BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17134
         (89 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1SPP|B Chain B, The Crystal Structures Of Two Members Of The
          Spermadhesin Family Reveal The Folding Of The Cub
          Domain
          Length = 116

 Score = 27.3 bits (59), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 4  WAILLFPKRKRQLVVSLLERACVKPVLRPYQ--LSVQEFGQIC 44
          W IL+ P +K ++ +  L  AC K  +  +   LS   +G++C
Sbjct: 32 WTILMKPDQKVRMAIPYLNLACGKEYVEVFDGLLSGPSYGKLC 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.141    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,912,102
Number of Sequences: 62578
Number of extensions: 107266
Number of successful extensions: 154
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 154
Number of HSP's gapped (non-prelim): 2
length of query: 89
length of database: 14,973,337
effective HSP length: 56
effective length of query: 33
effective length of database: 11,468,969
effective search space: 378475977
effective search space used: 378475977
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)