------------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~------------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ++|+.++.||+|+||.|+.|.....                        +     ..+.+ .|+|++.+++++..+.
T Consensus         4 ~~~~~~~~ig~g~~~~v~~~~~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~ei~~l~~l-~~~~i~~~~~~~~~~~   79 (284)
T cd05038           4 RHLKFIKQLGEGHFGKVELCRYDPLGDNTGEQVAVKSLNHSGEEQHRSDFEREIEILRTL-DHENIVKYKGVCEKPG   79 (284)
T ss_pred             hhchhheeeccCCCeeEEEeeecCCCCCCceEEEEEEeccccchHHHHHHHHHHHHHHhC-CCCChheEEeeeecCC
Confidence            4678889999999999999863210                        0     12556 7899999999876643


No 278
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=92.04  E-value=0.14  Score=36.77  Aligned_cols=41  Identities=27%  Similarity=0.320  Sum_probs=29.4

Q ss_pred             cccCCCCCcceEEEEechh-------hhh--------------------hccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------LLQ--------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~~~--------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.++.+       ++.                    +.+..|+|++.+++.|...
T Consensus         1 ~~lg~G~~g~V~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~e~~~l~~~~~~~~i~~~~~~~~~~   68 (316)
T cd05620           1 KVLGKGSFGKVLLAELKGKGEYFAVKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLYCTFQTK   68 (316)
T ss_pred             CeeeeCCCeEEEEEEECCCCCEEEEEEEEHHHhhhcchHHHHHHHHHHHHhccCCCCccCeeEEEEeC
Confidence            4699999999999987532       110                    2234789999999987654


No 279
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=92.04  E-value=0.089  Score=42.36  Aligned_cols=26  Identities=27%  Similarity=0.452  Sum_probs=22.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechh
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK   51 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~   51 (77)
                      .++|+..+.||+|+||.|+.|.+..+
T Consensus       131 ~~~y~l~~~LG~G~FG~VYka~~~~~  156 (566)
T PLN03225        131 KDDFVLGKKLGEGAFGVVYKASLVNK  156 (566)
T ss_pred             cCCeEEeEEEeeCCCeEEEEEEEcCC
Confidence            46799999999999999999988654


No 280
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=91.98  E-value=0.11  Score=36.77  Aligned_cols=47  Identities=23%  Similarity=0.370  Sum_probs=34.3

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh-------------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK-------------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~-------------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ....|..+..||+|+||.||.|.+..+                   +     ..+.+ .|+|++.+++.+..
T Consensus        18 ~~~~~~~~~~lg~g~~g~v~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~   88 (292)
T cd06657          18 PRTYLDNFIKIGEGSTGIVCIATVKSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDY-QHENVVEMYNSYLV   88 (292)
T ss_pred             hHHHhhhHHHcCCCCCeEEEEEEEcCCCeEEEEEEecccchhHHHHHHHHHHHHHhc-CCcchhheeeEEEe
Confidence            345566778899999999999977421                   0     12555 58999999998764


No 281
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=91.86  E-value=0.11  Score=36.03  Aligned_cols=24  Identities=21%  Similarity=0.248  Sum_probs=20.9

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      ..+|+..+.||+|+||.|+.|.+.
T Consensus         4 ~~~~~~~~~lg~G~~g~v~~~~~~   27 (296)
T cd05051           4 RQPLNFVEKLGEGQFGEVHLCEAD   27 (296)
T ss_pred             hhhCcccccccCCCCccEEEEEec
Confidence            468999999999999999988754


No 282
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=91.83  E-value=0.18  Score=36.47  Aligned_cols=40  Identities=18%  Similarity=0.296  Sum_probs=28.6

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.|..+       +                    +.+.+ .|+|++.+++.+...
T Consensus         1 ~~lG~G~~g~Vy~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~E~~~l~~l-~hp~iv~~~~~~~~~   67 (328)
T cd05593           1 KLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNT-RHPFLTSLKYSFQTK   67 (328)
T ss_pred             CeeeeCCCEEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhC-CCCCCcceEEEEEcC
Confidence            4689999999999987531       1                    11333 588999998887654


No 283
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=91.77  E-value=0.22  Score=33.78  Aligned_cols=39  Identities=23%  Similarity=0.429  Sum_probs=27.7

Q ss_pred             cccCCCCCcceEEEEech---h----------------hh---------hhccCcchheeEEEeEeeC
Q psy1710          33 AYIGEGAYGMVVSEAPMK---K----------------LL---------QKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~---~----------------~~---------~~~~~~~~~~~~~~~~~~~   72 (77)
                      +.||+|+||.|++|.+..   +                ..         -+.+ .|+|+|.+++.+..
T Consensus         1 ~~ig~g~~~~v~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~   67 (257)
T cd05040           1 KKLGDGSFGVVRRGEWSTSGGKVIPVAVKCLKSDKLSDIMDDFLKEAAIMHSL-DHENLIRLYGVVLT   67 (257)
T ss_pred             CcCCccCcccEEeeeEecCCCCceEEEEeecCCcccHHHHHHHHHHHHHHhhc-CCCCccceeEEEcC
Confidence            468999999999997643   1                00         0334 68899999988754


No 284
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=91.76  E-value=0.18  Score=36.16  Aligned_cols=40  Identities=15%  Similarity=0.291  Sum_probs=28.4

Q ss_pred             cccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|+.|.|..+       +                    +-+.+ .|+|++.+++.+...
T Consensus         1 ~~lG~G~~g~V~~~~~~~~~~~~a~K~~~~~~~~~~~~~~~~~~e~~~l~~~-~hp~i~~~~~~~~~~   67 (325)
T cd05594           1 KLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNS-RHPFLTALKYSFQTH   67 (325)
T ss_pred             CeeeeCCCEEEEEEEECCCCCEEEEEEEEHHHhhhhhHHHHHHHHHHHHHhC-CCCCCCceEEEEEcC
Confidence            4689999999999987521       0                    01333 688999999887654


No 285
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=91.76  E-value=0.1  Score=36.11  Aligned_cols=48  Identities=21%  Similarity=0.312  Sum_probs=34.6

Q ss_pred             CCCcccccccCCCCCcceEEEEech-----------hhh------------------hhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK-----------KLL------------------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~-----------~~~------------------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..+|+.++.||.|+||.|+.|.+..           |++                  .+.+ .|.|++.+++.+..+.
T Consensus         6 ~~~~~~~~~lg~G~~g~vy~~~~~~~~~~~~~~va~K~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~~   82 (279)
T cd05109           6 ETELKKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGV-GSPYVCRLLGICLTST   82 (279)
T ss_pred             hhheeeeeecCCCCCceEEEEEEecCCCccceEEEEEEecCCCCHHHHHHHHHHHHHHHhc-CCCCCceEEEEEcCCC
Confidence            4678899999999999999986321           111                  1444 5789999988876653


No 286
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=91.65  E-value=0.25  Score=33.30  Aligned_cols=40  Identities=23%  Similarity=0.272  Sum_probs=29.4

Q ss_pred             cccCCCCCcceEEEEech-------------------hh-----hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMK-------------------KL-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~-------------------~~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||.|+||.|++|.+..                   ++     ..+.+ .|+|++.+++++...
T Consensus         1 ~~lg~g~~g~v~~~~~~~~~~v~~K~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   64 (251)
T cd05041           1 EKIGKGNFGDVYKGVLKGNTEVAVKTCRSTLPPDLKRKFLQEAEILKQY-DHPNIVKLIGVCVQK   64 (251)
T ss_pred             CccccCCCceEEEEEEeCCCcEEEEeccccCCHHHHHHHHHHHHHHHhC-CCCCeEEEEEEEecC
Confidence            468999999999998752                   01     11556 689999999987644


No 287
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=91.64  E-value=0.24  Score=33.59  Aligned_cols=40  Identities=23%  Similarity=0.376  Sum_probs=28.1

Q ss_pred             cccCCCCCcceEEEEech----------h-h-----------------hhhccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMK----------K-L-----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~----------~-~-----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||+|+||.|++|.+..          | +                 +.+-+ .|+|++.+++.++.+
T Consensus         1 ~~lg~g~~g~v~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~   68 (262)
T cd05058           1 RVIGKGHFGCVYHGTLIDSDGQKIHCAVKSLNRITDLEEVEQFLKEGIIMKDF-SHPNVLSLLGICLPS   68 (262)
T ss_pred             CcccccCCceEEEEEEecCCCceEEEEEEecCccCCHHHHHHHHHHHHHHccC-CCCCcceEEEEeecC
Confidence            468999999999887421          0 0                 11445 789999999977654


No 288
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=91.44  E-value=0.12  Score=36.21  Aligned_cols=22  Identities=18%  Similarity=0.439  Sum_probs=18.8

Q ss_pred             CcccccccCCCCCcceEEEEec
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .|...+.||+|+||.|+.|.+.
T Consensus         1 ~~~~~~~lg~G~~g~vy~~~~~   22 (285)
T cd05632           1 TFRQYRVLGKGGFGEVCACQVR   22 (285)
T ss_pred             CceEEEEEecCCCeEEEEEEEC
Confidence            3677889999999999998774


No 289
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=91.43  E-value=0.11  Score=35.58  Aligned_cols=46  Identities=15%  Similarity=0.047  Sum_probs=33.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechh----------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK----------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~----------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +++|+..+.||+|+||.|++|.++..          +                  ..+-+ .|+|++.+++.+..
T Consensus         3 ~~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~vaik~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~   76 (266)
T cd05033           3 PSYVTIEKVIGGGEFGEVCRGRLKLPGKKEIDVAIKTLKAGSSDKQRLDFLTEASIMGQF-DHPNIIRLEGVVTK   76 (266)
T ss_pred             hHHceeeeEecCCccceEEEEEEccCCCCcceEEEEEcCCCCChHHHHHHHHHHHHHHhC-CCCCcceEeEEEec
Confidence            35788899999999999999876321          1                  01334 58899999998754


No 290
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=91.32  E-value=0.28  Score=33.36  Aligned_cols=41  Identities=24%  Similarity=0.309  Sum_probs=28.8

Q ss_pred             ccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeC
Q psy1710          32 LAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++.||.|+||.|+.|.+...       .                    .......|.|++.+++.+..
T Consensus         1 ~~~l~~g~~~~v~~a~~~~~~~~vavK~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~i~~~~~~~~~   68 (260)
T cd05611           1 LKPISKGAFGSVYLAKKRSTGDYFAIKVLKKSDMIAKNQVTNVKAERAIMMIQGESPYVAKLYYSFQS   68 (260)
T ss_pred             CccCCcCCCeeEEEEEecCCCCeEEEEEecchhhhHHHHHHHHHHHHHHHhhcCCCCCeeeeeeeEEc
Confidence            46799999999999987421       0                    00223368999999988754


No 291
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=91.28  E-value=0.14  Score=34.64  Aligned_cols=45  Identities=20%  Similarity=0.304  Sum_probs=33.2

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+..+.||+|+||.|+.|.+...                     +     ..+.+ .|+|++.+++.....
T Consensus         1 ~y~~~~~lg~G~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~~~~l-~~~~i~~~~~~~~~~   71 (264)
T cd06626           1 RWQRGNKIGGGTFGKVYTAVNLDTGELMAVKEIRIQDNDPKTIKEIADEMKVLELL-KHPNLVKYYGVEVHR   71 (264)
T ss_pred             CceeeeEeecCCCcEEEEEEECCCCcEEEEEEEECcccchHHHHHHHHHHHHHHhC-CCCChhheeeeEecC
Confidence            799999999999999999976421                     0     11555 678888888875543


No 292
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=91.26  E-value=0.23  Score=33.46  Aligned_cols=44  Identities=16%  Similarity=0.331  Sum_probs=33.3

Q ss_pred             cccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |...+.||+|++|.|+.|.++.+-                          ..+.+ .|+|++.+++.++..
T Consensus         2 ~~~~~~l~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   71 (256)
T cd08529           2 FEILNKIGKGSFGVVFKVVRKADKRVYAMKQIDLSKMNRREREEAIDEARVLAKL-DSSYIIRYYESFLDK   71 (256)
T ss_pred             ceEeEEecCCCCeEEEEEEEcCCCcEEEEEEeehhhCCHHHHHHHHHHHHHHHhc-CCCCeehheeeeccC
Confidence            677889999999999999764210                          11566 789999999987754


No 293
>KOG0586|consensus
Probab=91.13  E-value=0.17  Score=42.22  Aligned_cols=47  Identities=19%  Similarity=0.208  Sum_probs=37.5

Q ss_pred             CCcccccccCCCCCcceEEEEechhh-----------------hh---------hccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKKL-----------------LQ---------KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~~-----------------~~---------~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .-|..++.||+|.|+.|-.|++..+=                 +|         |-+ +|+|+|+||-+..++.
T Consensus        56 g~y~i~~tig~g~f~~V~La~~~~t~~~VaiK~idkt~ln~~~~~k~~rev~imk~l-~HPnIvkl~~v~~t~~  128 (596)
T KOG0586|consen   56 GLYVIIKTIGKGNFAKVKLARHILTGTEVAIKIIDKTQLNPSKRQKLGREVDIMKSL-NHPNIVKLFSVIETEA  128 (596)
T ss_pred             cceeeeeeeccceeEEEEeeEecCCCceEEEEEehhcccChHHHHHHHHHHHHHHhc-CCcceeeeeeeeeecc
Confidence            45888999999999999999765221                 22         667 8999999999988764


No 294
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=91.07  E-value=0.15  Score=34.32  Aligned_cols=44  Identities=16%  Similarity=0.210  Sum_probs=33.1

Q ss_pred             CcccccccCCCCCcceEEEEechh--------------------h---------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------------------L---------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------------------~---------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ||+..+.||.|+||.|+.|.+..+                    .         +.+.+ .|+|++.+++.+..
T Consensus         1 ~~~~~~~ig~g~~~~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~   73 (258)
T cd06632           1 RWRKGELLGSGSFGSVYEGLNLDDGDFFAVKEVSLADDGQTGQEAVKQLEQEIALLSKL-QHPNIVQYLGTERE   73 (258)
T ss_pred             CccccceeeecCCceEEEEEEcCCCcEEEEEEEEEccccccchHHHHHHHHHHHHHHhc-CCCCchheeeeEec
Confidence            688889999999999999987511                    0         11445 67899999987654


No 295
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=90.97  E-value=0.16  Score=34.26  Aligned_cols=44  Identities=23%  Similarity=0.349  Sum_probs=32.8

Q ss_pred             CcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +|+.++.||+|+||.|+.|.|+..        +                  +-+.+ .|+|++.+++.|..
T Consensus         1 ~y~~~~~lg~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~   70 (257)
T cd08223           1 AYCFVRVVGKGSYGEVSLVRHRTDGKQYVIKKLNLRNASRRERKAAEQEAQLLSQL-KHPNIVAYRESWEG   70 (257)
T ss_pred             CceEEEEecCCCCeEEEEEEEcCCCcEEEEEEEehhhcCHHHHHHHHHHHHHHHhC-CCCCeeeeeeeecC
Confidence            488999999999999999987532        1                  01344 57899998887653


No 296
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=90.92  E-value=0.14  Score=36.65  Aligned_cols=49  Identities=12%  Similarity=0.235  Sum_probs=35.9

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh----------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK----------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~----------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++.++|..++.||.|+||.|+.|.+...                      +     .-+.+ .|+|++.+++.+...
T Consensus        18 ~~~~~~~~~~~lg~g~~g~v~~~~~~~~~~~v~ik~~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~~~   93 (313)
T cd06633          18 DPEEIFVGLHEIGHGSFGAVYFATNSHTNEVVAVKKMSYSGKQTNEKWQDIIKEVKFLQQL-KHPNTIEYKGCYLKE   93 (313)
T ss_pred             CHHHHhhcceeeccCCCeEEEEEEECCCCcEEEEEEEeccccCchHHHHHHHHHHHHHHhC-CCCCCccEEEEEEeC
Confidence            3456788899999999999999976421                      1     11455 578999999887654


No 297
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=90.85  E-value=0.15  Score=40.00  Aligned_cols=26  Identities=27%  Similarity=0.395  Sum_probs=23.0

Q ss_pred             EeCCCcccccccCCCCCcceEEEEec
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      ....||...+.||+|+||.|+.|.+.
T Consensus        29 ~~~~rY~i~~~LG~G~fG~Vy~a~~~   54 (496)
T PTZ00283         29 EQAKKYWISRVLGSGATGTVLCAKRV   54 (496)
T ss_pred             ccCCCEEEEEEEecCCCEEEEEEEEc
Confidence            45689999999999999999999874


No 298
>KOG1989|consensus
Probab=90.85  E-value=0.26  Score=41.98  Aligned_cols=54  Identities=28%  Similarity=0.265  Sum_probs=41.1

Q ss_pred             ceEEEe-CCCcccccccCCCCCcceEEEEechh-h--------------hh---------hccCcchheeEEEe-EeeCC
Q psy1710          20 GQTFEV-GPRYTNLAYIGEGAYGMVVSEAPMKK-L--------------LQ---------KGAGTNEQLVLLYM-WWISP   73 (77)
Q Consensus        20 ~~~f~V-~~RY~~lk~IG~GAYG~VcSA~D~~~-~--------------~~---------~~~~~~~~~~~~~~-~~~~~   73 (77)
                      +..|.| .-|+...+.|-+|.|+.||.|.|... .              |+         |-+--|+|+|+++| -.+.+
T Consensus        29 G~~~~Vg~~~v~V~~vLAEGGFa~VYla~~~~~~~~~AlKrm~~~de~~L~~v~~EI~~MK~L~gh~nIV~yidss~~~~  108 (738)
T KOG1989|consen   29 GQTFTVGSHRVTVEKVLAEGGFAQVYLAQDVKGGKKYALKRMYVNDEEALNAVKREIDIMKLLSGHKNIVSYIDSSAINR  108 (738)
T ss_pred             ceEEEECCEEEEEEEEEccCCcEEEEEEEecCCCceeeeeeeecCCHHHHHHHHHHHHHHHHhcCCCceeeEeccccccc
Confidence            345666 35678889999999999999998866 2              11         77777999999999 44433


No 299
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=90.81  E-value=0.29  Score=33.52  Aligned_cols=46  Identities=35%  Similarity=0.463  Sum_probs=33.3

Q ss_pred             cccccccCCCCCcceEEEEech-------hhh-------------------hhccC--cchheeEEEeEeeCCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK-------KLL-------------------QKGAG--TNEQLVLLYMWWISPT   74 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~-------~~~-------------------~~~~~--~~~~~~~~~~~~~~~~   74 (77)
                      |+..+.||.|+||.|+.|.++.       |.+                   .+++.  .|+|++.+++.+..+.
T Consensus         1 y~~~~~l~~g~~~~v~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~e~~~l~~l~~~~h~~i~~~~~~~~~~~   74 (287)
T cd07838           1 YEELAEIGEGAYGTVYKARDLNTGRFVALKKVRVPLSEEGIPLSTLREIALLKQLESFEHPNIVRLLDVCHGPR   74 (287)
T ss_pred             CeEEEEecccCceEEEEEEECCCCCEEEEEEeccccccchhhhhHHHHHHHHHHhhccCCCCcceEEEEEeecc
Confidence            6678889999999999998753       111                   12332  4899999999887653


No 300
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=90.80  E-value=0.33  Score=33.93  Aligned_cols=16  Identities=6%  Similarity=0.056  Sum_probs=13.4

Q ss_pred             cchheeEEEeEeeCCC
Q psy1710          59 TNEQLVLLYMWWISPT   74 (77)
Q Consensus        59 ~~~~~~~~~~~~~~~~   74 (77)
                      .|+|++.+++.++...
T Consensus        74 ~h~niv~~~~~~~~~~   89 (274)
T cd05076          74 SHIHLAFVHGVCVRGS   89 (274)
T ss_pred             CCCCeeeEEEEEEeCC
Confidence            6899999999887654


No 301
>KOG0192|consensus
Probab=90.69  E-value=0.23  Score=38.39  Aligned_cols=44  Identities=20%  Similarity=0.258  Sum_probs=32.1

Q ss_pred             cccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ....+.+|.|+||.|+.|.-..+.                          |+| + .|+|||+++-..+.|.
T Consensus        43 l~~~~~iG~G~~g~V~~~~~~g~~~vavK~~~~~~~~~~~~~~f~~E~~il~~-l-~HpNIV~f~G~~~~~~  112 (362)
T KOG0192|consen   43 LPIEEVLGSGSFGTVYKGKWRGTDVVAVKIISDPDFDDESRKAFRREASLLSR-L-RHPNIVQFYGACTSPP  112 (362)
T ss_pred             hhhhhhcccCCceeEEEEEeCCceeEEEEEecchhcChHHHHHHHHHHHHHHh-C-CCCCeeeEEEEEcCCC
Confidence            344566999999999977433222                          223 5 8999999999998884


No 302
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=90.65  E-value=0.3  Score=34.88  Aligned_cols=46  Identities=15%  Similarity=0.335  Sum_probs=34.3

Q ss_pred             CCcccccccCCCCCcceEEEEechh----------------------hhh-----hccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK----------------------LLQ-----KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~----------------------~~~-----~~~~~~~~~~~~~~~~~~~   73 (77)
                      ..|..++.||+|+||.|+.|.+...                      +++     +.+ .|+|+|.+++.+...
T Consensus        25 ~~f~~~~~lg~G~~~~v~~~~~~~~~~~valK~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv~~~~~~~~~   97 (317)
T cd06635          25 KLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSNEKWQDIIKEVKFLQRI-KHPNSIEYKGCYLRE   97 (317)
T ss_pred             hhhhhhheeccCCCeEEEEEEEcCCCcEEEEEEEecCCCCchHHHHHHHHHHHHHHhC-CCCCEEEEEEEEeeC
Confidence            4488999999999999999986421                      100     334 689999999987654


No 303
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=90.64  E-value=0.16  Score=35.41  Aligned_cols=44  Identities=20%  Similarity=0.323  Sum_probs=33.5

Q ss_pred             CcccccccCCCCCcceEEEEechh--h---------------------------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--L---------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--~---------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ||+..+.||+|+||.|+.|.+...  .                           ..+.+ .|+|++.+++.+..
T Consensus         1 ~y~~~~~lg~g~~~~vy~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~~~~~e~~~l~~~-~h~~i~~~~~~~~~   73 (298)
T cd07841           1 RYEKGKKLGEGTYAVVYKARDKETGRIVAIKKIKLGERKEAKDGINFTALREIKLLQEL-KHPNIIGLLDVFGH   73 (298)
T ss_pred             CceeeeeeeeccccEEEEEEECCCCcEEEEEEEeccccccccchhhHHHHHHHHHHhhc-CCCCChhhhheeec
Confidence            688899999999999999987531  0                           11334 58999999988765


No 304
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=90.62  E-value=0.34  Score=33.01  Aligned_cols=40  Identities=23%  Similarity=0.367  Sum_probs=28.2

Q ss_pred             cccCCCCCcceEEEEech-------------hhhh------------------hccCcchheeEEEeEeeCC
Q psy1710          33 AYIGEGAYGMVVSEAPMK-------------KLLQ------------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~-------------~~~~------------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.||.|+||.|+.|.++.             |.+.                  +.+ .|+|++.+++.+...
T Consensus         1 ~~lg~g~~g~vy~~~~~~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   71 (269)
T cd05044           1 NFLGSGAFGEVYEGTATDILGPGSGPIRVAVKTLRKGATDQEKKEFLKEAHLMSNF-NHPNIVKLLGVCLLN   71 (269)
T ss_pred             CccccccceeEEeeeecccccCcccceeehhhhhhcccchhhHHHHHHHHHHHHhc-CCCCeeeEeeeecCC
Confidence            468999999999887531             1111                  344 689999999987653


No 305
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=90.58  E-value=0.3  Score=33.80  Aligned_cols=18  Identities=22%  Similarity=0.395  Sum_probs=14.0

Q ss_pred             ccCcchheeEEEeEeeCCC
Q psy1710          56 GAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        56 ~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+ .|+|+|.+++.+....
T Consensus        60 ~l-~hp~iv~~~~~~~~~~   77 (262)
T cd05077          60 QV-SHKHIVLLYGVCVRDV   77 (262)
T ss_pred             hC-CCCCEeeEEEEEecCC
Confidence            44 7999999999876543


No 306
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=90.57  E-value=0.34  Score=33.83  Aligned_cols=45  Identities=24%  Similarity=0.318  Sum_probs=32.8

Q ss_pred             CcccccccCCCCCcceEEEEech-------------hh----------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK-------------KL----------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~-------------~~----------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .|...+.||.|+||.|+.+.+..             .+                .-+.+ +|+|++.+++.+...
T Consensus         6 ~~~~~~~lg~G~~~~v~~~~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   79 (288)
T cd05093           6 NIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNL-QHEHIVKFYGVCVEG   79 (288)
T ss_pred             HeeeccccCCcCCeeEEeeEeccCCCCCcceEEEEEecCCcCHHHHHHHHHHHHHHHhC-CCCCcceEEEEEecC
Confidence            47778899999999999887421             00                11455 689999999987653


No 307
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=90.55  E-value=0.41  Score=32.24  Aligned_cols=41  Identities=20%  Similarity=0.275  Sum_probs=28.4

Q ss_pred             cccCCCCCcceEEEEechh-------------------h-----hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEGAYGMVVSEAPMKK-------------------L-----LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~-------------------~-----~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.||.|+||.|+.|.+...                   +     +.+.+ .|+|++.+++++....
T Consensus         1 ~~ig~g~~g~vy~~~~~~~~~~a~K~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   65 (250)
T cd05085           1 ELLGKGNFGEVFKGTLKDKTPVAVKTCKEDLPQELKIKFLSEARILKQY-DHPNIVKLIGVCTQRQ   65 (250)
T ss_pred             CccCCCCCceEEEEEecCCcEEEEEecCCcCCHHHHHHHHHHHHHHHhC-CCCCcCeEEEEEecCC
Confidence            3689999999998864210                   0     11345 6999999999876543


No 308
>KOG0596|consensus
Probab=90.38  E-value=0.53  Score=39.79  Aligned_cols=50  Identities=28%  Similarity=0.430  Sum_probs=35.8

Q ss_pred             eEEEe-CCCcccccccCCCCCcceEEEEec-------hhh-------------------hhhccCcchheeEEEeEee
Q psy1710          21 QTFEV-GPRYTNLAYIGEGAYGMVVSEAPM-------KKL-------------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        21 ~~f~V-~~RY~~lk~IG~GAYG~VcSA~D~-------~~~-------------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      ..+.| ..-|+.++.||+|....|+++...       .++                   |-|-- .+-+||+|||.=+
T Consensus       354 ~~i~Vkg~~Yeilk~iG~GGSSkV~kV~~s~~~iyalkkv~~~~~D~qtl~gy~nEI~lL~KLk-g~~~IIqL~DYEv  430 (677)
T KOG0596|consen  354 EIIKVKGREYEILKQIGSGGSSKVFKVLNSDKQIYALKKVVLLEADNQTLDGYRNEIALLNKLK-GHDKIIQLYDYEV  430 (677)
T ss_pred             eeEEECcchhhHHHhhcCCCcceeeeeecCCCcchhhhHHHHhhcCHHHHHHHHHHHHHHHHhc-CCceEEEEeeeec
Confidence            44555 456999999999999999998654       111                   22544 4589999999643


No 309
>KOG1164|consensus
Probab=90.22  E-value=0.18  Score=36.98  Aligned_cols=23  Identities=35%  Similarity=0.470  Sum_probs=21.4

Q ss_pred             CcccccccCCCCCcceEEEEech
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      +|...+.||+|+||.|+.+.|..
T Consensus        19 ~~~i~~~iG~G~fG~V~~v~~~~   41 (322)
T KOG1164|consen   19 RYKLGKKIGEGGFGAVYLVSDKS   41 (322)
T ss_pred             ceEEeeeccccCCceEEEEEecC
Confidence            89999999999999999998765


No 310
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=90.10  E-value=0.47  Score=33.15  Aligned_cols=38  Identities=18%  Similarity=0.267  Sum_probs=26.8

Q ss_pred             cCCCCCcceEEEEechh--------h-------------------hhhccCcchheeEEEeEeeCC
Q psy1710          35 IGEGAYGMVVSEAPMKK--------L-------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        35 IG~GAYG~VcSA~D~~~--------~-------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+|+||.|+.|.|+.+        +                   +.+-+ .|+|++.+++.+...
T Consensus         1 lg~G~~g~Vy~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~~E~~il~~l-~~~~i~~~~~~~~~~   65 (280)
T cd05608           1 LGKGGFGEVSACQMRATGKLYACKKLNKKRLKKRKGYEGAMVEKRILAKV-HSRFIVSLAYAFQTK   65 (280)
T ss_pred             CCCCCceeEEEEEEccCCcEEEEEeeeHHHHhhhHHHHHHHHHHHHHHhC-CCCcEeeeeEEEcCC
Confidence            68999999998876521        1                   01334 688999998887654


No 311
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=90.07  E-value=0.37  Score=33.70  Aligned_cols=47  Identities=21%  Similarity=0.213  Sum_probs=33.4

Q ss_pred             CCcccccccCCCCCcceEEEEech------------hh-----------h------hhccCcchheeEEEeEeeCCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK------------KL-----------L------QKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~------------~~-----------~------~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .+|...+.||+|+||.|+.|.+..            +.           +      .+.+ .|+|++++++.+....
T Consensus         5 ~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   80 (291)
T cd05094           5 RDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNL-QHEHIVKFYGVCGDGD   80 (291)
T ss_pred             HHeEEeeeecccCCCeEEEeEeeccCCCCcceeeEEEecCCccHHHHHHHHHHHHHHhcC-CCCCcceEEEEEccCC
Confidence            357778899999999999886321            00           1      1445 6899999999876543


No 312
>KOG0588|consensus
Probab=90.05  E-value=0.16  Score=43.38  Aligned_cols=44  Identities=18%  Similarity=0.289  Sum_probs=34.1

Q ss_pred             CcccccccCCCCCcceEEEEechh-------h--------------------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK-------L--------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~-------~--------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .|++=+.||+|.-|.|-.|.+..+       |                    +-|-| +|.||++|||+|=.
T Consensus        13 pwkLgkTLG~Gstg~vrlakh~~TGqlaaiKii~k~~~~s~s~~~~IerEIviMkLi-~HpnVl~LydVwe~   83 (786)
T KOG0588|consen   13 PWKLGKTLGKGSTGCVRLAKHAETGQLAAIKIIPKRSELSSSQPAGIEREIVIMKLI-EHPNVLRLYDVWEN   83 (786)
T ss_pred             ceeccccccCCCCceehhhhcccccceeEEEeeccccccccccccchhhhhHHHHHh-cCCCeeeeeeeecc
Confidence            477778999999999977765522       1                    22777 99999999999943


No 313
>KOG0578|consensus
Probab=89.94  E-value=0.061  Score=44.41  Aligned_cols=46  Identities=22%  Similarity=0.341  Sum_probs=35.2

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechhh---------h---------------hhccCcchheeEEEeEe
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKKL---------L---------------QKGAGTNEQLVLLYMWW   70 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~~---------~---------------~~~~~~~~~~~~~~~~~   70 (77)
                      ++..+|.....||+||-|.||.|.++.+=         +               -|.. .|+|+|..+|-|
T Consensus       270 dP~~~y~~~~kigqgaSG~vy~A~~~~~~~~VaiK~m~l~~Q~~keLilnEi~Vm~~~-~H~NiVnfl~Sy  339 (550)
T KOG0578|consen  270 DPRSKYTDFKKIGQGATGGVYVARKISTKQEVAIKRMDLRKQPKKELLLNEILVMRDL-HHPNIVNFLDSY  339 (550)
T ss_pred             ChhhhhcchhhhccccccceeeeeeccCCceEEEEEEEeccCCchhhhHHHHHHHHhc-cchHHHHHHHHh
Confidence            46788999999999999999999876321         1               1666 788998776643


No 314
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=89.86  E-value=0.37  Score=33.43  Aligned_cols=49  Identities=27%  Similarity=0.375  Sum_probs=37.4

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +..+.|+..+.||.|.||.|+.|.+...                  +     ..+.+ .|+|++.+++.++.+
T Consensus        16 ~~~~~~~~~~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   87 (286)
T cd06614          16 DPRELYKNLEKIGEGASGEVYKATDRATGKEVAIKKMRLRKQNKELIINEILIMKDC-KHPNIVDYYDSYLVG   87 (286)
T ss_pred             CccccchHhHhccCCCCeEEEEEEEccCCcEEEEEEEecCchhHHHHHHHHHHHHHC-CCCCeeEEEEEEEEC
Confidence            4567799999999999999999988611                  1     11455 588999999987754


No 315
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=89.80  E-value=0.23  Score=33.01  Aligned_cols=45  Identities=18%  Similarity=0.301  Sum_probs=33.9

Q ss_pred             CcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||...+.||.|+||.|+.|.|..+-                          ..+.+ .|+|++.+.|.+...
T Consensus         1 ~y~~~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~~~~~~~~~~~~   71 (258)
T cd08215           1 KYEIIKQIGKGSFGKVYLVRRKSDGKLYVLKEIDLSNMSEKEREDALNEVKILKKL-NHPNIIKYYESFEEK   71 (258)
T ss_pred             CceEEeeeccCCCeEEEEEEEcCCCcEEEEEEeecccCChHHHHHHHHHHHHHHhc-CCCChhheEEEEecC
Confidence            6888999999999999999886210                          11444 488999998877653


No 316
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=89.80  E-value=0.58  Score=30.81  Aligned_cols=44  Identities=23%  Similarity=0.429  Sum_probs=33.1

Q ss_pred             cccccccCCCCCcceEEEEech--h-h---------------------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK--K-L---------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~--~-~---------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |...+.||.|.+|.|+.|.+..  + .                     .-+.+ .|+|++++++.+...
T Consensus         2 y~~~~~l~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   69 (253)
T cd05122           2 FEILEKIGKGGFGEVYKARHKRTGKEVAIKVIKLESKEKKEKIINEIQILKKC-KHPNIVKYYGSYLKK   69 (253)
T ss_pred             ceeeeeeccCCceEEEEEEECCCCcEEEEEEecccchhHHHHHHHHHHHHHhC-CCCCEeEEEEEEecC
Confidence            7778899999999999998751  1 0                     01344 489999999988765


No 317
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=89.73  E-value=0.24  Score=33.68  Aligned_cols=45  Identities=22%  Similarity=0.310  Sum_probs=33.5

Q ss_pred             CcccccccCCCCCcceEEEEechhh---------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL---------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~---------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|+..+.||.|+||.||.|.|...-                           ..+.+ .|+|++.+++.+..+
T Consensus         1 ~y~~~~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   72 (258)
T cd05578           1 HFELLRVIGKGAFGKVCIVQKRDTKKMFAMKYMNKQKCVEKGSVRNVLNERRILQEL-NHPFLVNLWYSFQDE   72 (258)
T ss_pred             CceEEEEeccCCCceEEEEEEccCCcEEEEEEEehhhhcchhHHHHHHHHHHHHHhC-CCCChHHHHHhhcCC
Confidence            5888999999999999999886210                           11456 688998887766543


No 318
>KOG1163|consensus
Probab=89.54  E-value=0.45  Score=37.11  Aligned_cols=53  Identities=28%  Similarity=0.497  Sum_probs=40.0

Q ss_pred             EEEeCCCcccccccCCCCCcceEEEEech-----------------------hh---hh--------hccCcchheeEEE
Q psy1710          22 TFEVGPRYTNLAYIGEGAYGMVVSEAPMK-----------------------KL---LQ--------KGAGTNEQLVLLY   67 (77)
Q Consensus        22 ~f~V~~RY~~lk~IG~GAYG~VcSA~D~~-----------------------~~---~~--------~~~~~~~~~~~~~   67 (77)
                      .+-+..+|..+++||.|+||-.+.|....                       ++   ||        +|.|+.++--.|-
T Consensus        10 ~~iv~gky~lvrkiGsGSFGdIy~~~~i~~ge~VAiK~Es~~a~hpqL~yEskvY~iL~~g~GiP~i~~y~~e~~ynvlV   89 (341)
T KOG1163|consen   10 ELIVGGKYKLVRKIGSGSFGDIYLGISITSGEEVAIKLESSKAKHPQLLYESKVYRILQGGVGIPHIRHYGTEKDYNVLV   89 (341)
T ss_pred             hheeccceEEEEeecCCchhheeeeeeccCCceEEEEeecccCCCcchhHHHHHHHHhccCCCCchhhhhccccccceee
Confidence            35678899999999999999999886541                       11   33        7788877776666


Q ss_pred             eEeeCCC
Q psy1710          68 MWWISPT   74 (77)
Q Consensus        68 ~~~~~~~   74 (77)
                      |=.+-||
T Consensus        90 MdLLGPs   96 (341)
T KOG1163|consen   90 MDLLGPS   96 (341)
T ss_pred             eeccCcc
Confidence            6667776


No 319
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=89.33  E-value=0.2  Score=34.21  Aligned_cols=47  Identities=15%  Similarity=0.123  Sum_probs=34.3

Q ss_pred             CCCcccccccCCCCCcceEEEEechh-----------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKK-----------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~-----------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.+|...+.||+|+||.|++|.++..                       +     +-+.+ .|.|++.+.+.+...
T Consensus         4 ~~~~~~~~~lg~g~~g~vy~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~   78 (268)
T cd05063           4 PSHITKQKVIGAGEFGEVFRGILKMPGRKEVAVAIKTLKPGYTEKQRQDFLSEASIMGQF-SHHNIIRLEGVVTKF   78 (268)
T ss_pred             hHHceEeeEecCCCCccEEEEEEecCCCCceEEEEEeccccCCHHHHHHHHHHHHHHhcC-CCCCeeEEEEEEccC
Confidence            34678889999999999999976410                       0     11445 688999999887644


No 320
>KOG0577|consensus
Probab=89.31  E-value=0.13  Score=44.07  Aligned_cols=27  Identities=22%  Similarity=0.482  Sum_probs=24.0

Q ss_pred             EeCCCcccccccCCCCCcceEEEEech
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      ++-.+|.+++.||-|+||-||.|+|..
T Consensus        23 DPEklf~dLrEIGHGSFGAVYfArd~~   49 (948)
T KOG0577|consen   23 DPEKLFSDLREIGHGSFGAVYFARDVR   49 (948)
T ss_pred             CHHHHHHHHHHhcCCccceeEEeeccC
Confidence            455789999999999999999999974


No 321
>KOG1095|consensus
Probab=89.24  E-value=0.54  Score=41.42  Aligned_cols=48  Identities=23%  Similarity=0.228  Sum_probs=34.4

Q ss_pred             CCCcccccccCCCCCcceEEEEe----ch---------hh-----------------hhhccCcchheeEEEeEeeCCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAP----MK---------KL-----------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D----~~---------~~-----------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      +.+-++.+.||+|+||.||.|.-    ..         ++                 +-+++ .|+|||.|--+-|++.
T Consensus       691 ~~~v~l~~~lG~G~FG~VY~g~~~~~~~~~~~~~vaiK~l~~~~~~~~~~~Fl~Ea~~m~~f-~HpNiv~liGv~l~~~  768 (1025)
T KOG1095|consen  691 RKNVTLLRVLGKGAFGEVYEGTYSDVPGSVSPIQVAVKSLKRLSSEQEVSDFLKEALLMSKF-DHPNIVSLIGVCLDSG  768 (1025)
T ss_pred             hhheEeeeeeccccccceEEEEEecCCCCccceEEEEEeccccCCHHHHHHHHHHHHHHhcC-CCcceeeEEEeecCCC
Confidence            34567789999999999999741    11         11                 11566 8999999988777644


No 322
>KOG0576|consensus
Probab=89.19  E-value=0.12  Score=44.39  Aligned_cols=28  Identities=25%  Similarity=0.415  Sum_probs=25.3

Q ss_pred             EeCCCcccccccCCCCCcceEEEEechh
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMKK   51 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~~   51 (77)
                      +..++|+.+..+|.|.||-|++|+|+.+
T Consensus        12 nP~ddyellqrvgsgTygdvyKaRd~~s   39 (829)
T KOG0576|consen   12 NPQDDYELLQRVGSGTYGDVYKARDKRS   39 (829)
T ss_pred             CCccchhheeeecCCcccchhhhccccc
Confidence            6778999999999999999999999843


No 323
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=89.03  E-value=0.51  Score=32.58  Aligned_cols=39  Identities=15%  Similarity=0.203  Sum_probs=26.6

Q ss_pred             ccCCCCCcceEEEEechh------h----------------h-----hhccCcchheeEEEeEeeCC
Q psy1710          34 YIGEGAYGMVVSEAPMKK------L----------------L-----QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        34 ~IG~GAYG~VcSA~D~~~------~----------------~-----~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .||+|+||.|+.|.+...      +                +     .+-+ .|+|+|.+++.+...
T Consensus         2 ~lg~G~~g~v~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~e~~~~~~l-~h~~iv~~~~~~~~~   67 (268)
T cd05086           2 EIGNGWFGKVLLSEIYTDTGVARVVVKELKANASSKEQNEFLQQGDPYRIL-QHPNILQCLGQCVEA   67 (268)
T ss_pred             cCCCCcCceEEEEEEEcCCCcceEEEEEecCCCChHHHHHHHHHHHHHhcc-CCcchhheEEEecCC
Confidence            589999999998753210      0                0     1224 689999999987654


No 324
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=88.88  E-value=0.28  Score=33.62  Aligned_cols=22  Identities=27%  Similarity=0.525  Sum_probs=19.5

Q ss_pred             CcccccccCCCCCcceEEEEec
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      ||...+.||.|+||.||.|.+.
T Consensus         2 ~~~~~~~lg~g~~~~vy~~~~~   23 (272)
T cd06629           2 KWVKGELIGKGTYGRVYLALNV   23 (272)
T ss_pred             ceeecceecccCceEEEEEeec
Confidence            6888899999999999999764


No 325
>KOG0200|consensus
Probab=88.81  E-value=0.24  Score=40.22  Aligned_cols=47  Identities=30%  Similarity=0.461  Sum_probs=33.6

Q ss_pred             EEEeCCCc-ccccccCCCCCcceEEEEec----h-----------------------hhhh-----hccCcchheeEEEe
Q psy1710          22 TFEVGPRY-TNLAYIGEGAYGMVVSEAPM----K-----------------------KLLQ-----KGAGTNEQLVLLYM   68 (77)
Q Consensus        22 ~f~V~~RY-~~lk~IG~GAYG~VcSA~D~----~-----------------------~~~~-----~~~~~~~~~~~~~~   68 (77)
                      .|++++.. +.-+.+|+|+||.|+.|.=.    .                       .+.+     +++|.|+|+|.|.-
T Consensus       290 ~~e~~~~~l~~~~~lg~g~fG~v~~~~~~~~~~~~~~~~~~VaVK~~k~~~~~~~~~~~~~El~~m~~~g~H~niv~llG  369 (609)
T KOG0200|consen  290 KWEIPRENLKLGKYLGEGAFGQVVKALLFGLSKALLSIYVTVAVKMLKENASSSEKKDLMSELNVLKELGKHPNIVNLLG  369 (609)
T ss_pred             ceeechhhccccceeecccccceEeEEEeecccccccceEEEEEEecccccCcHHHHHHHHHHHHHHHhcCCcchhhhee
Confidence            57776544 45579999999999988411    1                       1111     89999999998864


No 326
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=88.76  E-value=0.29  Score=39.42  Aligned_cols=23  Identities=13%  Similarity=0.341  Sum_probs=20.7

Q ss_pred             CCCcccccccCCCCCcceEEEEe
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAP   48 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D   48 (77)
                      .++|...+.||+|+||.|++|.+
T Consensus       144 ~d~F~i~~~LG~GgFG~VYkG~~  166 (507)
T PLN03224        144 SDDFQLRDKLGGGNFGITFEGLR  166 (507)
T ss_pred             ccCceEeeEeecCCCeEEEEEEe
Confidence            56899999999999999999864


No 327
>KOG4717|consensus
Probab=88.62  E-value=0.27  Score=41.76  Aligned_cols=43  Identities=26%  Similarity=0.274  Sum_probs=33.4

Q ss_pred             CCcccccccCCCCCcceEE-------------EEechhh--------hh-----hccCcchheeEEEeEe
Q psy1710          27 PRYTNLAYIGEGAYGMVVS-------------EAPMKKL--------LQ-----KGAGTNEQLVLLYMWW   70 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcS-------------A~D~~~~--------~~-----~~~~~~~~~~~~~~~~   70 (77)
                      .=|.+-+.||+|-|.+|-.             .+|+.|+        +|     |-. ||.|+|.||.+.
T Consensus        18 GLYDLekTlG~GHFAVVKLArHVFTGekVAVKviDKTKlD~~st~hlfqEVRCMKLV-QHpNiVRLYEVi   86 (864)
T KOG4717|consen   18 GLYDLEKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLSTGHLFQEVRCMKLV-QHPNIVRLYEVI   86 (864)
T ss_pred             eeehhhhhhcCCceehhhhhhhhcccceeEEEEecccccchhhhhHHHHHHHHHHHh-cCcCeeeeeehh
Confidence            3488889999999988844             3577776        33     555 999999999874


No 328
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=88.50  E-value=0.31  Score=32.52  Aligned_cols=45  Identities=22%  Similarity=0.301  Sum_probs=33.7

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+..+.||+|++|.||.|.+...                     +     ..+.+ .|+|++.+.+++...
T Consensus         1 ~y~~~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   71 (254)
T cd06627           1 NYQLGDLIGRGAFGVVYKGLNLETGDFVAIKQISLEKIKEEALKSIMQEIDLLKNL-KHPNIVKYIGSIETS   71 (254)
T ss_pred             CceeeeEEcccCCeEEEEEEEcCCCcEEEEEEecccccCHHHHHHHHHHHHHHHhC-CCCCccEEEEEEEeC
Confidence            688899999999999999976521                     0     11455 578999998877653


No 329
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=88.47  E-value=0.35  Score=32.89  Aligned_cols=47  Identities=19%  Similarity=0.301  Sum_probs=34.3

Q ss_pred             CCcccccccCCCCCcceEEEEech-------------hh--------------hhhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMK-------------KL--------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~-------------~~--------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+|+..+.||.|.||.|+.|.++.             .+              ..+.+..|+|++.+++++...
T Consensus         1 ~~y~~~~~lg~g~~~~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~e~~~~~~l~~~~~i~~~~~~~~~~   74 (280)
T cd05581           1 DDFKFGKIIGEGSFSTVVLAKEKETNKEYAIKILDKRQLIKEKKVKYVKIEKEVLTRLNGHPGIIKLYYTFQDE   74 (280)
T ss_pred             CCceEeeeecCCCceEEEEEEEcCCCCEEEEEEechHhccchHHHHHHHHHHHHHHhcccCCCchhHHHHhcCC
Confidence            368899999999999999998752             00              114554589999888876543


No 330
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=88.44  E-value=0.23  Score=34.23  Aligned_cols=45  Identities=24%  Similarity=0.257  Sum_probs=33.0

Q ss_pred             CCcccccccCCCCCcceEEEEechh-------------h-----------------hhhccCcchheeEEEeEeeC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK-------------L-----------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~-------------~-----------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ++|+.++.||+|+||.|+.|.+...             +                 +.+.+ .|+|++.+++.+..
T Consensus         5 ~~~~~~~~lg~G~~g~Vy~~~~~~~~~~~~~~~v~~K~~~~~~~~~~~~~~~~ei~~l~~l-~h~~i~~~~~~~~~   79 (283)
T cd05048           5 SAVRFLEELGEGAFGKVYKGELTGPNERLSATSVAIKTLKENAEPKVQQEFRQEAELMSDL-QHPNIVCLLGVCTK   79 (283)
T ss_pred             HHcchhhcccCccCCcEEEEEEecCCCCcceeeEEEEecccCCCHHHHHHHHHHHHHHHhc-CCcccceEEEEEcC
Confidence            4688999999999999999865311             0                 11345 68899999988764


No 331
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=88.34  E-value=0.57  Score=33.58  Aligned_cols=41  Identities=15%  Similarity=0.152  Sum_probs=28.4

Q ss_pred             cccCCC--CCcceEEEEechh--h------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          33 AYIGEG--AYGMVVSEAPMKK--L------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        33 k~IG~G--AYG~VcSA~D~~~--~------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ..||+|  +||.|+.|.|...  .                        +.+.+ .|+|+|.+++.|....
T Consensus         4 ~~ig~g~~~~~~v~~a~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~~~~l-~h~niv~~~~~~~~~~   72 (328)
T cd08226           4 VEIGRGFCNLTSVYLARHTPTGTLVTVRITDLENCTEEHLKALQNEVVLSHFF-RHPNIMTSWTVFTTGS   72 (328)
T ss_pred             HHhCCcccCceeEEEEEEcCCCcEEEEEEeccccCCHHHHHHHHHHHHHHHhC-CCCCcceEeeeEecCC
Confidence            346666  8889999988411  0                        11345 6999999999987543


No 332
>KOG4279|consensus
Probab=87.78  E-value=0.16  Score=44.37  Aligned_cols=19  Identities=32%  Similarity=0.660  Sum_probs=16.5

Q ss_pred             cccCCCCCcceEEEEechh
Q psy1710          33 AYIGEGAYGMVVSEAPMKK   51 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~   51 (77)
                      -.||+|.||+||.|+|+.+
T Consensus       581 vVLGKGTYG~VYA~RD~~t  599 (1226)
T KOG4279|consen  581 VVLGKGTYGTVYAARDMDT  599 (1226)
T ss_pred             EEeecCceeEEEeeccccc
Confidence            3599999999999999844


No 333
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=87.44  E-value=0.71  Score=31.50  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=12.8

Q ss_pred             ccCCCCCcceEEEEe
Q psy1710          34 YIGEGAYGMVVSEAP   48 (77)
Q Consensus        34 ~IG~GAYG~VcSA~D   48 (77)
                      .||+|+||.|+.|.+
T Consensus         2 ~lg~G~~g~v~~~~~   16 (257)
T cd05116           2 ELGSGNFGTVKKGMY   16 (257)
T ss_pred             cCCCcCCcceEEeEE
Confidence            589999999998854


No 334
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=87.24  E-value=0.38  Score=32.63  Aligned_cols=46  Identities=17%  Similarity=0.213  Sum_probs=34.2

Q ss_pred             CCcccccccCCCCCcceEEEEechh--------------------hh-----hhccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPMKK--------------------LL-----QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~~~--------------------~~-----~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ++|+..+.||.|+||.|+.|.++.+                    ++     .+.+ .|+|++.+++.++..
T Consensus         1 ~~~~~~~~ig~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~~-~~~~i~~~~~~~~~~   71 (265)
T cd06605           1 DDLEYLGELGAGNSGVVSKVLHRPTGKIMAVKTIRLEINEAIQKQILRELDILHKC-NSPYIVGFYGAFYNN   71 (265)
T ss_pred             CcchHHHHhcCCCCeEEEEEEEcCCCcEEEEEEEecccChHHHHHHHHHHHHHHHC-CCCchhhhheeeecC
Confidence            3688899999999999999988621                    00     1345 488999988887654


No 335
>KOG0664|consensus
Probab=87.16  E-value=0.15  Score=40.47  Aligned_cols=45  Identities=20%  Similarity=0.142  Sum_probs=31.1

Q ss_pred             ccccccCCCCCcceEEEEechhh-----------hh------hcc--------CcchheeEEEeEeeCCC
Q psy1710          30 TNLAYIGEGAYGMVVSEAPMKKL-----------LQ------KGA--------GTNEQLVLLYMWWISPT   74 (77)
Q Consensus        30 ~~lk~IG~GAYG~VcSA~D~~~~-----------~~------~~~--------~~~~~~~~~~~~~~~~~   74 (77)
                      +.-++||.||||+|||..|-...           .|      +-.        =.||||.-+.|..-||.
T Consensus        56 ~PDRPIGYGAFGVVWsVTDPRdgrrvalkK~pnvfq~L~s~krvFre~kmLcfFkHdNVLSaLDILQPph  125 (449)
T KOG0664|consen   56 QPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPAN  125 (449)
T ss_pred             CCCCcccccceeEEEeccCCCCccchhHhhcchHHHHHHHHHHHHHHHHHHHhhccccHHHHHHhcCCCC
Confidence            44589999999999998776433           11      111        15789988888776664


No 336
>KOG0199|consensus
Probab=86.94  E-value=0.54  Score=41.05  Aligned_cols=46  Identities=22%  Similarity=0.327  Sum_probs=32.3

Q ss_pred             CCCcccccccCCCCCcceEEEEec----------hh---------h----hh-----hccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM----------KK---------L----LQ-----KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~----------~~---------~----~~-----~~~~~~~~~~~~~~~~~~   72 (77)
                      .+.-...+.||+|+||+|..+.-+          .|         +    ++     --+ +|+|||.||-+++-
T Consensus       109 ee~i~l~e~LG~GsFgvV~rg~Wt~psgk~V~VAVKclr~d~l~~~mddflrEas~M~~L-~H~hliRLyGvVl~  182 (1039)
T KOG0199|consen  109 EEQIKLYELLGEGSFGVVKRGTWTQPSGKHVNVAVKCLRDDSLNAIMDDFLREASHMLKL-QHPHLIRLYGVVLD  182 (1039)
T ss_pred             HHHHHHHHHhcCcceeeEeeccccCCCCcEEeEEEEeccCCccchhHHHHHHHHHHHHhc-cCcceeEEeeeecc
Confidence            345566789999999999765322          01         1    22     224 89999999999993


No 337
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=86.84  E-value=0.45  Score=32.78  Aligned_cols=44  Identities=25%  Similarity=0.373  Sum_probs=32.9

Q ss_pred             CcccccccCCCCCcceEEEEechh--------h------------------hhhccCcchheeEEEeEeeC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK--------L------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~--------~------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .|+.++.||.|++|.|+.|.++..        +                  .-+.+ .|+|++.+++.+..
T Consensus         1 ~y~~~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~i~~~~~~~~~   70 (284)
T cd07860           1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKEL-NHPNIVKLLDVIHT   70 (284)
T ss_pred             CceeeeeecCCCceEEEEEEECCCCCEEEEEEccccccccccchHHHHHHHHHHhc-CCCCCcchhhhccc
Confidence            378899999999999999987521        1                  01445 68899999887653


No 338
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=86.41  E-value=0.48  Score=31.35  Aligned_cols=45  Identities=16%  Similarity=0.180  Sum_probs=33.9

Q ss_pred             CcccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|...+.||+|++|.|+.|.+..+-                          ..+.+ .|+|++.+++.+...
T Consensus         1 ~~~~~~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   71 (260)
T cd06606           1 EWTRGELLGRGSFGSVYLALDKDTGELMAVKSVELSGDSEEELEALEREIRILSSL-QHPNIVRYYGSERDE   71 (260)
T ss_pred             CceeeeEeeecCceEEEEEEECCCCcEEEEEEeeccccchHHHHHHHHHHHHHHHc-CCCCEeeEEEEEecC
Confidence            5788899999999999999876110                          11444 489999999887764


No 339
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=85.91  E-value=1.2  Score=30.29  Aligned_cols=39  Identities=21%  Similarity=0.287  Sum_probs=27.9

Q ss_pred             cCCCCCcceEEEEechh--h-------------------------hhhccCcchheeEEEeEeeCCC
Q psy1710          35 IGEGAYGMVVSEAPMKK--L-------------------------LQKGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        35 IG~GAYG~VcSA~D~~~--~-------------------------~~~~~~~~~~~~~~~~~~~~~~   74 (77)
                      ||.|+||.|+.|.|...  .                         ..+.+ .|+|++.+++.+..+.
T Consensus         1 lg~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~~e~~~l~~l-~h~~i~~~~~~~~~~~   66 (262)
T cd05572           1 LGVGGFGRVELVKVKSKNRTFALKCVKKRHIVETGQQEHIFSEKEILEEC-NHPFIVKLYRTFKDKK   66 (262)
T ss_pred             CCCCCceEEEEEEECCCCcEEEEEEEehhcchhhhHHHHHHHHHHHHHhC-CCCCEeeeeeeEEcCC
Confidence            68899999999988621  0                         11445 6889999999876553


No 340
>KOG0198|consensus
Probab=85.78  E-value=0.5  Score=36.20  Aligned_cols=25  Identities=20%  Similarity=0.365  Sum_probs=22.1

Q ss_pred             CCCcccccccCCCCCcceEEEEech
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      +.++...+.||+|+||.|+.|.+++
T Consensus        16 ~~~~~~~~~lG~Gs~G~V~l~~~~~   40 (313)
T KOG0198|consen   16 ISNWSKGKLLGRGSFGSVYLATNKK   40 (313)
T ss_pred             cchhhhhccccCccceEEEEEEecC
Confidence            5678889999999999999998874


No 341
>KOG0671|consensus
Probab=85.18  E-value=1.3  Score=35.73  Aligned_cols=27  Identities=30%  Similarity=0.503  Sum_probs=24.2

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK   51 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~   51 (77)
                      +..||..++.+|+|.||.|+...|...
T Consensus        87 l~~Ry~i~~~lGeGtFGkV~ec~D~~~  113 (415)
T KOG0671|consen   87 LTNRYEIVDLLGEGTFGKVVECWDRET  113 (415)
T ss_pred             cccceehhhhhcCCcccceEEEeecCC
Confidence            488999999999999999999888754


No 342
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=85.11  E-value=0.6  Score=32.05  Aligned_cols=44  Identities=18%  Similarity=0.363  Sum_probs=31.2

Q ss_pred             cccccccCCCCCcceEEEEechh--h-----hh------------------hccCcchheeEEEeEeeC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKK--L-----LQ------------------KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~--~-----~~------------------~~~~~~~~~~~~~~~~~~   72 (77)
                      |+..+.||.|+||.|+.|.+..+  .     +.                  +.+..|+|++.+++.+..
T Consensus         1 y~~~~~ig~g~~g~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~~~~~h~~i~~~~~~~~~   69 (283)
T cd07830           1 YKVIKQLGDGTFGSVYLARNKETGELVAIKKMKKKFYSWEECMNLREVKSLRKLNEHPNIVKLKEVFRE   69 (283)
T ss_pred             CeeheeeccCCceEEEEEEECCCCcEEEEEEehhhccchhHHHHHHHHHHHHhccCCCCchhHHHHhhc
Confidence            67788999999999999987431  1     00                  233237888888877655


No 343
>KOG0592|consensus
Probab=84.97  E-value=1.1  Score=37.48  Aligned_cols=24  Identities=25%  Similarity=0.339  Sum_probs=21.7

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      +..|.+-+.||.|+|..|+.|.|+
T Consensus        72 ~~DF~Fg~~lGeGSYStV~~A~~~   95 (604)
T KOG0592|consen   72 PNDFKFGKILGEGSYSTVVLAREK   95 (604)
T ss_pred             hhhcchhheeccccceeEEEeeec
Confidence            567899999999999999999877


No 344
>KOG0670|consensus
Probab=84.69  E-value=0.57  Score=39.71  Aligned_cols=37  Identities=19%  Similarity=0.254  Sum_probs=29.6

Q ss_pred             CCceEEeecceEEEeCCCcccccccCCCCCcceEEEEech
Q psy1710          11 LAGNAELVRGQTFEVGPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        11 ~~~~~~~v~~~~f~V~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      .+||.+.+..   .+..||...-..|+|-|+.||.|.|.+
T Consensus       419 EGYYrv~igE---~LD~RY~V~~~~GkGvFs~Vvra~D~~  455 (752)
T KOG0670|consen  419 EGYYRVRIGE---LLDSRYEVQGYTGKGVFSTVVRARDQA  455 (752)
T ss_pred             cceEEEehhh---hhcceeEEEeccccceeeeeeeccccC
Confidence            4555555543   367899999999999999999999874


No 345
>KOG1026|consensus
Probab=84.65  E-value=0.44  Score=40.89  Aligned_cols=25  Identities=28%  Similarity=0.414  Sum_probs=18.6

Q ss_pred             EEeCC-CcccccccCCCCCcceEEEE
Q psy1710          23 FEVGP-RYTNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        23 f~V~~-RY~~lk~IG~GAYG~VcSA~   47 (77)
                      .+++. .-+..+.||+||||.|++|.
T Consensus       481 ~~i~r~~i~~~~eLGegaFGkVf~a~  506 (774)
T KOG1026|consen  481 LEIPRSDIVFKEELGEGAFGKVFLAE  506 (774)
T ss_pred             eEechhheeehhhhcCchhhhhhhhh
Confidence            44433 23567899999999999984


No 346
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=84.39  E-value=1.6  Score=29.95  Aligned_cols=38  Identities=21%  Similarity=0.256  Sum_probs=26.4

Q ss_pred             ccCCCCCcceEEEEec--h-------h-------------h-----hhhccCcchheeEEEeEeeC
Q psy1710          34 YIGEGAYGMVVSEAPM--K-------K-------------L-----LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        34 ~IG~GAYG~VcSA~D~--~-------~-------------~-----~~~~~~~~~~~~~~~~~~~~   72 (77)
                      .||+|+||.|+.|.++  .       |             +     +.+.+ .|+|+|.+++++-.
T Consensus         2 ~ig~G~~g~v~~~~~~~~~~~~~vavk~~~~~~~~~~~~~~~~E~~~l~~l-~h~~ii~~~~~~~~   66 (257)
T cd05115           2 ELGSGNFGCVKKGVYKMRKKQIDVAIKVLKNENEKSVRDEMMREAEIMHQL-DNPYIVRMIGVCEA   66 (257)
T ss_pred             ccCCCCcccEEEEEEecCCCceeEEEEEcccccChHHHHHHHHHHHHHHhc-CCCCeEEEEEEEcC
Confidence            3899999999987542  0       0             0     11456 78999999987643


No 347
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=84.29  E-value=0.67  Score=31.62  Aligned_cols=40  Identities=18%  Similarity=0.167  Sum_probs=28.3

Q ss_pred             cccccCCCCCcceEEEEechh---------h-------------------hhhccCcchheeEEEeEee
Q psy1710          31 NLAYIGEGAYGMVVSEAPMKK---------L-------------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        31 ~lk~IG~GAYG~VcSA~D~~~---------~-------------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      ..+.||+|+||.|+.|.+...         .                   ..+.+ .|.|++.+++.++
T Consensus         3 i~~~ig~G~~g~V~~~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~~E~~~l~~l-~h~~iv~~~~~~~   70 (272)
T cd05075           3 LGKTLGEGEFGSVMEGQLNQDDSILKVAVKTMKIAICTRSEMEDFLSEAVCMKEF-DHPNVMRLIGVCL   70 (272)
T ss_pred             cccccCcccCceEEEeEEccCCCeeeEEEEecccCcCCHHHHHHHHHHHHHHHhC-CCCCcceEEEEEc
Confidence            457899999999998864321         1                   01445 6889999998654


No 348
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=84.16  E-value=0.78  Score=31.83  Aligned_cols=21  Identities=33%  Similarity=0.543  Sum_probs=18.2

Q ss_pred             CcccccccCCCCCcceEEEEe
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAP   48 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D   48 (77)
                      .|+..+.||+|+||.|+.|.+
T Consensus         1 ~~~~~~~ig~G~~~~vy~~~~   21 (288)
T cd05583           1 NFELLRVLGTGAYGKVFLVRK   21 (288)
T ss_pred             CceEEEEeccCCCceEEEEEE
Confidence            377889999999999998864


No 349
>PRK10345 hypothetical protein; Provisional
Probab=83.65  E-value=0.91  Score=32.33  Aligned_cols=45  Identities=11%  Similarity=0.038  Sum_probs=28.7

Q ss_pred             cccccccCCCCCcceEEEEec----------------hhh---------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPM----------------KKL---------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~----------------~~~---------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ....+.||+|+||.||.-.+.                ..+         +++....++|++.+|++|-..
T Consensus         4 L~~~~~LG~G~~~~Vy~hp~~~~k~IKv~~~~~~~~~~~~~rEi~~l~~L~~~~~~h~nIvr~yg~~et~   73 (210)
T PRK10345          4 LSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLSRRLIDWSGIPRYYGTVETD   73 (210)
T ss_pred             cCCcceecCCCceEEEECCCCcCeEEEEEeccccchHHHHHHHHHHHHHhhccCCCCcccceeeEEEEeC
Confidence            456788999999999741100                011         111123689999999988654


No 350
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=83.45  E-value=0.85  Score=30.53  Aligned_cols=45  Identities=13%  Similarity=0.319  Sum_probs=32.8

Q ss_pred             CcccccccCCCCCcceEEEEechh---------------------hhh-----hccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMKK---------------------LLQ-----KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~~---------------------~~~-----~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|+..+.||.|+||.|+.|.+...                     ++.     +.+ +|+|++.+++.+...
T Consensus         1 ~y~~~~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   71 (256)
T cd08530           1 DFKVLKKLGKGSYGSVYKVKRLSDNQFYALKEVDLGSMSQKEREDAVNEIRILASV-NHPNIISYKEAFLDG   71 (256)
T ss_pred             CceEeeeecCCCceeEEEEEECCCCCEEEEEEEehhhccHHHHHHHHHHHHHHHhC-CCCCchhhhhhhccC
Confidence            588899999999999999875411                     001     445 588999888877653


No 351
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=83.43  E-value=0.8  Score=31.50  Aligned_cols=44  Identities=30%  Similarity=0.365  Sum_probs=32.0

Q ss_pred             cccccccCCCCCcceEEEEech-------hhh-------------------hhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK-------KLL-------------------QKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~-------~~~-------------------~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |+.++.||.|++|.|+.|.++.       |++                   -+.+ .|+|++.+++.+...
T Consensus         1 y~~~~~l~~g~~~~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~E~~~l~~l-~~~~iv~~~~~~~~~   70 (283)
T cd07835           1 YQKVEKIGEGTYGVVYKARDKLTGEIVALKKIRLETEDEGVPSTAIREISLLKEL-NHPNIVRLLDVVHSE   70 (283)
T ss_pred             CchheEecCCCCeEEEEEEEcCCCCEEEEEEeecccccccchhHHHHHHHHHHhc-CCCCccCHhheeccC
Confidence            6778899999999999998752       111                   1344 588999888876543


No 352
>KOG0694|consensus
Probab=83.38  E-value=0.85  Score=38.82  Aligned_cols=47  Identities=26%  Similarity=0.381  Sum_probs=35.3

Q ss_pred             CCcccccccCCCCCcceEEEEec-------------hhhhh--------------hccCcchheeEEEeEeeCC
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPM-------------KKLLQ--------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~-------------~~~~~--------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      +.+..++.||+|.||.|..|..+             ..|||              .-+..|+-|++||.-|=.+
T Consensus       368 ~~F~~l~vLGkGsFGkV~lae~k~~~e~yAIK~LKK~~Il~~d~Ve~~~~EkrI~~la~~HPFL~~L~~~fQT~  441 (694)
T KOG0694|consen  368 DDFRLLAVLGRGSFGKVLLAELKGTNEYYAIKVLKKGDILQRDEVESLMCEKRIFELANRHPFLVNLFSCFQTK  441 (694)
T ss_pred             cceEEEEEeccCcCceEEEEEEcCCCcEEEEEEeeccceeccccHHHHHHHHHHHHHhccCCeEeecccccccC
Confidence            45788999999999999887654             22333              4566889999999877544


No 353
>KOG0612|consensus
Probab=82.54  E-value=0.51  Score=42.48  Aligned_cols=24  Identities=29%  Similarity=0.425  Sum_probs=20.8

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .+.|..++.||+||||.|+....+
T Consensus        74 ~~DfeilKvIGrGaFGEV~lVr~k   97 (1317)
T KOG0612|consen   74 AEDFEILKVIGRGAFGEVALVRHK   97 (1317)
T ss_pred             HHhhHHHHHhcccccceeEEEEee
Confidence            467999999999999999987664


No 354
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=82.29  E-value=0.89  Score=30.92  Aligned_cols=16  Identities=31%  Similarity=0.551  Sum_probs=13.7

Q ss_pred             cccCCCCCcceEEEEe
Q psy1710          33 AYIGEGAYGMVVSEAP   48 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D   48 (77)
                      +.||+|+||.|++|.+
T Consensus         1 ~~ig~G~~g~v~~~~~   16 (257)
T cd05060           1 KELGHGNFGSVVKGVY   16 (257)
T ss_pred             CccCccCceeEEEeEe
Confidence            4699999999998864


No 355
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=81.92  E-value=1  Score=30.61  Aligned_cols=45  Identities=27%  Similarity=0.348  Sum_probs=32.8

Q ss_pred             CcccccccCCCCCcceEEEEech------h------------------h-----hhhccCcchheeEEEeEeeCC
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK------K------------------L-----LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~------~------------------~-----~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      +|+..+.||.|.||.|+.|.+..      |                  +     .-+.+ .|+|++.+++.+...
T Consensus         1 ~~~~~~~ig~g~~~~v~~~~~~~~~~~avk~~~~~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   74 (265)
T cd06631           1 EWTKGEVLGKGAYGTVYCGLTNQGQLIAVKQVELDTSNVLAAEKEYEKLQEEVDLLKSL-KHVNIVQYLGTCLDD   74 (265)
T ss_pred             CccccceEeccCCeEEEEEEEcCCCeEEEEEeecCccchhhHHHHHHHHHHHHHHHHhc-CCCCEeeEeeEeecC
Confidence            47778899999999999986521      1                  0     01455 578999999987654


No 356
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=80.76  E-value=1.1  Score=30.16  Aligned_cols=17  Identities=12%  Similarity=0.302  Sum_probs=14.6

Q ss_pred             cccCCCCCcceEEEEec
Q psy1710          33 AYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~   49 (77)
                      +.||+|+||.|++|.+.
T Consensus         1 ~~lg~G~~~~v~~~~~~   17 (259)
T cd05037           1 EHLGQGTFTNIYKGVLR   17 (259)
T ss_pred             CcccccccceEEEEEEe
Confidence            36899999999999875


No 357
>KOG0616|consensus
Probab=80.51  E-value=1.9  Score=34.16  Aligned_cols=24  Identities=21%  Similarity=0.335  Sum_probs=20.0

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .+.|+.++.||.|+||.|...+++
T Consensus        43 l~dfe~~~tlGtGSFGrV~LVr~k   66 (355)
T KOG0616|consen   43 LQDFERLKTLGTGSFGRVHLVREK   66 (355)
T ss_pred             hhhhhheeeeccCccceEEEEEEc
Confidence            345889999999999999877655


No 358
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=80.24  E-value=1.2  Score=30.17  Aligned_cols=18  Identities=17%  Similarity=0.025  Sum_probs=16.0

Q ss_pred             ccccCCCCCcceEEEEec
Q psy1710          32 LAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~D~   49 (77)
                      .++||+|++|.||.|.+.
T Consensus         2 ~~~ig~G~~~~Vy~a~~~   19 (190)
T cd05145           2 NGCISTGKEANVYHARTG   19 (190)
T ss_pred             CceeecCCCcEEEEEEcC
Confidence            468999999999999875


No 359
>KOG2345|consensus
Probab=79.87  E-value=0.75  Score=35.63  Aligned_cols=29  Identities=28%  Similarity=0.436  Sum_probs=23.9

Q ss_pred             cceEEEeCCCcccccccCCCCCcceEEEE
Q psy1710          19 RGQTFEVGPRYTNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        19 ~~~~f~V~~RY~~lk~IG~GAYG~VcSA~   47 (77)
                      .++.+.-..||...+.+|+|.|..|....
T Consensus        13 ~~tv~In~~Ryri~~~LgeGGfsfv~LV~   41 (302)
T KOG2345|consen   13 RGTVIINNKRYRIQRLLGEGGFSFVDLVK   41 (302)
T ss_pred             CCcEEEcCceEEEeeeecCCCceeeeeec
Confidence            45567678999999999999999886654


No 360
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=79.66  E-value=1.2  Score=29.25  Aligned_cols=18  Identities=22%  Similarity=-0.010  Sum_probs=15.9

Q ss_pred             ccccCCCCCcceEEEEec
Q psy1710          32 LAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~D~   49 (77)
                      .+.||+|+||.||.|.+.
T Consensus         2 ~~~lg~G~~g~Vy~a~~~   19 (187)
T cd05119           2 GGPIGTGKEADVYLALDG   19 (187)
T ss_pred             CcccccccceeEEEEECC
Confidence            467999999999999876


No 361
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=79.23  E-value=1.3  Score=30.23  Aligned_cols=44  Identities=27%  Similarity=0.378  Sum_probs=31.2

Q ss_pred             cccccccCCCCCcceEEEEechhh--------------------------hhhccCcchheeEEEeEeeCC
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMKKL--------------------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      |...+.||.|.+|.|+.|.+...-                          ..+-+ .|+|++.+++.+..+
T Consensus         1 y~~~~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   70 (283)
T cd05118           1 YQKLGKIGEGTYGVVYKARDKLTGEIVAIKKIKLRFESEGIPKTALREIKLLKEL-NHPNIIKLLDVFRHK   70 (283)
T ss_pred             CccceeeecCCCceEEEEEcCCCCcEEEEEEeccccccchhHHHHHHHHHHHHHh-cCCCcchHHHhhccC
Confidence            667889999999999999864210                          01334 478888888876654


No 362
>KOG0582|consensus
Probab=78.99  E-value=2  Score=35.53  Aligned_cols=47  Identities=17%  Similarity=0.139  Sum_probs=36.1

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh-------------------hh-----hccCcchheeEEEeEeeC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL-------------------LQ-----KGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~-------------------~~-----~~~~~~~~~~~~~~~~~~   72 (77)
                      .+.|+....||.|+-++|+.|+...+-                   ++     -++=.|+|||..|-.|+-
T Consensus        25 ~~~YeL~e~IG~G~sa~V~~A~c~p~~e~VAIK~inLEkc~~~ld~l~kE~~~msl~~HPNIv~~~~sFvv   95 (516)
T KOG0582|consen   25 AKDYELQEVIGVGASAVVYLARCIPTNEVVAIKIINLEKCNNDLDALRKEVQTMSLIDHPNIVTYHCSFVV   95 (516)
T ss_pred             ccceeEEEEEeccceeEeeeeeecccCCEEEEEEeehhhhhhhHHHHHHHHHHhhhcCCCCcceEEEEEEe
Confidence            578999999999999999999866332                   22     233379999999876653


No 363
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=78.24  E-value=1.3  Score=31.34  Aligned_cols=47  Identities=19%  Similarity=0.342  Sum_probs=32.7

Q ss_pred             eCCCcccccccCCCCCcceEEEEechh-------h-----------------hhhccCcchheeEEEeEeeC
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAPMKK-------L-----------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D~~~-------~-----------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      +..-|.....||.|+||.||.|.|...       .                 ..+.+ .|+|++.+++.+..
T Consensus        19 ~~~~~~~~~~ig~g~~g~v~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~e~~~l~~l-~hp~i~~~~~~~~~   89 (297)
T cd06659          19 PRSLLENYIKIGEGSTGIVCIAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDY-QHQNVVEMYKSYLV   89 (297)
T ss_pred             chhhHHhhhhcCCCCceeEEEEEEcCCCCEEEEEEEEecccchHHHHHHHHHHHHhC-CCCchhhhhhheee
Confidence            344466777899999999999987521       1                 11445 58888888876653


No 364
>KOG0574|consensus
Probab=77.67  E-value=0.24  Score=39.75  Aligned_cols=22  Identities=27%  Similarity=0.487  Sum_probs=18.8

Q ss_pred             CcccccccCCCCCcceEEEEec
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      -|..+..||+|+||.|++|+++
T Consensus        34 VFDi~~KLGEGSYGSV~KAIH~   55 (502)
T KOG0574|consen   34 VFDIVGKLGEGSYGSVHKAIHR   55 (502)
T ss_pred             HHHHHHHhcCCcchHHHHHHHh
Confidence            3667889999999999999776


No 365
>smart00090 RIO RIO-like kinase.
Probab=76.00  E-value=1.5  Score=31.36  Aligned_cols=20  Identities=15%  Similarity=-0.059  Sum_probs=18.1

Q ss_pred             CcccccccCCCCCcceEEEE
Q psy1710          28 RYTNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~   47 (77)
                      -|...++||+|++|.||.|.
T Consensus        29 ~~~i~~~Lg~G~~g~Vy~a~   48 (237)
T smart00090       29 LSAIGGCISTGKEANVYHAL   48 (237)
T ss_pred             hHHhCCeeccCcceeEEEEE
Confidence            36778999999999999998


No 366
>KOG2052|consensus
Probab=75.72  E-value=1.2  Score=36.61  Aligned_cols=39  Identities=18%  Similarity=0.158  Sum_probs=27.8

Q ss_pred             CCcccccccCCCCCcceEEEEe--------------------chhhhhhccCcchheeE
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAP--------------------MKKLLQKGAGTNEQLVL   65 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D--------------------~~~~~~~~~~~~~~~~~   65 (77)
                      ..-..++.||+|-||.|+.+.-                    ..+|||--+=.|||+..
T Consensus       211 rqI~L~e~IGkGRyGEVwrG~wrGe~VAVKiF~srdE~SWfrEtEIYqTvmLRHENILg  269 (513)
T KOG2052|consen  211 RQIVLQEIIGKGRFGEVWRGRWRGEDVAVKIFSSRDERSWFRETEIYQTVMLRHENILG  269 (513)
T ss_pred             heeEEEEEecCccccceeeccccCCceEEEEecccchhhhhhHHHHHHHHHhccchhhh
Confidence            3456778999999999977532                    26778855557788753


No 367
>PHA02988 hypothetical protein; Provisional
Probab=75.69  E-value=2.5  Score=29.83  Aligned_cols=39  Identities=13%  Similarity=0.125  Sum_probs=28.5

Q ss_pred             cccCCCCCcceEEEEechhh-------------------------hhhccCcchheeEEEeEeeC
Q psy1710          33 AYIGEGAYGMVVSEAPMKKL-------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~~~-------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ..||+|.+|.|+.|.+..+.                         .-+.+ .|+|+|.++.++..
T Consensus        26 ~~i~~g~~~~v~~~~~~~~~vavK~~~~~~~~~~~~~~~~~~E~~~l~~l-~h~nIv~~~g~~~~   89 (283)
T PHA02988         26 VLIKENDQNSIYKGIFNNKEVIIRTFKKFHKGHKVLIDITENEIKNLRRI-DSNNILKIYGFIID   89 (283)
T ss_pred             eEEeeCCceEEEEEEECCEEEEEEeccccccccHHHHHHHHHHHHHHHhc-CCCCEEEEeeeEEe
Confidence            56899999999888654322                         11445 68899999998875


No 368
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=74.99  E-value=2  Score=29.99  Aligned_cols=40  Identities=23%  Similarity=0.347  Sum_probs=27.7

Q ss_pred             ccCCCCCcceEEEEechh-------hh---------------------h-hccCcchheeEEEeEeeCC
Q psy1710          34 YIGEGAYGMVVSEAPMKK-------LL---------------------Q-KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        34 ~IG~GAYG~VcSA~D~~~-------~~---------------------~-~~~~~~~~~~~~~~~~~~~   73 (77)
                      .||+|+||.|+.|.+..+       .+                     + -..+.|.|++.+++.+...
T Consensus         1 ~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~   69 (279)
T cd05633           1 IIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTP   69 (279)
T ss_pred             CcccCCCeEEEEEEECCCCcEEEEEEEEccccccchHHHHHHHHHHHHHHHhhCCCCcEeEEEEEEecC
Confidence            489999999999887521       10                     0 1124678999999887654


No 369
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=74.11  E-value=2.1  Score=29.15  Aligned_cols=22  Identities=41%  Similarity=0.750  Sum_probs=18.6

Q ss_pred             cccccccCCCCCcceEEEEech
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      |+..+.||.|.||.|+.|.+..
T Consensus         1 y~~~~~ig~g~~~~vy~~~~~~   22 (282)
T cd07829           1 YEKLEKLGEGTYGVVYKARDKK   22 (282)
T ss_pred             CeeehcccccCcceEEEeeecC
Confidence            5677889999999999987763


No 370
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=74.04  E-value=2.2  Score=29.72  Aligned_cols=41  Identities=22%  Similarity=0.339  Sum_probs=28.2

Q ss_pred             ccCCCCCcceEEEEechh-------h---------------------hh-hccCcchheeEEEeEeeCCC
Q psy1710          34 YIGEGAYGMVVSEAPMKK-------L---------------------LQ-KGAGTNEQLVLLYMWWISPT   74 (77)
Q Consensus        34 ~IG~GAYG~VcSA~D~~~-------~---------------------~~-~~~~~~~~~~~~~~~~~~~~   74 (77)
                      .||+|+||.|+.|.+..+       +                     ++ .+.+.|+|++.+++.+.++.
T Consensus         1 ~ig~g~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~   70 (278)
T cd05606           1 IIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPD   70 (278)
T ss_pred             CcccCCCeEEEEEEEecCCCEEEEEEeeccccccchhHHHHHHHHHHHHHHHhCCCCcEeeeeeeeecCC
Confidence            489999999999987421       0                     00 11247899999988876543


No 371
>PRK14879 serine/threonine protein kinase; Provisional
Probab=72.88  E-value=2.4  Score=28.29  Aligned_cols=16  Identities=19%  Similarity=0.196  Sum_probs=14.1

Q ss_pred             ccccCCCCCcceEEEE
Q psy1710          32 LAYIGEGAYGMVVSEA   47 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~   47 (77)
                      ++.||+|++|.||.|.
T Consensus         1 ~~~l~~G~~~~vy~~~   16 (211)
T PRK14879          1 MKLIKRGAEAEIYLGD   16 (211)
T ss_pred             CcccccCceEEEEEEe
Confidence            4679999999999995


No 372
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=72.66  E-value=1.5  Score=30.94  Aligned_cols=50  Identities=18%  Similarity=0.255  Sum_probs=35.5

Q ss_pred             EEEeCCCcccccccCCCCCcceEEEEechhh------------------------hhhccCcchheeEEEeEeeC
Q psy1710          22 TFEVGPRYTNLAYIGEGAYGMVVSEAPMKKL------------------------LQKGAGTNEQLVLLYMWWIS   72 (77)
Q Consensus        22 ~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~~------------------------~~~~~~~~~~~~~~~~~~~~   72 (77)
                      ..+..+.|.....||.|+||.||.|.+..+-                        ..+.+ .|+|++.+++.+..
T Consensus        17 ~~~~~~~~~~~~~lg~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~e~~~l~~l-~h~~ii~~~~~~~~   90 (292)
T cd06658          17 PGDPREYLDSFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDY-HHENVVDMYNSYLV   90 (292)
T ss_pred             cCchHHHHhhhhcccCCCCeEEEEEEECCCCCEEEEEEEecchHHHHHHHHHHHHHHHhC-CCCcHHHHHHheec
Confidence            3455677777888999999999999874211                        11445 68898888876654


No 373
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=70.86  E-value=2.8  Score=28.84  Aligned_cols=18  Identities=17%  Similarity=0.099  Sum_probs=15.6

Q ss_pred             ccccCCCCCcceEEEEec
Q psy1710          32 LAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        32 lk~IG~GAYG~VcSA~D~   49 (77)
                      ...||+|++|.|+.|.+.
T Consensus         2 ~~~ig~G~~~~Vy~a~~~   19 (190)
T cd05147           2 NGCISTGKEANVYHATTA   19 (190)
T ss_pred             CCccccccceEEEEEECC
Confidence            357999999999999875


No 374
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=69.62  E-value=3.7  Score=26.49  Aligned_cols=21  Identities=33%  Similarity=0.536  Sum_probs=18.8

Q ss_pred             cccccccCCCCCcceEEEEec
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~   49 (77)
                      |...+.||.|+||.|+.|.+.
T Consensus         2 ~~~~~~l~~g~~~~v~~~~~~   22 (384)
T COG0515           2 YRILRKLGEGSFGEVYLARDR   22 (384)
T ss_pred             ceeEEeecCCCCeEEEEEEec
Confidence            677888999999999999887


No 375
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=69.28  E-value=3.2  Score=27.94  Aligned_cols=21  Identities=19%  Similarity=-0.078  Sum_probs=18.5

Q ss_pred             cccccccCCCCCcceEEEEec
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~   49 (77)
                      |...+.||+|++|.|+.|.+.
T Consensus        17 ~~~~~~i~~G~~g~Vy~~~~~   37 (198)
T cd05144          17 ESLGNQIGVGKESDVYLALDP   37 (198)
T ss_pred             hhcCCccccCcceEEEEEEcC
Confidence            777899999999999999774


No 376
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=68.21  E-value=3.6  Score=28.37  Aligned_cols=38  Identities=18%  Similarity=0.306  Sum_probs=26.6

Q ss_pred             cCCCCCcceEEEEechh-------------h--------------hhhccCcchheeEEEeEeeCC
Q psy1710          35 IGEGAYGMVVSEAPMKK-------------L--------------LQKGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        35 IG~GAYG~VcSA~D~~~-------------~--------------~~~~~~~~~~~~~~~~~~~~~   73 (77)
                      ||+|+||.||.|.+..+             +              +-+.+ .|+|++.+++.+...
T Consensus         1 lg~g~~g~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~e~~~l~~l-~~~~i~~~~~~~~~~   65 (277)
T cd05577           1 LGKGGFGEVCACQVKATGKMYACKKLDKKRLKKRKGEQMALNEKKILEKV-SSRFIVSLAYAFETK   65 (277)
T ss_pred             CCCCCceeEEEEEEcCCCcEEEEEEEehhhhhhhhhhHHHHHHHHHHHhC-CCCCEeeeeeEEecC
Confidence            68999999999876521             0              01344 489999999887653


No 377
>KOG1165|consensus
Probab=65.85  E-value=5.6  Score=32.26  Aligned_cols=46  Identities=30%  Similarity=0.521  Sum_probs=33.7

Q ss_pred             EEEeCCCcccccccCCCCCcceEEEEechh-----------------h---hh--hccCcchheeEEE
Q psy1710          22 TFEVGPRYTNLAYIGEGAYGMVVSEAPMKK-----------------L---LQ--KGAGTNEQLVLLY   67 (77)
Q Consensus        22 ~f~V~~RY~~lk~IG~GAYG~VcSA~D~~~-----------------~---~~--~~~~~~~~~~~~~   67 (77)
                      ...|...|..=++||+|+||+.+...+.-.                 |   |.  |-+|.||.+-+.|
T Consensus        23 ~~~VG~hyrVGkKIGeGsFG~lf~G~Nl~nne~VAIKfEPrkS~APQLrdEYr~YKlL~g~~GIP~vY   90 (449)
T KOG1165|consen   23 VLMVGPHYRVGKKIGEGSFGVLFLGKNLYNNEPVAIKFEPRKSEAPQLRDEYRTYKLLGGTEGIPQVY   90 (449)
T ss_pred             ceEecccceeccccccCcceeeecccccccCceEEEEeccccCCcchHHHHHHHHHHHcCCCCCCcee
Confidence            456888999999999999999977644311                 1   11  7788888877665


No 378
>KOG0033|consensus
Probab=65.61  E-value=1.8  Score=33.91  Aligned_cols=22  Identities=23%  Similarity=0.392  Sum_probs=17.9

Q ss_pred             eCCCcccccccCCCCCcceEEE
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSE   46 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA   46 (77)
                      ..+.|+.-..||+|+|.+|...
T Consensus         9 f~d~y~l~e~igkG~FSvVrRc   30 (355)
T KOG0033|consen    9 FSDNYDVKEELGKGAFSVVRRC   30 (355)
T ss_pred             cchhhhHHHHHccCchHHHHHH
Confidence            4567999999999999988443


No 379
>KOG0607|consensus
Probab=65.24  E-value=1.3  Score=35.77  Aligned_cols=39  Identities=21%  Similarity=0.407  Sum_probs=26.8

Q ss_pred             cccCCCCCcceEEEEec-------hhhhh-----------------hccCcchheeEEEeEee
Q psy1710          33 AYIGEGAYGMVVSEAPM-------KKLLQ-----------------KGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~-------~~~~~-----------------~~~~~~~~~~~~~~~~~   71 (77)
                      ..||+|||+.|--+.+.       .||..                 ++--.|.|+++|.+||=
T Consensus        84 e~LGeGAyasVqtcv~i~t~~EYAVKiidKq~gHsR~RvfREVe~f~~Cqgh~nilqLiefFE  146 (463)
T KOG0607|consen   84 ELLGEGAYASVQTCVSIQTGKEYAVKIIDKQPGHSRSRVFREVETFYQCQGHKNILQLIEFFE  146 (463)
T ss_pred             HHhcCccceeeeeeeeeccchhhhhhhhhcCCchHHHHHHHHHHHHHHhcCCccHHHHHHHhc
Confidence            67999999998555433       23321                 45556789999988873


No 380
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=61.77  E-value=6.4  Score=25.46  Aligned_cols=22  Identities=32%  Similarity=0.403  Sum_probs=18.0

Q ss_pred             cccccccCCCCCcceEEEEech
Q psy1710          29 YTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      |...+.||.|.+|.|+.|.+..
T Consensus         1 ~~~~~~i~~g~~~~v~~~~~~~   22 (225)
T smart00221        1 YELGKKLGEGAFGKVYLARDKG   22 (225)
T ss_pred             CceeeEeecCCCeEEEEEEEcC
Confidence            4566789999999999998754


No 381
>KOG4721|consensus
Probab=58.97  E-value=5.9  Score=34.35  Aligned_cols=46  Identities=20%  Similarity=0.367  Sum_probs=31.4

Q ss_pred             EEEeC-CCcccccccCCCCCcceEEEEech------hh--hh-------hccCcchheeEEEe
Q psy1710          22 TFEVG-PRYTNLAYIGEGAYGMVVSEAPMK------KL--LQ-------KGAGTNEQLVLLYM   68 (77)
Q Consensus        22 ~f~V~-~RY~~lk~IG~GAYG~VcSA~D~~------~~--~~-------~~~~~~~~~~~~~~   68 (77)
                      .|+|| +--..+.+||.||.|-|++..-..      |.  |.       ||+ .|+|+|..--
T Consensus       118 ~WeiPFe~IsELeWlGSGaQGAVF~Grl~netVAVKKV~elkETdIKHLRkL-kH~NII~FkG  179 (904)
T KOG4721|consen  118 LWEIPFEEISELEWLGSGAQGAVFLGRLHNETVAVKKVRELKETDIKHLRKL-KHPNIITFKG  179 (904)
T ss_pred             hccCCHHHhhhhhhhccCcccceeeeeccCceehhHHHhhhhhhhHHHHHhc-cCcceeeEee
Confidence            46665 233567999999999999975332      22  11       667 8999997643


No 382
>KOG1167|consensus
Probab=57.92  E-value=1.7  Score=35.14  Aligned_cols=27  Identities=22%  Similarity=0.436  Sum_probs=23.7

Q ss_pred             EeCCCcccccccCCCCCcceEEEEech
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      .+..-|..+.+||+|.|++|++|.|..
T Consensus        33 ~~~~~~~~v~kigeGsFssv~~a~~~~   59 (418)
T KOG1167|consen   33 FISNAYKVVNKIGEGSFSSVYKATDIE   59 (418)
T ss_pred             hhhhhhhhhccccccchhhhhhhhHhh
Confidence            356678899999999999999998887


No 383
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=56.76  E-value=7.6  Score=30.74  Aligned_cols=21  Identities=24%  Similarity=0.188  Sum_probs=17.1

Q ss_pred             CCcccccccCCCCCcceEEEE
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~   47 (77)
                      .+|...+.||+|+||.|+.+.
T Consensus       333 ~~~~~~~~iG~G~~g~Vy~~~  353 (535)
T PRK09605        333 RRKIPDHLIGKGAEADIKKGE  353 (535)
T ss_pred             cccCccceeccCCcEEEEEEe
Confidence            345667899999999999954


No 384
>KOG0669|consensus
Probab=55.46  E-value=1.4  Score=34.72  Aligned_cols=26  Identities=31%  Similarity=0.572  Sum_probs=22.3

Q ss_pred             EeCCCcccccccCCCCCcceEEEEec
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .....|+.+..+|+|.||.|++|+.+
T Consensus        14 ~~~~~yek~~kigqGtfgeVFkAr~~   39 (376)
T KOG0669|consen   14 DEVSKYEKLAKIGQGTFGEVFKARSK   39 (376)
T ss_pred             ecchHHHHHHhcCCchHHHHHHHhhc
Confidence            34568999999999999999999755


No 385
>KOG1166|consensus
Probab=55.34  E-value=6.8  Score=34.61  Aligned_cols=28  Identities=39%  Similarity=0.649  Sum_probs=22.4

Q ss_pred             EEe-CCCcccccccCCCCCcceEEEEech
Q psy1710          23 FEV-GPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        23 f~V-~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      +++ ...|..-+.+|+|+||.||.|.+..
T Consensus       693 ~~~~~~~~~I~~e~G~g~y~~vy~a~~~~  721 (974)
T KOG1166|consen  693 FEVGGEKFCISKEIGEGSYGSVYVATHSN  721 (974)
T ss_pred             eeecceeEEEEeeeccccceEEEEeecCC
Confidence            444 4567888999999999999997654


No 386
>KOG0604|consensus
Probab=53.99  E-value=10  Score=30.37  Aligned_cols=49  Identities=18%  Similarity=0.297  Sum_probs=37.3

Q ss_pred             EEEeCCCcc-cccccCCCCCcceEEEEechh-------hhh------------hccCcchheeEEEeEe
Q psy1710          22 TFEVGPRYT-NLAYIGEGAYGMVVSEAPMKK-------LLQ------------KGAGTNEQLVLLYMWW   70 (77)
Q Consensus        22 ~f~V~~RY~-~lk~IG~GAYG~VcSA~D~~~-------~~~------------~~~~~~~~~~~~~~~~   70 (77)
                      ...|.+.|. .++.||-|..|.|...+++.+       +|.            --+.+|+|+|.+-|+|
T Consensus        56 ~~~itedY~is~qvLG~GinGkV~~C~~k~T~ekfALKvL~Ds~KARrEVeLHw~~s~h~~iV~IidVy  124 (400)
T KOG0604|consen   56 EYSITEDYSISWQVLGAGINGKVVQCVHKRTQEKFALKVLLDSPKARREVELHWMASGHPHIVSIIDVY  124 (400)
T ss_pred             cccchhhheehhhhhccccCCceEEEEeccchhhhHHHHHhcCHHHHhHhhhhhhhcCCCceEEeehhh
Confidence            345777885 478999999999988887743       233            2356899999999987


No 387
>KOG0696|consensus
Probab=53.65  E-value=11  Score=31.62  Aligned_cols=24  Identities=21%  Similarity=0.479  Sum_probs=20.4

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      ...+..+..||+|+||-|-.|.-+
T Consensus       348 ~tDFnFl~VlGKGSFGKVlLaerk  371 (683)
T KOG0696|consen  348 ATDFNFLMVLGKGSFGKVLLAERK  371 (683)
T ss_pred             ecccceEEEeccCccceeeeeccc
Confidence            356889999999999999998654


No 388
>KOG0579|consensus
Probab=53.46  E-value=2  Score=37.64  Aligned_cols=27  Identities=19%  Similarity=0.404  Sum_probs=22.3

Q ss_pred             EeCCCcccccccCCCCCcceEEEEech
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      ++.+.++.+-.||-||||-|++|.++.
T Consensus        29 nP~d~WeIiGELGDGAFGKVyKA~nke   55 (1187)
T KOG0579|consen   29 NPRDHWEIIGELGDGAFGKVYKAVNKE   55 (1187)
T ss_pred             CHHHHHHHHhhhcCccchhhhhhhccc
Confidence            445667778889999999999998874


No 389
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=50.25  E-value=12  Score=24.94  Aligned_cols=15  Identities=40%  Similarity=0.585  Sum_probs=13.1

Q ss_pred             cCCCCCcceEEEEec
Q psy1710          35 IGEGAYGMVVSEAPM   49 (77)
Q Consensus        35 IG~GAYG~VcSA~D~   49 (77)
                      ||.|+||.|+.|.+.
T Consensus         1 lg~g~~~~vy~~~~~   15 (265)
T cd05579           1 ISKGAYGRVFLAKKK   15 (265)
T ss_pred             CCCCCceEEEEEEEC
Confidence            688999999999875


No 390
>KOG0603|consensus
Probab=50.08  E-value=13  Score=31.48  Aligned_cols=50  Identities=14%  Similarity=0.075  Sum_probs=35.7

Q ss_pred             CCCcccccccCCCCCcceEEEEechhh--------------hhhc------cCcchheeEEEeEeeCCCc
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMKKL--------------LQKG------AGTNEQLVLLYMWWISPTQ   75 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~~~--------------~~~~------~~~~~~~~~~~~~~~~~~~   75 (77)
                      .+.|.....+|.|+|+.|-...++.+-              .|++      -+.|+|++.+.|++-...+
T Consensus       321 ~~~y~~~~~~~~gs~s~~~~~~~~~t~~~~~vkii~~~~~~~~~e~~~~~~~~~h~niv~~~~v~~~~~~  390 (612)
T KOG0603|consen  321 TESYEFREELGEGSFSAVKYCESSPTDQEPAVKIISKRADDNQDEIPISLLVRDHPNIVKSHDVYEDGKE  390 (612)
T ss_pred             chhhccccccCCCCccceeeeeccccccchhheeccccccccccccchhhhhcCCCcceeecceecCCce
Confidence            566888778999999999666555333              2222      3689999999998866543


No 391
>KOG4278|consensus
Probab=48.22  E-value=9.9  Score=33.52  Aligned_cols=36  Identities=33%  Similarity=0.367  Sum_probs=26.2

Q ss_pred             cccCCCCCcceEEEEech--------hh----------hh-----hccCcchheeEEEeE
Q psy1710          33 AYIGEGAYGMVVSEAPMK--------KL----------LQ-----KGAGTNEQLVLLYMW   69 (77)
Q Consensus        33 k~IG~GAYG~VcSA~D~~--------~~----------~~-----~~~~~~~~~~~~~~~   69 (77)
                      .+||.|-||.||-.+-++        +|          |.     |-| .|.|+|||.-+
T Consensus       273 hKLGGGQYGeVYeGvWKkyslTvAVKtLKEDtMeveEFLkEAAvMKei-kHpNLVqLLGV  331 (1157)
T KOG4278|consen  273 HKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEI-KHPNLVQLLGV  331 (1157)
T ss_pred             eccCCCcccceeeeeeeccceeeehhhhhhcchhHHHHHHHHHHHHhh-cCccHHHHhhh
Confidence            579999999998775441        11          22     777 88999998654


No 392
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=46.64  E-value=13  Score=24.60  Aligned_cols=14  Identities=21%  Similarity=0.330  Sum_probs=12.5

Q ss_pred             ccCCCCCcceEEEE
Q psy1710          34 YIGEGAYGMVVSEA   47 (77)
Q Consensus        34 ~IG~GAYG~VcSA~   47 (77)
                      .||+|++|.|+.|.
T Consensus         1 ~ig~G~~~~vy~~~   14 (199)
T TIGR03724         1 LIAKGAEAIIYLGD   14 (199)
T ss_pred             CCCCCceEEEEEee
Confidence            48999999999997


No 393
>KOG0587|consensus
Probab=45.49  E-value=27  Score=31.11  Aligned_cols=47  Identities=26%  Similarity=0.444  Sum_probs=35.1

Q ss_pred             EeCCCcccccccCCCCCcceEEEEech-------hh-----------------hhhccCcchheeEEEeEee
Q psy1710          24 EVGPRYTNLAYIGEGAYGMVVSEAPMK-------KL-----------------LQKGAGTNEQLVLLYMWWI   71 (77)
Q Consensus        24 ~V~~RY~~lk~IG~GAYG~VcSA~D~~-------~~-----------------~~~~~~~~~~~~~~~~~~~   71 (77)
                      +..+-++....||.|.||-|+.+.++.       ||                 |+++- -|.||+-.|-.|+
T Consensus        16 dp~d~~ei~evig~Gtygkv~k~k~~~~~~~aa~kI~~~~~d~deEiE~eynil~~~~-~hpnv~~fyg~~~   86 (953)
T KOG0587|consen   16 DPADIFEIIEVIGNGTYGKVYKGRHVKTGQLAAIKIMDPTEDEEEEIELEYNMLKKYS-HHPNVATFYGAFI   86 (953)
T ss_pred             CCCCccEEEEEEeeccceeEEEEeeeecCceeeeEeecCCccccHHHHHHHHHHHhcc-CCCCcceEEEEEE
Confidence            445678889999999999999986552       11                 44444 8899999887764


No 394
>KOG1025|consensus
Probab=45.40  E-value=11  Score=33.74  Aligned_cols=19  Identities=26%  Similarity=0.455  Sum_probs=16.3

Q ss_pred             cccccccCCCCCcceEEEE
Q psy1710          29 YTNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA~   47 (77)
                      -.+.+.||.||||.|++..
T Consensus       698 lkk~kvLGsgAfGtV~kGi  716 (1177)
T KOG1025|consen  698 LKKDKVLGSGAFGTVYKGI  716 (1177)
T ss_pred             hhhhceeccccceeEEeee
Confidence            4567899999999999975


No 395
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=45.34  E-value=15  Score=27.05  Aligned_cols=24  Identities=4%  Similarity=-0.153  Sum_probs=21.7

Q ss_pred             eCCCcccccccCCCCCcceEEEEe
Q psy1710          25 VGPRYTNLAYIGEGAYGMVVSEAP   48 (77)
Q Consensus        25 V~~RY~~lk~IG~GAYG~VcSA~D   48 (77)
                      +..||..++.+|.|.+|.|+.+.+
T Consensus        29 l~~~y~~~~~l~~~~f~~v~l~~~   52 (232)
T PRK10359         29 LSYNIKTIKVFRNIDDTKVSLIDT   52 (232)
T ss_pred             hhCceEEEEEecCCCceEEEEEec
Confidence            478999999999999999999766


No 396
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=45.01  E-value=17  Score=22.46  Aligned_cols=15  Identities=33%  Similarity=0.638  Sum_probs=13.0

Q ss_pred             cCCCCCcceEEEEec
Q psy1710          35 IGEGAYGMVVSEAPM   49 (77)
Q Consensus        35 IG~GAYG~VcSA~D~   49 (77)
                      ||+|.+|.|+.+.+.
T Consensus         1 l~~g~~~~v~~~~~~   15 (215)
T cd00180           1 LGEGGFGTVYLARDK   15 (215)
T ss_pred             CCcCCceEEEEEEec
Confidence            689999999998876


No 397
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=44.00  E-value=18  Score=24.02  Aligned_cols=15  Identities=27%  Similarity=0.605  Sum_probs=12.6

Q ss_pred             cCCCCCcceEEEEec
Q psy1710          35 IGEGAYGMVVSEAPM   49 (77)
Q Consensus        35 IG~GAYG~VcSA~D~   49 (77)
                      ||.|+||.|+.|.+.
T Consensus         1 lg~G~~~~v~~~~~~   15 (250)
T cd05123           1 LGKGSFGKVLLVRKK   15 (250)
T ss_pred             CCCCCceEEEEEEEC
Confidence            689999999988764


No 398
>KOG0984|consensus
Probab=43.14  E-value=20  Score=27.60  Aligned_cols=27  Identities=33%  Similarity=0.610  Sum_probs=19.3

Q ss_pred             ceEEEeCCC-cccccccCCCCCcceEEE
Q psy1710          20 GQTFEVGPR-YTNLAYIGEGAYGMVVSE   46 (77)
Q Consensus        20 ~~~f~V~~R-Y~~lk~IG~GAYG~VcSA   46 (77)
                      ...|+++.. -.-+..||+||||+|-+-
T Consensus        38 ~~~~eV~ad~L~~i~elGrGayG~vekm   65 (282)
T KOG0984|consen   38 DRNFEVPADDLVGIEELGRGAYGVVEKM   65 (282)
T ss_pred             cCccccchhhhhhhhhhcCCccchhhhe
Confidence            334777644 456788999999998543


No 399
>KOG0690|consensus
Probab=42.17  E-value=14  Score=30.21  Aligned_cols=24  Identities=21%  Similarity=0.379  Sum_probs=18.9

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .+.+..++.||+|.||-|-....+
T Consensus       167 m~dFdfLKvLGkGTFGKVIL~rEK  190 (516)
T KOG0690|consen  167 MEDFDFLKVLGKGTFGKVILCREK  190 (516)
T ss_pred             cchhhHHHHhcCCccceEEEEeec
Confidence            356889999999999998655443


No 400
>KOG0695|consensus
Probab=41.67  E-value=9.6  Score=31.31  Aligned_cols=31  Identities=23%  Similarity=0.239  Sum_probs=23.4

Q ss_pred             ceEEEe-CCCcccccccCCCCCcceEEEEech
Q psy1710          20 GQTFEV-GPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        20 ~~~f~V-~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      +..|.+ ...|..++.||+|+|..|..|..++
T Consensus       242 ~~~~~l~l~df~ll~vigrgsyakvl~~~~~~  273 (593)
T KOG0695|consen  242 KISQGLGLQDFDLLRVIGRGSYAKVLLVRLKK  273 (593)
T ss_pred             ccccccccccceeeeeecCcchhhhhheehcc
Confidence            334544 3568899999999999998886553


No 401
>KOG1006|consensus
Probab=41.49  E-value=6  Score=31.27  Aligned_cols=24  Identities=29%  Similarity=0.434  Sum_probs=18.6

Q ss_pred             CCCcccccccCCCCCcceEEEEec
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      .+.-+.+..||.|+||+|.+-.++
T Consensus        63 ~~~Lqdlg~iG~G~fG~V~KM~hk   86 (361)
T KOG1006|consen   63 SDNLQDLGEIGNGAFGTVNKMLHK   86 (361)
T ss_pred             cchHHHHHHhcCCcchhhhhhhcC
Confidence            355678899999999999765443


No 402
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=40.63  E-value=23  Score=21.03  Aligned_cols=19  Identities=11%  Similarity=0.055  Sum_probs=15.1

Q ss_pred             cccccCCCCCcceEEEEec
Q psy1710          31 NLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        31 ~lk~IG~GAYG~VcSA~D~   49 (77)
                      .++.+|.|.++.|+++.+.
T Consensus         2 ~~~~i~~g~~~~v~~~~~~   20 (155)
T cd05120           2 SIKLLKGGLTNRVYLLGTK   20 (155)
T ss_pred             cceecccccccceEEEEec
Confidence            3567899999999988763


No 403
>KOG1187|consensus
Probab=40.31  E-value=19  Score=27.60  Aligned_cols=47  Identities=21%  Similarity=0.354  Sum_probs=31.0

Q ss_pred             CCCcccccccCCCCCcceEEEEech-h-h----hh-----------------hccCcchheeEEEeEeeCC
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK-K-L----LQ-----------------KGAGTNEQLVLLYMWWISP   73 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~-~-~----~~-----------------~~~~~~~~~~~~~~~~~~~   73 (77)
                      .+.|..-..||+|+||.|+++.-.. + +    +.                 -.+ .|.|||.|.-.....
T Consensus        74 T~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~l-~H~Nlv~LlGyC~e~  143 (361)
T KOG1187|consen   74 TNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSRL-RHPNLVKLLGYCLEG  143 (361)
T ss_pred             HhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhcC-CCcCcccEEEEEecC
Confidence            3566666899999999999875222 1 1    11                 233 488999998766543


No 404
>KOG0610|consensus
Probab=38.89  E-value=13  Score=30.51  Aligned_cols=25  Identities=20%  Similarity=0.138  Sum_probs=21.2

Q ss_pred             CCCcccccccCCCCCcceEEEEech
Q psy1710          26 GPRYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        26 ~~RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      .++++.++.||.|.=|.|+.|.++.
T Consensus        76 l~~f~llk~LG~GdiG~VyL~~l~~  100 (459)
T KOG0610|consen   76 LRHFRLLKRLGCGDIGTVYLVELRG  100 (459)
T ss_pred             HHHHHHHHHcCCCCceeEEEEEecC
Confidence            3568889999999999999987664


No 405
>KOG1345|consensus
Probab=34.10  E-value=6.8  Score=31.11  Aligned_cols=47  Identities=15%  Similarity=0.227  Sum_probs=33.8

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEechh---------------h--------hhhccCcchheeEEEeE
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKK---------------L--------LQKGAGTNEQLVLLYMW   69 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~~~---------------~--------~~~~~~~~~~~~~~~~~   69 (77)
                      .++-+-|...+.+|+|-||..-.|.++..               +        |.-|+|-|.|+|.-|++
T Consensus        20 v~l~d~y~I~k~lgeG~FgkIlL~eHr~s~t~ivlKavp~p~tt~~dF~rEfhY~~~Ls~H~hIi~tY~v   89 (378)
T KOG1345|consen   20 VDLEDVYTINKQLGEGRFGKILLAEHRQSKTRIVLKAVPRPQTTQADFVREFHYSFFLSPHQHIIDTYEV   89 (378)
T ss_pred             cchhhhhhHHHHhcccceeeEEeeeccCCceEEEeeccCcchhhHHHHHHHhccceeeccchhhhHHHHH
Confidence            34567899999999999998877776521               1        33567777777766654


No 406
>KOG3653|consensus
Probab=32.58  E-value=16  Score=30.47  Aligned_cols=23  Identities=26%  Similarity=0.329  Sum_probs=18.9

Q ss_pred             CCcccccccCCCCCcceEEEEec
Q psy1710          27 PRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        27 ~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      +.-+++..+|+|.||.|++|.-.
T Consensus       210 ~pl~l~eli~~Grfg~V~KaqL~  232 (534)
T KOG3653|consen  210 DPLQLLELIGRGRFGCVWKAQLD  232 (534)
T ss_pred             CchhhHHHhhcCccceeehhhcc
Confidence            34677899999999999999543


No 407
>KOG0986|consensus
Probab=31.81  E-value=29  Score=29.24  Aligned_cols=24  Identities=21%  Similarity=0.472  Sum_probs=18.3

Q ss_pred             cccccccCCCCCcceEEE--Eechhh
Q psy1710          29 YTNLAYIGEGAYGMVVSE--APMKKL   52 (77)
Q Consensus        29 Y~~lk~IG~GAYG~VcSA--~D~~~~   52 (77)
                      +..-+.||+|.||.||..  .++.|.
T Consensus       187 F~~~RvlGkGGFGEV~acqvraTGKM  212 (591)
T KOG0986|consen  187 FRVYRVLGKGGFGEVCACQVRATGKM  212 (591)
T ss_pred             eeeeEEEecccccceeEEEEecchhh
Confidence            456689999999999875  455555


No 408
>KOG4236|consensus
Probab=31.42  E-value=23  Score=30.68  Aligned_cols=26  Identities=19%  Similarity=0.463  Sum_probs=19.6

Q ss_pred             EeCCCcccc--cccCCCCCcceEEEEec
Q psy1710          24 EVGPRYTNL--AYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        24 ~V~~RY~~l--k~IG~GAYG~VcSA~D~   49 (77)
                      ++..-|+..  +.||+|-||+||.+.++
T Consensus       559 d~stvYQif~devLGSGQFG~VYgg~hR  586 (888)
T KOG4236|consen  559 DISTVYQIFADEVLGSGQFGTVYGGKHR  586 (888)
T ss_pred             hHHHHHHhhhHhhccCCcceeeecceec
Confidence            344446543  78999999999998765


No 409
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis]
Probab=29.47  E-value=19  Score=24.20  Aligned_cols=15  Identities=20%  Similarity=0.197  Sum_probs=12.8

Q ss_pred             hhhccCcchheeEEEe
Q psy1710          53 LQKGAGTNEQLVLLYM   68 (77)
Q Consensus        53 ~~~~~~~~~~~~~~~~   68 (77)
                      .-||+ ++|+||+|++
T Consensus        79 vLR~L-eeeGvv~lvs   93 (107)
T COG4901          79 VLRHL-EEEGVVQLVS   93 (107)
T ss_pred             HHHHH-HhCCceeeec
Confidence            44899 9999999985


No 410
>KOG0196|consensus
Probab=29.40  E-value=21  Score=31.74  Aligned_cols=27  Identities=30%  Similarity=0.425  Sum_probs=20.3

Q ss_pred             EEeCCCccc-ccccCCCCCcceEEEEec
Q psy1710          23 FEVGPRYTN-LAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        23 f~V~~RY~~-lk~IG~GAYG~VcSA~D~   49 (77)
                      .++...|.. -+.||.|.||.||+..-+
T Consensus       624 kEId~s~i~Ie~VIGaGEFGEVc~GrLk  651 (996)
T KOG0196|consen  624 KEIDPSCVKIEKVIGAGEFGEVCSGRLK  651 (996)
T ss_pred             hhcChhheEEEEEEecccccceeccccc
Confidence            456666654 478999999999997543


No 411
>KOG4257|consensus
Probab=25.51  E-value=54  Score=28.98  Aligned_cols=18  Identities=39%  Similarity=0.516  Sum_probs=14.5

Q ss_pred             ccccccCCCCCcceEEEE
Q psy1710          30 TNLAYIGEGAYGMVVSEA   47 (77)
Q Consensus        30 ~~lk~IG~GAYG~VcSA~   47 (77)
                      ..-+.||+|-||-|+.+.
T Consensus       392 tl~r~iG~GqFGdVy~gv  409 (974)
T KOG4257|consen  392 TLKRLIGEGQFGDVYKGV  409 (974)
T ss_pred             cHHHhhcCCcccceeeeE
Confidence            344789999999998774


No 412
>cd00235 TLP-20 Telokin-like protein-20 (TLP-20) domain; a baculovirus protein that shares some antigenic similarities to the smooth muscle protein telokin, a kinase-related protein
Probab=25.38  E-value=40  Score=22.60  Aligned_cols=22  Identities=32%  Similarity=0.477  Sum_probs=16.8

Q ss_pred             EEEeCCCcccccccCCCCCcceE
Q psy1710          22 TFEVGPRYTNLAYIGEGAYGMVV   44 (77)
Q Consensus        22 ~f~V~~RY~~lk~IG~GAYG~Vc   44 (77)
                      .|.+.+-|.+.| +|.|||-.-.
T Consensus        27 sF~v~dEyhLkK-l~vGAy~v~I   48 (108)
T cd00235          27 SFIVQDEYHLKK-LAVGAYAVNV   48 (108)
T ss_pred             EEEEchheeehh-hccccEEEEE
Confidence            588888887655 9999987543


No 413
>KOG4645|consensus
Probab=24.50  E-value=40  Score=31.42  Aligned_cols=27  Identities=26%  Similarity=0.485  Sum_probs=22.9

Q ss_pred             EEeCCCcccccccCCCCCcceEEEEec
Q psy1710          23 FEVGPRYTNLAYIGEGAYGMVVSEAPM   49 (77)
Q Consensus        23 f~V~~RY~~lk~IG~GAYG~VcSA~D~   49 (77)
                      -+|.-|++.--+||.|-||.|++|.|.
T Consensus      1231 snV~~rWqrg~~Ig~G~fG~VYtavN~ 1257 (1509)
T KOG4645|consen 1231 SNVTFRWQRGNFIGGGTFGKVYTAVNL 1257 (1509)
T ss_pred             ccceeeeccccccCCcceeeeEEeecC
Confidence            356668888889999999999999865


No 414
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=22.15  E-value=56  Score=26.86  Aligned_cols=22  Identities=5%  Similarity=-0.040  Sum_probs=17.8

Q ss_pred             CcccccccCCCCCcceEEEEech
Q psy1710          28 RYTNLAYIGEGAYGMVVSEAPMK   50 (77)
Q Consensus        28 RY~~lk~IG~GAYG~VcSA~D~~   50 (77)
                      .|.. ++||+|++|.|+.|..+.
T Consensus       121 ~fd~-~PlasaSiaQVh~A~l~~  142 (537)
T PRK04750        121 DFDI-KPLASASIAQVHFARLKD  142 (537)
T ss_pred             hcCh-hhhcCCCccEEEEEEECC
Confidence            3444 789999999999998653


Done!