BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17123
         (105 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (76%)

Query: 12 AETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
          ++  +R RKESILDLS++ D+ I+  F GGR+ +GILKGFD L+NLVLD+  E LR
Sbjct: 18 SQPTERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLR 73


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%)

Query: 12 AETKDRKRKESILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYLR 67
          ++  +R RKESILDLS++ D+ I+  F GGR+ +GILKGFD L NLVLD+  E LR
Sbjct: 14 SQPTERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLXNLVLDDVEEQLR 69


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%)

Query: 25 DLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEY 65
          +L KF+DK + +K  GGR   GIL+GFDP +NLV+D   E 
Sbjct: 8  ELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEM 48


>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
 pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
          Length = 121

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 6  TTTDAGAETKDRKRKESILDLSKFLDKVIR----VKFAGGRECSGILKGFDPLLNLVLDN 61
          T  +      ++K    IL L+  +DK I     V   G +E SG+L+GFD  +N+VLD+
Sbjct: 10 TPANKSQGGSNQKGGNIILPLA-LIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDD 68

Query: 62 TTEY 65
            EY
Sbjct: 69 VQEY 72


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 32.7 bits (73), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEY 65
          L   L+  + +K  G RE  G+LK FD  +NLVL++  E 
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL 57


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 32.7 bits (73), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEY 65
          L   L+  + +K  G RE  G+LK FD  +NLVL++  E 
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL 57


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 32.7 bits (73), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEY 65
          L   L+  + +K  G RE  G+LK FD  +NLVL++  E 
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL 57


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 32.3 bits (72), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTE 64
          L   L+  + +K  G RE  G+LK FD  +NLVL++  E
Sbjct: 20 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE 58


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 32.3 bits (72), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTE 64
          L++ L+ ++ VK  G +E  G+L+ +D  +NLVL ++ E
Sbjct: 14 LAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEE 52


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 32.0 bits (71), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 21 ESILDLSKF-LDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYL 66
          E+ LDL K  LD+ + +K  G R   G L+ FD   N+VL +  E +
Sbjct: 9  ETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETI 55


>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
          Length = 94

 Score = 30.0 bits (66), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 42 RECSGILKGFDPLLNLVLDNTTEYLRVT 69
          RE +G L GFD  +N+VL + TEY  VT
Sbjct: 41 REFAGTLVGFDDYVNIVLKDVTEYDTVT 68


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 30.0 bits (66), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 42 RECSGILKGFDPLLNLVLDNTTEYLRVT 69
          RE +G L GFD  +N+VL + TEY  VT
Sbjct: 29 REFAGTLVGFDDYVNIVLKDVTEYDTVT 56


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 29.6 bits (65), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTE 64
          L++ L   + V+  GGRE  G L G+D  +NLVL +  E
Sbjct: 9  LNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEE 47


>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 77

 Score = 29.6 bits (65), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYL 66
          L+K + K + ++ + G +  GIL   D  +NL L+ T EY+
Sbjct: 11 LNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYV 51


>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
          Length = 75

 Score = 28.1 bits (61), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYL 66
          L+K + K + ++ + G +  GIL   D   NL L+ T EY+
Sbjct: 9  LNKVIGKKVLIRLSSGVDYKGILSCLDGYXNLALERTEEYV 49


>pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|B Chain B, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|C Chain C, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|D Chain D, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|E Chain E, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|F Chain F, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|G Chain G, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|H Chain H, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|I Chain I, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|J Chain J, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|K Chain K, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|L Chain L, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|M Chain M, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|N Chain N, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|O Chain O, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|P Chain P, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Q Chain Q, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|R Chain R, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|S Chain S, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|T Chain T, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|U Chain U, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|V Chain V, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|W Chain W, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|X Chain X, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Y Chain Y, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Z Chain Z, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|1 Chain 1, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|2 Chain 2, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
          Length = 130

 Score = 26.6 bits (57), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 23 ILDLSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTT 63
          + +L+  L + ++V  + G    G+L   D  LN+VL N +
Sbjct: 2  VAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANAS 42


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 26.2 bits (56), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 26 LSKFLDKVIRVKFAGGRECSGILKGFDPLLNLVLDNTTEYL 66
          L   + K + VK     E  GIL+ FD  +NL+L++  E +
Sbjct: 16 LQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEII 56


>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
          Archaeoglobus Fulgidus At 1.95a Resolution
          Length = 77

 Score = 25.4 bits (54), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 29 FLDKVIRVKFAGGR-ECSGILKGFDPLLNLVLDNTTEYLRVTYQSVQVRSWCSIVRR 84
           + K+IRV+  G   +  G L+G D  +NL L N  E         +VRS   IV R
Sbjct: 13 MVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAME----CKGEEKVRSLGEIVLR 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,893,963
Number of Sequences: 62578
Number of extensions: 103230
Number of successful extensions: 189
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 172
Number of HSP's gapped (non-prelim): 19
length of query: 105
length of database: 14,973,337
effective HSP length: 70
effective length of query: 35
effective length of database: 10,592,877
effective search space: 370750695
effective search space used: 370750695
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)