Diaphorina citri psyllid: psy17147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MKRYRPVLVIHGILSGNKTLEKFKERIERFHPGTKVVIPDNYSNWASLEPMWNQVLFFGSLVMKMSQNHPEGIHLIGYSQGGLIARGILEQFPNHNVRNFISLSSPHGGQYGSNQFGHFTEDESVVELRDTKMYTENSLGLRTLDKQGKLVLISVPGVDHFQWHNNPTVIDQHKSTFVCFSKFLPFINNLNATPNSNLFKLGLLRLHRMVLIGGPNDSVITPWQSSQFGHFTEDESVVELRDTKMYTKNSLGLRTLDKQGKLVLISVPGVDHFQWHNNPTVIDQHVLPYLD
ccccccEEEEccccccHHHHHHHHHHHHHHcccCEEEEccccccccccHHHHHHHHHHHHHHHHccccccccCEEEEEccHHHHHHHHHHccccccccEEEEEcccccccccccccccccccHHHHHHHHccccccHHHHHHHHHccccEEEEEccccccccccccccccccccccHHccccccccccccccccccHHHHHHHHHHccEEEEccccccEEEcccccccccccccccEEEcccccccccccccHHHHHHcccEEEEEEccccccccccccHHHHcccccccc
*KRYRPVLVIHGILSGNKTLEKFKERIERFHPGTKVVIPDNYSNWASLEPMWNQVLFFGSLVMKMSQNHPEGIHLIGYSQGGLIARGILEQFPNHNVRNFISLSSPHGGQYGSNQFGHFTEDESVVELRDTKMYTENSLGLRTLDKQGKLVLISVPGVDHFQWHNNPTVIDQHKSTFVCFSKFLPFINNLNATPNSNLFKLGLLRLHRMVLIGGPNDSVITPWQSSQFGHFTEDESVVELRDTKMYTKNSLGLRTLDKQGKLVLISVPGVDHFQWHNNPTVIDQHVLPYLD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRYRPVLVIHGILSGNKTLEKFKERIERFHPGTKVVIPDNYSNWASLEPMWNQVLFFGSLVMKMSQNHPEGIHLIGYSQGGLIARGILEQFPNHNVRNFISLSSPHGGQYGSNQFGHFTEDESVVELRDTKMYTENSLGLRTLDKQGKLVLISVPGVDHFQWHNNPTVIDQHKSTFVCFSKFLPFINNLNATPNSNLFKLGLLRLHRMVLIGGPNDSVITPWQSSQFGHFTEDESVVELRDTKMYTKNSLGLRTLDKQGKLVLISVPGVDHFQWHNNPTVIDQHVLPYLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lysosomal thioesterase PPT2 Removes thioester-linked fatty acyl groups from various substrates including S-palmitoyl-CoA. Has the highest S-thioesterase activity for the acyl groups palmitic and myristic acid followed by other short- and long-chain acyl substrates. However, because of structural constraints, is unable to remove palmitate from peptides or proteins.confidentO70489
Lysosomal thioesterase PPT2 Removes thioester-linked fatty acyl groups from various substrates including S-palmitoyl-CoA. Has the highest S-thioesterase activity for the acyl groups palmitic and myristic acid followed by other short- and long-chain acyl substrates. However, because of structural constraints, is unable to remove palmitate from peptides or proteins.confidentO35448
Lysosomal thioesterase PPT2 Removes thioester-linked fatty acyl groups from various substrates including S-palmitoyl-CoA. Has the highest S-thioesterase activity for the acyl groups palmitic and myristic acid followed by other short- and long-chain acyl substrates. However, because of structural constraints, is unable to remove palmitate from peptides or proteins.confidentQ1JQA0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PJA, chain A
Confidence level:very confident
Coverage over the Query: 3-141,155-291
View the alignment between query and template
View the model in PyMOL
Template: 3GRO, chain A
Confidence level:probable
Coverage over the Query: 71-290
View the alignment between query and template
View the model in PyMOL