RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy1710
         (77 letters)



>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
          signal-Regulated Kinase 1 and 2-like Serine/Threonine
          Kinases.  Serine/Threonine Kinases (STKs),
          Extracellular signal-regulated kinases 1 and 2 (ERK1/2)
          and Fus3 subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. This
          ERK1/2-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the mitogen-activated protein kinases (MAPKs) ERK1,
          ERK2, baker's yeast Fus3, and similar proteins. MAPK
          pathways are important mediators of cellular responses
          to extracellular signals. ERK1/2 activation is
          preferentially by mitogenic factors, differentiation
          stimuli, and cytokines, through a kinase cascade
          involving the MAPK kinases MEK1/2 and a MAPK kinase
          kinase from the Raf family. ERK1/2 have numerous
          substrates, many of which are nuclear and participate
          in transcriptional regulation of many cellular
          processes. They regulate cell growth, cell
          proliferation, and cell cycle progression from G1 to S
          phase. Although the distinct roles of ERK1 and ERK2
          have not been fully determined, it is known that ERK2
          can maintain most functions in the absence of ERK1, and
          that the deletion of ERK2 is embryonically lethal. The
          MAPK, Fus3, regulates yeast mating processes including
          mating-specific gene expression, G1 arrest, mating
          projection, and cell fusion.
          Length = 336

 Score = 53.1 bits (128), Expect = 4e-10
 Identities = 19/23 (82%), Positives = 21/23 (91%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          F+VGPRY NL+YIGEGAYGMV S
Sbjct: 1  FDVGPRYQNLSYIGEGAYGMVCS 23


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
          Kinase,  Extracellular signal-Regulated Kinase 5.
          Serine/Threonine Kinases (STKs), Extracellular
          signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ERK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7,
          has a unique C-terminal extension, making it
          approximately twice as big as other MAPKs. This
          extension contains transcriptional activation
          capability which is inhibited by the N-terminal half.
          ERK5 is activated in response to growth factors and
          stress by a cascade that leads to its phosphorylation
          by the MAP2K MEK5, which in turn is regulated by the
          MAP3Ks MEKK2 and MEKK3. Activated ERK5 phosphorylates
          its targets including myocyte enhancer factor 2 (MEF2),
          Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
          cell proliferation during the G1/S phase transition.
          Studies on knockout mice revealed that ERK5 is
          essential for cardiovascular development and plays an
          important role in angiogenesis. It is also critical for
          neural differentiation and survival. The ERK5 pathway
          has been implicated in the pathogenesis of many
          diseases including cancer, cardiac hypertrophy, and
          atherosclerosis.
          Length = 334

 Score = 35.8 bits (83), Expect = 7e-04
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          F+VG RY  +  IG GAYG+V S
Sbjct: 1  FDVGSRYKPIENIGSGAYGVVCS 23


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine
          Kinase, p38 Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), p38 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The p38 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They function in the regulation
          of the cell cycle, cell development, cell
          differentiation, senescence, tumorigenesis, apoptosis,
          pain development and pain progression, and immune
          responses. p38 kinases are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. p38 substrates include other protein kinases
          and factors that regulate transcription, nuclear
          export, mRNA stability and translation. p38 kinases are
          drug targets for the inflammatory diseases psoriasis,
          rheumatoid arthritis, and chronic pulmonary disease.
          Vertebrates contain four isoforms of p38, named alpha,
          beta, gamma, and delta, which show varying substrate
          specificity and expression patterns. p38alpha and
          p38beta are ubiquitously expressed, p38gamma is
          predominantly found in skeletal muscle, and p38delta is
          found in the heart, lung, testis, pancreas, and small
          intestine.
          Length = 343

 Score = 35.0 bits (81), Expect = 0.001
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 8/41 (19%)

Query: 22 TFEVGPRYTNLAYIGEGAYGMVVS--------EAPMKKLLQ 54
           +EV  RY NL+ +G GAYG V S        +  +KKL +
Sbjct: 10 VWEVPDRYQNLSPVGSGAYGQVCSAFDTKTGRKVAIKKLSR 50


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
          Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
          and Hog1.  Serine/Threonine Kinases (STKs), Fungal
          Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Sty1/Hog1 subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1
          from Saccharomyces cerevisiae, and similar proteins.
          MAPKs are important mediators of cellular responses to
          extracellular signals. Sty1 and Hog1 are
          stress-activated MAPKs that partipate in
          transcriptional regulation in response to stress. Sty1
          is activated in response to oxidative stress, osmotic
          stress, and UV radiation. Sty1 is regulated by the
          MAP2K Wis1, which is activated by the MAP3Ks Wis4 and
          Win1, which receive signals of the stress condition
          from membrane-spanning histidine kinases Mak1-3.
          Activated Sty1 stabilizes the Atf1 transcription factor
          and induces transcription of Atf1-dependent genes of
          the core environmetal stress response (CESR). Hog1 is
          the key element in the high osmolarity glycerol (HOG)
          pathway and is activated upon hyperosmotic stress.
          Activated Hog1 accumulates in the nucleus and regulates
          stress-induced transcription. The HOG pathway is
          mediated by two transmembrane osmosensors, Sln1 and
          Sho1.
          Length = 328

 Score = 33.6 bits (77), Expect = 0.004
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 18 VRGQTFEVGPRYTNLAYIGEGAYGMVVS 45
          + G  FE+  RY +L  +G GA+G+V S
Sbjct: 1  IFGTVFEITNRYVDLQPVGMGAFGLVCS 28


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase (MAPK) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAPK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation. Typical MAPK pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPK kinase (MAP2K or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAP3K or MKKK). Each cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. There are three main typical MAPK subfamilies:
          Extracellular signal-Regulated Kinase (ERK), c-Jun
          N-terminal Kinase (JNK), and p38. Some MAPKs are
          atypical in that they are not regulated by MAP2Ks.
          These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 33.3 bits (77), Expect = 0.005
 Identities = 11/18 (61%), Positives = 12/18 (66%)

Query: 28 RYTNLAYIGEGAYGMVVS 45
          RY  L  IG GAYG+V S
Sbjct: 1  RYELLKPIGSGAYGVVCS 18


>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase (JNK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. They are
          also essential regulators of physiological and
          pathological processes and are involved in the
          pathogenesis of several diseases such as diabetes,
          atherosclerosis, stroke, Parkinson's and Alzheimer's.
          Vetebrates harbor three different JNK genes (Jnk1,
          Jnk2, and Jnk3) that are alternatively spliced to
          produce at least 10 isoforms. JNKs are specifically
          activated by the MAPK kinases MKK4 and MKK7, which are
          in turn activated by upstream MAPK kinase kinases as a
          result of different stimuli including stresses such as
          ultraviolet (UV) irradiation, hyperosmolarity, heat
          shock, or cytokines. JNKs activate a large number of
          different substrates based on specific stimulus, cell
          type, and cellular condition, and may be implicated in
          seemingly contradictory functions.
          Length = 353

 Score = 33.1 bits (76), Expect = 0.005
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 22 TFEVGPRYTNLAYIGEGAYGMVVS 45
          TF V  RY NL  IG GA G+V +
Sbjct: 11 TFTVLKRYQNLKPIGSGAQGIVCA 34


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 33.1 bits (76), Expect = 0.006
 Identities = 9/15 (60%), Positives = 10/15 (66%)

Query: 29 YTNLAYIGEGAYGMV 43
          Y  L  IGEG YG+V
Sbjct: 1  YQKLGKIGEGTYGVV 15


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TEY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TEY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TEY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. There are two subtypes of plant
          MAPKs based on the conserved phosphorylation motif
          present in the activation loop, TEY and TDY. This
          subfamily represents the TEY subtype and is further
          subdivided into three groups (A, B, and C). Group A is
          represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
          (NtNTF4), among others. They are mostly involved in
          environmental and hormonal responses. AtMPK3 and
          AtMPK6 are also key regulators for stomatal development
          and patterning. Group B is represented by AtMPK4,
          AtMPK13, and NtNTF6, among others. They may be involved
          in both cell division and environmental stress
          response. AtMPK4 also participates in regulating innate
          immunity. Group C is represented by AtMPK1, AtMPK2,
          NtNTF3, Oryza sativa MAPK4 (OsMAPK4), among others.
          They may also be involved in stress responses. AtMPK1
          and AtMPK2 are activated following mechanical injury
          and in the presence of stress chemicals such as
          jasmonic acid, hydrogen peroxide and abscisic acid.
          OsMAPK4 is also called OsMSRMK3 for Multiple
          Stress-Responsive MAPK3.
          Length = 337

 Score = 30.8 bits (70), Expect = 0.034
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          FEV  +Y  +  IG GAYG+V S
Sbjct: 1  FEVDTKYVPIKPIGRGAYGIVCS 23


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 2 (CDKL2) and CDKL3 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL2 and CDKL3
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL2, also called p56 KKIAMRE, is expressed
          in testis, kidney, lung, and brain. It functions mainly
          in mature neurons and plays an important role in
          learning and memory. Inactivation of CDKL3, also called
          NKIAMRE (NKIATRE in rat), by translocation is
          associated with mild mental retardation. It has been
          reported that CDKL3 is lost in leukemic cells having a
          chromosome arm 5q deletion, and may contribute to the
          transformed phenotype.
          Length = 286

 Score = 30.4 bits (69), Expect = 0.043
 Identities = 10/17 (58%), Positives = 14/17 (82%)

Query: 28 RYTNLAYIGEGAYGMVV 44
          +Y NL  +GEG+YGMV+
Sbjct: 2  KYENLGLVGEGSYGMVM 18


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
          Kinase Like Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Cyclin-dependent protein kinase like
          (CDKL) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CDKL subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDKL1-5 and
          similar proteins. Some CDKLs, like CDKL1 and CDKL3, may
          be implicated in transformation and others, like CDKL3
          and CDKL5, are associated with mental retardation when
          impaired. CDKL2 plays a role in learning and memory.
          Length = 288

 Score = 30.4 bits (69), Expect = 0.047
 Identities = 9/17 (52%), Positives = 13/17 (76%)

Query: 28 RYTNLAYIGEGAYGMVV 44
          +Y  L  +GEGAYG+V+
Sbjct: 2  KYEVLGVVGEGAYGVVL 18


>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the
          Serine/Threonine Kinase, p38alpha Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38alpha subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38alpha subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38alpha, also
          called MAPK14, is expressed in most tissues and is the
          major isoform involved in the immune and inflammatory
          response. It is the central p38 MAPK involved in
          myogenesis. It plays a role in regulating cell cycle
          check-point transition and promoting cell
          differentiation. p38alpha also regulates cell
          proliferation and death through crosstalk with the JNK
          pathway. Its substrates include MAPK activated protein
          kinase 2 (MK2), MK5, and the transcription factors ATF2
          and Mitf.
          Length = 345

 Score = 30.0 bits (67), Expect = 0.073
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          +EV  RY NL+ +G GAYG V +
Sbjct: 13 WEVPERYQNLSPVGSGAYGSVCA 35


>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the
          Serine/Threonine Kinase, p38beta Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38beta subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38beta subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38beta, also
          called MAPK11, is widely expressed in tissues and shows
          more similarity with p38alpha than with the other
          isoforms. Both are sensitive to pyridinylimidazoles and
          share some common substrates such as MAPK activated
          protein kinase 2 (MK2) and the transcription factors
          ATF2, c-Fos and, ELK-1. p38beta is involved in
          regulating the activation of the cyclooxygenase-2
          promoter and the expression of TGFbeta-induced
          alpha-smooth muscle cell actin.
          Length = 343

 Score = 29.6 bits (66), Expect = 0.10
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVSEAPMKKLLQKGA 57
          +EV  RY NL  +G GAYG V S A   +L QK A
Sbjct: 11 WEVPERYQNLTPVGSGAYGSVCS-AYDTRLRQKVA 44


>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
          Serine/Threonine Kinase, p38delta Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38delta subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38delta subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38delta, also
          called MAPK13, is found in skeletal muscle, heart,
          lung, testis, pancreas, and small intestine. It
          regulates microtubule function by phosphorylating Tau.
          It activates the c-jun promoter and plays a role in G2
          cell cycle arrest. It also controls the degration of
          c-Myb, which is associated with myeloid leukemia and
          poor prognosis in colorectal cancer. p38delta is the
          main isoform involved in regulating the differentiation
          and apoptosis of keratinocytes.
          Length = 342

 Score = 29.5 bits (66), Expect = 0.11
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          +E+  RYT+L  +G GAYG V S
Sbjct: 11 WELPERYTSLKQVGSGAYGSVCS 33


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 1 (CDKL1) and CDKL4 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL1 and CDKL4
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL1, also called p42 KKIALRE, is a glial
          protein that is upregulated in gliosis. It is present
          in neuroblastoma and A431 human carcinoma cells, and
          may be implicated in neoplastic transformation. The
          function of CDKL4 is unknown.
          Length = 286

 Score = 28.5 bits (64), Expect = 0.26
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 28 RYTNLAYIGEGAYGMV 43
          +Y  L+ IGEG+YG+V
Sbjct: 2  KYEKLSKIGEGSYGVV 17


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
          Serine/Threonine Kinase, p38gamma Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38gamma subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38gamma subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38gamma, also
          called MAPK12, is predominantly expressed in skeletal
          muscle. Unlike p38alpha and p38beta, p38gamma is
          insensitive to pyridinylimidazoles. It displays an
          antagonizing function compared to p38alpha. p38gamma
          inhibits, while p38alpha stimulates, c-Jun
          phosphorylation and AP-1 mediated transcription.
          p38gamma also plays a role in the signaling between Ras
          and the estrogen receptor and has been implicated to
          increase cell invasion and breast cancer progression.
          In Xenopus, p38gamma is critical in the meiotic
          maturation of oocytes.
          Length = 343

 Score = 28.0 bits (62), Expect = 0.41
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          +EV  RY +L  +G GAYG V S
Sbjct: 11 WEVPDRYRDLKQVGSGAYGTVCS 33


>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase 1.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. Vetebrates
          harbor three different JNK genes (Jnk1, Jnk2, and
          Jnk3). JNK1, like JNK2, is expressed in every cell and
          tissue type. Initially it was thought that JNK1 and
          JNK2 were functionally redundant as mice deficient in
          either genes (Jnk1 or Jnk2) could survive but
          disruption of both genes resulted in lethality.
          However, recent studies have shown that JNK1 and JNK2
          perform distinct functions through specific binding
          partners and substrates. JNK1 specifically binds with
          JAMP (JNK1-associated membrane protein), which
          regulates the duration of JNK1 activity in response to
          stimuli. Specific JNK1 substrates include Itch and
          SG10, which are implicated in Th2 responses and airway
          inflammation, and microtubule dynamics and axodendritic
          length, respectively. Mice deficient in Jnk1 are
          protected against arthritis, obesity, type 2 diabetes,
          cardiac cell death, and non-alcoholic liver disease,
          suggesting that JNK1 may play roles in the pathogenesis
          of these diseases.
          Length = 364

 Score = 28.1 bits (62), Expect = 0.41
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 22 TFEVGPRYTNLAYIGEGAYGMVVS 45
          TF V  RY NL  IG GA G+V +
Sbjct: 19 TFTVLKRYQNLKPIGSGAQGIVCA 42


>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase 3.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK3 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. Vetebrates
          harbor three different JNK genes (Jnk1, Jnk2, and
          Jnk3). JNK3 is expressed primarily in the brain, and to
          a lesser extent in the heart and testis. Mice deficient
          in Jnk3 are protected against kainic acid-induced
          seizures, stroke, sciatic axotomy neural death, and
          neuronal death due to NGF deprivation, oxidative
          stress, or exposure to beta-amyloid peptide. This
          suggests that JNK3 may play roles in the pathogenesis
          of these diseases.
          Length = 355

 Score = 27.7 bits (61), Expect = 0.47
 Identities = 14/28 (50%), Positives = 16/28 (57%)

Query: 18 VRGQTFEVGPRYTNLAYIGEGAYGMVVS 45
          V   TF V  RY NL  IG GA G+V +
Sbjct: 8  VGDSTFTVLKRYQNLKPIGSGAQGIVCA 35


>gnl|CDD|225929 COG3394, COG3394, Uncharacterized protein conserved in bacteria
           [Function unknown].
          Length = 257

 Score = 27.4 bits (61), Expect = 0.70
 Identities = 10/49 (20%), Positives = 13/49 (26%), Gaps = 4/49 (8%)

Query: 25  VGPRYTNLAYIGEGA----YGMVVSEAPMKKLLQKGAGTNEQLVLLYMW 69
            G     +  + EG     YG  VSE      L           +  M 
Sbjct: 161 AGELPAGIRSLLEGFLAAFYGEGVSEELFLNHLFSALERLGDPSVEVMC 209


>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 8-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK8-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK8, CDC2L6,
          and similar proteins. CDK8 functions as a negative or
          positive regulator of transcription, depending on the
          scenario. Together with its regulator, cyclin C, it
          reversibly associates with the multi-subunit core
          Mediator complex, a cofactor that is involved in
          regulating RNA polymerase II (RNAP II)-dependent
          transcription. CDC2L6 also associates with Mediator in
          complexes lacking CDK8. In VP16-dependent
          transcriptional activation, CDK8 and CDC2L6 exerts
          opposing effects by positive and negative regulation,
          respectively, in similar conditions.
          Length = 316

 Score = 27.2 bits (61), Expect = 0.72
 Identities = 7/17 (41%), Positives = 8/17 (47%)

Query: 28 RYTNLAYIGEGAYGMVV 44
          +Y     IG G YG V 
Sbjct: 1  KYEIEGCIGRGTYGRVY 17


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 4 and 6-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 4 (CDK4) and CDK6-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK4/6-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK4 and CDK6 partner with D-type cyclins to
          regulate the early G1 phase of the cell cycle. They are
          the first kinase activated by mitogenic signals to
          release cells from the G0 arrested state. CDK4 and CDK6
          are both expressed ubiquitously, associate with all
          three D cyclins (D1, D2 and D3), and phosphorylate the
          retinoblastoma (pRb) protein. They are also regulated
          by the INK4 family of inhibitors which associate with
          either the CDK alone or the CDK/cyclin complex. CDK4
          and CDK6 show differences in subcellular localization,
          sensitivity to some inhibitors, timing in activation,
          tumor selectivity, and possibly substrate profiles.
          Although CDK4 and CDK6 seem to show some redundancy,
          they also have discrete, nonoverlapping functions. CDK6
          plays an important role in cell differentiation.
          Length = 287

 Score = 26.8 bits (60), Expect = 0.96
 Identities = 11/15 (73%), Positives = 11/15 (73%)

Query: 29 YTNLAYIGEGAYGMV 43
          Y  LA IGEGAYG V
Sbjct: 1  YEELAEIGEGAYGTV 15


>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
          Kinase, c-Jun N-terminal Kinase 2.  Serine/Threonine
          Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          JNK2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. JNKs are mitogen-activated
          protein kinases (MAPKs) that are involved in many
          stress-activated responses including those during
          inflammation, neurodegeneration, apoptosis, and
          persistent pain sensitization, among others. Vetebrates
          harbor three different JNK genes (Jnk1, Jnk2, and
          Jnk3). JNK1, like JNK2, is expressed in every cell and
          tissue type. Initially it was thought that JNK1 and
          JNK2 were functionally redundant as mice deficient in
          either genes (Jnk1 or Jnk2) could survive but
          disruption of both genes resulted in lethality.
          However, recent studies have shown that JNK1 and JNK2
          perform distinct functions through specific binding
          partners and substrates.  JNK2 is specifically
          translocated to the mitochondria during dopaminergic
          cell death. Specific substrates include the
          microtubule-associated proteins DCX and Tau, as well as
          TIF-IA which is involved in ribosomal RNA synthesis
          regulation. Mice deficient in Jnk2 show protection
          against arthritis, type 1 diabetes, atherosclerosis,
          abdominal aortic aneurysm, cardiac cell death,
          TNF-induced liver damage, and tumor growth, indicating
          that JNK2 may play roles in the pathogenesis of these
          diseases.
          Length = 359

 Score = 26.9 bits (59), Expect = 1.0
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 18 VRGQTFEVGPRYTNLAYIGEGAYGMVVS 45
          V   TF V  RY  L  IG GA G+V +
Sbjct: 12 VADSTFTVLKRYQQLKPIGSGAQGIVCA 39


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 7.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 7 (CDK7) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK7 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK7 plays essential roles in the cell cycle
          and in transcription. It associates with cyclin H and
          MAT1 and acts as a CDK-Activating Kinase (CAK) by
          phosphorylating and activating cell cycle CDKs
          (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
          also a component of the general transcription factor
          TFIIH, which phosphorylates the C-terminal domain (CTD)
          of RNA polymerase II when it is bound with
          unphosphorylated DNA, as present in the pre-initiation
          complex. Following phosphorylation, the CTD dissociates
          from the DNA which allows transcription initiation.
          Length = 298

 Score = 26.4 bits (59), Expect = 1.2
 Identities = 7/16 (43%), Positives = 9/16 (56%)

Query: 28 RYTNLAYIGEGAYGMV 43
          RY     +GEG Y +V
Sbjct: 1  RYEKGKKLGEGTYAVV 16


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase 15.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK15 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. Human MAPK15 is also called Extracellular
          signal Regulated Kinase 8 (ERK8) while the rat protein
          is called ERK7. ERK7 and ERK8 display both similar and
          different biochemical properties. They
          autophosphorylate and activate themselves and do not
          require upstream activating kinases. ERK7 is
          constitutively active and is not affected by
          extracellular stimuli whereas ERK8 shows low basal
          activity and is activated by DNA-damaging agents. ERK7
          and ERK8 also have different substrate profiles. Genome
          analysis shows that they are orthologs with similar
          gene structures. ERK7 and ERK 8 may be involved in the
          signaling of some nuclear receptor transcription
          factors. ERK7 regulates hormone-dependent degradation
          of estrogen receptor alpha while ERK8 down-regulates
          the transcriptional co-activation androgen and
          glucocorticoid receptors.
          Length = 337

 Score = 26.4 bits (59), Expect = 1.4
 Identities = 8/16 (50%), Positives = 12/16 (75%)

Query: 28 RYTNLAYIGEGAYGMV 43
          +Y  L  +G+GAYG+V
Sbjct: 8  KYEILQKLGKGAYGIV 23


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TDY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TDY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TDY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. Oryza sativa contains at least
          17 MAPKs. There are two subtypes of plant MAPKs based
          on the conserved phosphorylation motif present in the
          activation loop, TEY and TDY. Arabidopsis thaliana
          contains more TEY-type MAPKs than TDY-type, whereas the
          reverse is true for Oryza sativa. This subfamily
          represents the TDY subtype and is composed of Group D
          plant MAPKs including Arabidopsis thaliana MPK18
          (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
          (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
          Zea mays MPK6, and the Medicago sativa TDY1 gene
          product. OsBWMK1 enhances resistance to pathogenic
          infections. It mediates stress-activated defense
          responses by activating a transcription factor that
          affects the expression of stress-related genes. AtMPK18
          is involved in microtubule-related functions.
          Length = 338

 Score = 26.3 bits (58), Expect = 1.7
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 28 RYTNLAYIGEGAYGMVVS 45
          RY     IG+G+YG+V S
Sbjct: 1  RYKIQEVIGKGSYGVVCS 18


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
          protein Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase (CDK)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKs are partly regulated by their
          subcellular localization, which defines substrate
          phosphorylation and the resulting specific function.
          CDK1, CDK2, CDK4, and CDK6 have well-defined functions
          in the cell cycle, such as the regulation of the early
          G1 phase by CDK4 or CDK6, the G1/S phase transition by
          CDK2, or the entry of mitosis by CDK1. They also
          exhibit overlapping cyclin specificity and functions in
          certain conditions. Knockout mice with a single CDK
          deleted remain viable with specific phenotypes, showing
          that some CDKs can compensate for each other. For
          example, CDK4 can compensate for the loss of CDK6,
          however, double knockout mice with both CDK4 and CDK6
          deleted die in utero. CDK8 and CDK9 are mainly involved
          in transcription while CDK5 is implicated in neuronal
          function. CDK7 plays essential roles in both the cell
          cycle as a CDK-Activating Kinase (CAK) and in
          transcription as a component of the general
          transcription factor TFIIH.
          Length = 282

 Score = 25.9 bits (58), Expect = 1.8
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 29 YTNLAYIGEGAYGMV 43
          Y  L  +GEG YG+V
Sbjct: 1  YEKLEKLGEGTYGVV 15


>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine
          Kinases, Mitogen-Activated Protein Kinases 4 and 6.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK4/6 subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. MAPK4 is also called ERK4 or p63MAPK, while
          MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6
          are atypical MAPKs that are not regulated by MAP2Ks.
          MAPK6 is expressed ubiquitously with highest amounts in
          brain and skeletal muscle. It may be involved in the
          control of cell differentiation by negatively
          regulating cell cycle progression in certain
          conditions. It may also play a role in glucose-induced
          insulin secretion. MAPK6 and MAPK4 cooperate to
          regulate the activity of MAPK-activated protein kinase
          5 (MK5), leading to its relocation to the cytoplasm and
          exclusion from the nucleus. The MAPK6/MK5 and MAPK4/MK5
          pathways may play critical roles in embryonic and
          post-natal development.
          Length = 342

 Score = 25.5 bits (56), Expect = 3.0
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 23 FEVGPRYTNLAYIGEGAYGMVVS 45
          F++G RY +L  +G G+ G+V S
Sbjct: 1  FDLGSRYMDLRPLGCGSNGLVFS 23


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
          Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
          Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CCRK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CCRK was previously called
          p42. It is a Cyclin-Dependent Kinase (CDK)-Activating
          Kinase (CAK) which is essential for the activation of
          CDK2. It is indispensable for cell growth and has been
          implicated in the progression of glioblastoma
          multiforme. In the heart, a splice variant of CCRK with
          a different C-terminal half is expressed, this variant
          promotes cardiac cell growth and survival and is
          significantly down-regulated during the development of
          heart failure.
          Length = 286

 Score = 25.3 bits (56), Expect = 3.3
 Identities = 10/18 (55%), Positives = 12/18 (66%)

Query: 28 RYTNLAYIGEGAYGMVVS 45
          RY  L  IGEGA+G+V  
Sbjct: 1  RYKILGRIGEGAHGIVFK 18


>gnl|CDD|233710 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A family.
           Bacterial that synthesize a cell wall of peptidoglycan
           (murein) generally have several transglycosylases and
           transpeptidases for the task. This family consists of
           bifunctional transglycosylase/transpeptidase
           penicillin-binding proteins (PBP). In the
           Proteobacteria, this family includes PBP 1A but not the
           paralogous PBP 1B (TIGR02071). This family also includes
           related proteins, often designated PBP 1A, from other
           bacterial lineages [Cell envelope, Biosynthesis and
           degradation of murein sacculus and peptidoglycan].
          Length = 531

 Score = 24.9 bits (55), Expect = 4.1
 Identities = 8/15 (53%), Positives = 9/15 (60%)

Query: 28  RYTNLAYIGEGAYGM 42
            Y N  Y G GAYG+
Sbjct: 98  LYLNRIYFGNGAYGI 112


>gnl|CDD|211932 TIGR04209, sarcinarray, sarcinarray family protein.  Members of
           this protein family are exclusive to archaea, probably
           all of which have S-layer surface protein arrays. All
           member proteins have an N-terminal signal sequence. The
           majority of known members belong to codirectional tandem
           arrays in the genus Methanosarcina (nine in M. barkeri
           str. Fusaro). Nearly all members have an additional 50
           residues, (trimmed from the seed alignment for This
           model), consisting of low-complexity sequence rich in
           E,N,Q,T,S, and P, followed by a variant (PAF) form of
           the PGF-CTERM putative archaeal surface glycoprotein
           sorting signal. The coined name, sarcinarray family
           protein, evokes the predicted archaeal surface layer
           localization, the taxonomic bias of known members, and
           the tandem organization of most members.
          Length = 144

 Score = 25.0 bits (55), Expect = 4.2
 Identities = 10/46 (21%), Positives = 21/46 (45%), Gaps = 2/46 (4%)

Query: 29  YTNLAYIGEGAYGMVVSEAPMKKLLQKGAGTNEQLVLLYMWWISPT 74
              L+ +G G++ ++   +PM     +    NE     + W ++PT
Sbjct: 58  SVKLSELGGGSFEIISGPSPMNIYSSRILEKNETHT--FEWTVAPT 101


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 1-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes, plants, and yeasts, as well as CDK2
          and CDK3. CDK1 is also called Cell division control
          protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression while
          the CDK1/cyclin B complex is critical for G2 to M phase
          transition. CDK2 is regulated by cyclin E or cyclin A.
          Upon activation by cyclin E, it phosphorylates the
          retinoblastoma (pRb) protein which activates E2F
          mediated transcription and allows cells to move into S
          phase. The CDK2/cyclin A complex plays a role in
          regulating DNA replication. Studies in knockout mice
          revealed that CDK1 can compensate for the loss of the
          cdk2 gene as it can also bind cyclin E and drive G1 to
          S phase transition. CDK3 is regulated by cyclin C and
          it phosphorylates pRB specifically during the G0/G1
          transition. This phosphorylation is required for cells
          to exit G0 efficiently and enter the G1 phase.
          Length = 283

 Score = 25.0 bits (55), Expect = 4.6
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 29 YTNLAYIGEGAYGMV 43
          Y  +  IGEG YG+V
Sbjct: 1  YQKVEKIGEGTYGVV 15


>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase.  Isovaleryl-CoA
           dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase,
           which catalyzes the third step in leucine catabolism,
           the conversion of isovaleryl-CoA (3-methylbutyryl-CoA)
           into 3-methylcrotonyl-CoA. IVD is a homotetramer and has
           the greatest affinity for small branched chain
           substrates.
          Length = 376

 Score = 24.7 bits (54), Expect = 5.3
 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 3/28 (10%)

Query: 34  YIGEGAYGMVVSEAPMKKLLQKGAGTNE 61
           YI +   G ++ +A   KL + GAGT+E
Sbjct: 340 YINDYPTGRLLRDA---KLYEIGAGTSE 364


>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 1 from higher
          eukaryotes-like.  Serine/Threonine Kinases (STKs),
          Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes. CDK1 is also called Cell division
          control protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression.
          CDK1/cyclin A2 has also been implicated as an important
          regulator of S phase events. The CDK1/cyclin B complex
          is critical for G2 to M phase transition. It induces
          mitosis by activating nuclear enzymes that regulate
          chromatin condensation, nuclear membrane degradation,
          mitosis-specific microtubule and cytoskeletal
          reorganization. CDK1 also associates with cyclin E and
          plays a role in the entry into S phase. CDK1
          transcription is stable throughout the cell cycle but
          is modulated in some pathological conditions. It may
          play a role in regulating apoptosis under these
          conditions. In breast cancer cells, HER2 can mediate
          apoptosis by inactivating CDK1. Activation of CDK1 may
          contribute to HIV-1 induced apoptosis and neuronal
          apoptosis in neurodegenerative diseases.
          Length = 285

 Score = 24.7 bits (54), Expect = 5.6
 Identities = 9/15 (60%), Positives = 11/15 (73%)

Query: 29 YTNLAYIGEGAYGMV 43
          YT +  IGEG YG+V
Sbjct: 2  YTKIEKIGEGTYGVV 16


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 9-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK9 and CDK12
          from higher eukaryotes, yeast BUR1, C-type plant CDKs
          (CdkC), and similar proteins. CDK9, BUR1, and CdkC are
          functionally equivalent. They act as a kinase for the
          C-terminal domain of RNA polymerase II and participate
          in regulating mutliple steps of gene expression
          including transcription elongation and RNA processing.
          CDK9 and CdkC associate with T-type cyclins while BUR1
          associates with the cyclin BUR2. CDK12 is a unique CDK
          that contains an arginine/serine-rich (RS) domain,
          which is predominantly found in splicing factors. CDK12
          interacts with cyclins L1 and L2, and participates in
          regulating transcription and alternative splicing.
          Length = 287

 Score = 24.4 bits (54), Expect = 7.4
 Identities = 9/15 (60%), Positives = 10/15 (66%)

Query: 29 YTNLAYIGEGAYGMV 43
          Y  +A IGEG YG V
Sbjct: 1  YEKIAQIGEGTYGQV 15


>gnl|CDD|218697 pfam05694, SBP56, 56kDa selenium binding protein (SBP56).  This
           family consists of several eukaryotic selenium binding
           proteins as well as three sequences from archaea. The
           exact function of this protein is unknown although it is
           thought that SBP56 participates in late stages of
           intra-Golgi protein transport. The Lotus japonicus
           homologue of SBP56, LjSBP is thought to have more than
           one physiological role and can be implicated in
           controlling the oxidation/reduction status of target
           proteins, in vesicular Golgi transport.
          Length = 461

 Score = 24.5 bits (54), Expect = 7.5
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 1   MSAEGGAGGTLAGNAELVRGQTFEV 25
           +SA G A G   G   L+  +TFEV
Sbjct: 145 ISALGDADGNGPGGFLLLDHETFEV 169


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.315    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0748    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,777,842
Number of extensions: 285672
Number of successful extensions: 232
Number of sequences better than 10.0: 1
Number of HSP's gapped: 232
Number of HSP's successfully gapped: 37
Length of query: 77
Length of database: 10,937,602
Length adjustment: 46
Effective length of query: 31
Effective length of database: 8,897,318
Effective search space: 275816858
Effective search space used: 275816858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (24.2 bits)