RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17150
         (146 letters)



>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human
           MTMR5) Pleckstrin Homology (PH) domain.  Sbf1 is a
           myotubularin-related pseudo-phosphatase. Both Sbf1 and
           myotubularin interact with the SET domains of Hrx and
           other epigenetic regulatory proteins, but Sbf1 lacks
           phosphatase activity due to several amino acid changes
           in its structurally preserved catalytic pocket. It
           contains pleckstrin (PH), GEF, and myotubularin homology
           domains that are thought to be responsible for signaling
           and growth control. Sbf1 functions as an inhibitor of
           cellular growth. The N-terminal GEF homology domain
           serves to inhibit the transforming effects of Sbf1. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 106

 Score =  117 bits (295), Expect = 4e-35
 Identities = 39/103 (37%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 39  SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHL-- 96
           +C GYL K       W +RWFV D T   L YY  + + K +G    + +E VY D    
Sbjct: 4   TCEGYLYKRGALLKGWKQRWFVLDLTKHQLRYYESKEDTKCKGVIDLQEVESVYPDTPSI 63

Query: 97  NSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAE 139
            + KSP P   F +K++ R ++ +APSAEA + WIDVI +   
Sbjct: 64  GAPKSPDPGAFFELKTNKRVYYFLAPSAEAAQQWIDVIQTLLS 106


>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain
           containing, family H (with MyTH4 domain) members 1 and 2
           (PLEKHH1) PH domain, repeat 1.  PLEKHH1 and PLEKHH2
           (also called PLEKHH1L) are thought to function in
           phospholipid binding and signal transduction. There are
           3 Human PLEKHH genes: PLEKHH1, PLEKHH2, and PLEKHH3.
           There are many isoforms, the longest of which contain a
           FERM domain, a MyTH4 domain, two PH domains, a peroximal
           domain, a vacuolar domain, and a coiled coil stretch.
           The FERM domain has a cloverleaf tripart structure
           (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe,
           B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the
           FERM domain is part of the PH domain family. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 96

 Score = 62.7 bits (153), Expect = 6e-14
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSE--KKQRGATYFRCIEEVYVDHLNSV 99
           GYL K+ G+   W +RWFV       L YY   ++  +K +G        ++ +D    +
Sbjct: 3   GYLTKLGGKVKTWKRRWFVLKNG--ELFYYKSPNDVIRKPQG--------QIALDGSCEI 52

Query: 100 KSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQ 142
                  TF + +  RT++L A S   +  WI VI +      
Sbjct: 53  ARAEGAQTFEIVTEKRTYYLTADSENDLDEWIRVIQNVLRRQA 95


>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain.  Domain commonly found
           in eukaryotic signalling proteins. The domain family
           possesses multiple functions including the abilities to
           bind inositol phosphates, and various proteins. PH
           domains have been found to possess inserted domains
           (such as in PLC gamma, syntrophins) and to be inserted
           within other domains. Mutations in Brutons tyrosine
           kinase (Btk) within its PH domain cause X-linked
           agammaglobulinaemia (XLA) in patients. Point mutations
           cluster into the positively charged end of the molecule
           around the predicted binding site for
           phosphatidylinositol lipids.
          Length = 102

 Score = 54.9 bits (132), Expect = 1e-10
 Identities = 27/97 (27%), Positives = 39/97 (40%), Gaps = 4/97 (4%)

Query: 40  CRGYLNKM-AGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNS 98
             G+L K   G    W KR+FV    + +L YY  + +KK         +    V     
Sbjct: 3   KEGWLYKKSGGGKKSWKKRYFVL--FNSTLLYYKSKKDKKSYKPKGSIDLSGCTVREAPD 60

Query: 99  VKSPSPHLTFVVKSSDR-TFHLMAPSAEAMRIWIDVI 134
             S      F +K+SDR T  L A S E    W++ +
Sbjct: 61  PDSSKKPHCFEIKTSDRKTLLLQAESEEEREKWVEAL 97


>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin
           homology (PH) domain.  TBC1D2A (also called
           PARIS-1/Prostate antigen recognized and identified by
           SEREX 1 and ARMUS) contains a PH domain and a TBC-type
           GTPase catalytic domain. TBC1D2A integrates signaling
           between Arf6, Rac1, and Rab7 during junction
           disassembly. Activated Rac1 recruits TBC1D2A to locally
           inactivate Rab7 via its C-terminal TBC/RabGAP domain and
           facilitate E-cadherin degradation in lysosomes. The
           TBC1D2A PH domain mediates localization at cell-cell
           contacts and coprecipitates with cadherin complexes. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 101

 Score = 50.7 bits (122), Expect = 4e-09
 Identities = 26/93 (27%), Positives = 37/93 (39%), Gaps = 9/93 (9%)

Query: 42  GYLNKMAGR--FHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSV 99
           GYLNK+  +     W  RWFVFD     L YY     +  +  T    I+        S 
Sbjct: 4   GYLNKLETKGLLKTWKSRWFVFDERKCQLYYY-----RSPQDITPLGSID--LSGAAFSY 56

Query: 100 KSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWID 132
              +   TF + +  R + L A   +AM  W+ 
Sbjct: 57  DPEAEKGTFEIHTPGRVYILKASDRQAMLYWLQ 89


>gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family
           Pleckstrin homology (PH) domain.  Gab proteins are
           scaffolding adaptor proteins, which possess N-terminal
           PH domains and a C-terminus with proline-rich regions
           and multiple phosphorylation sites. Following activation
           of growth factor receptors, Gab proteins are tyrosine
           phosphorylated and activate PI3K, which generates
           3-phosphoinositide lipids. By binding to these lipids
           via the PH domain, Gab proteins remain in proximity to
           the receptor, leading to further signaling. While not
           all Gab proteins depend on the PH domain for
           recruitment, it is required for Gab activity. There are
           3 families: Gab1, Gab2, and Gab3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 103

 Score = 49.7 bits (119), Expect = 9e-09
 Identities = 30/103 (29%), Positives = 41/103 (39%), Gaps = 11/103 (10%)

Query: 40  CRGYLNK----MAGRFHHWNKRWFVFDRTSRS------LAYYSDRSEKKQRGATYFRCIE 89
             G+L K       +   W KRWFV  R+ R       L YY D   KK  GA      E
Sbjct: 1   YEGWLRKSPPEKKIKRAAWKKRWFVL-RSGRLSGDPDVLEYYKDDHCKKPIGAIDLDECE 59

Query: 90  EVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWID 132
           +V        K       F + +  RT++L+A + E M  W+ 
Sbjct: 60  QVDAGLTFEYKEFKNQFIFDIVTPKRTYYLVAETEEEMNKWVR 102


>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
           Pleckstrin homology (PH) domain.  The binding of TAPP2
           (also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
           not PI(3,4, 5)P3, function as negative regulators of
           insulin and PI3K signalling pathways (i.e.
           TAPP/utrophin/syntrophin complex). TAPP2 contains two
           sequential PH domains in which the C-terminal PH domain
           specifically binds PtdIns(3,4)P2 with high affinity. The
           N-terminal PH domain does not interact with any
           phosphoinositide tested. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. The members here are most
           sequence similar to TAPP2 proteins, but may not be
           actual TAPP2 proteins. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 49.7 bits (119), Expect = 1e-08
 Identities = 31/93 (33%), Positives = 40/93 (43%), Gaps = 7/93 (7%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKS 101
           GYL K   R   W KRWFV   T   LAYY +  E +       R I+   +     V+ 
Sbjct: 10  GYLEKKGERRKTWKKRWFVLRPT--KLAYYKNDKEYR-----LLRLIDLTDIHTCTEVQL 62

Query: 102 PSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                TF + +  RTF++ A S   M  WI  I
Sbjct: 63  KKHDNTFGIVTPARTFYVQADSKAEMESWISAI 95


>gnl|CDD|215766 pfam00169, PH, PH domain.  PH stands for pleckstrin homology.
          Length = 101

 Score = 49.4 bits (118), Expect = 1e-08
 Identities = 27/99 (27%), Positives = 38/99 (38%), Gaps = 5/99 (5%)

Query: 40  CRGYLNKM-AGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNS 98
             G+L K  +G    W KR+FV       L YY D  +   R                +S
Sbjct: 3   KEGWLLKKGSGGRKSWKKRYFVL--FDGVLLYYKDSKKSSSRPKGSIPLSGCQVTKVPDS 60

Query: 99  VKSPSPHLTFVVKSSDR-TFHLMAPSAEAMRIWIDVIFS 136
                 +  F +++ DR TF L A S E  + W+  I S
Sbjct: 61  EDGKRKN-CFEIRTGDRETFLLQAESEEERKEWVKAIRS 98


>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH)
           domain, repeat 1.  The functions of these fungal
           proteins are unknown, but they all contain 2 PH domains.
           This cd represents the first PH repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 106

 Score = 49.6 bits (119), Expect = 1e-08
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 7/95 (7%)

Query: 40  CRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSV 99
             G+L K + +   W KRWFV       L+YY D  E K R     R I    +  +  +
Sbjct: 8   KSGWLLKRSRKTKTWKKRWFVLRPC--QLSYYKDEKEYKLR-----RVINLSELTAVAPL 60

Query: 100 KSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           K       F + +  + +H  A S +    W++ I
Sbjct: 61  KDKKRKNVFAIYTPSKNYHFQASSEKDANEWVEAI 95


>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and
           3-Phosphoinositides Pleckstrin homology (PH) domain.
           DAPP1 (also known as PHISH/3'
           phosphoinositide-interacting SH2 domain-containing
           protein or Bam32) plays a role in B-cell activation and
           has potential roles in T-cell and mast cell function.
           DAPP1 promotes B cell receptor (BCR) induced activation
           of Rho GTPases Rac1 and Cdc42, which feed into
           mitogen-activated protein kinases (MAPK) activation
           pathways and affect cytoskeletal rearrangement. DAPP1can
           also regulate BCR-induced activation of extracellular
           signal-regulated kinase (ERK), and c-jun NH2-terminal
           kinase (JNK). DAPP1 contains an N-terminal SH2 domain
           and a C-terminal pleckstrin homology (PH) domain with a
           single tyrosine phosphorylation site located centrally.
           DAPP1 binds strongly to both PtdIns(3,4,5)P3 and
           PtdIns(3,4)P2. The PH domain is essential for plasma
           membrane recruitment of PI3K upon cell activation. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 96

 Score = 48.8 bits (117), Expect = 2e-08
 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 7/93 (7%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKS 101
           GYL K  G   +W  RWFV  +    L Y+  R++ K            V  D+     S
Sbjct: 7   GYLTKQGGIVKNWKTRWFVLRKNE--LKYFKTRTDTKPIRTLDLTECSSVQADY-----S 59

Query: 102 PSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                 F +   DRTF++ A + E    W+ ++
Sbjct: 60  QGKPNCFRLVFPDRTFYMYAKTEEEADEWVKLL 92


>gnl|CDD|241536 cd13385, PH_Gab3, Grb2-associated binding protein 3 pleckstrin
           homology (PH) domain.  The Gab subfamily includes
           several Gab proteins, Drosophila DOS and C. elegans
           SOC-1. They are scaffolding adaptor proteins, which
           possess N-terminal PH domains and a C-terminus with
           proline-rich regions and multiple phosphorylation sites.
           Following activation of growth factor receptors, Gab
           proteins are tyrosine phosphorylated and activate PI3K,
           which generates 3-phosphoinositide lipids. By binding to
           these lipids via the PH domain, Gab proteins remain in
           proximity to the receptor, leading to further signaling.
           While not all Gab proteins depend on the PH domain for
           recruitment, it is required for Gab activity. The
           members in this cd include the Gab1, Gab2, and Gab3
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 48.7 bits (116), Expect = 4e-08
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 54  WNKRWFVFDRTSRS-----LAYYSDRSEKKQ-RGATYFRCIEEVYVDHLNSVKSPSPHLT 107
           W KRWFV  R   S     L YY ++  KK  R      C    +       K    +  
Sbjct: 26  WRKRWFVLRRGRMSGNPDVLEYYRNKHSKKPIRVIDLNECEVTKHAGVNFIKKEFQNNFV 85

Query: 108 FVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           F+VK++ RTF+L+A + E M+ W+  I
Sbjct: 86  FIVKTTTRTFYLVAKTEEEMQDWVQNI 112


>gnl|CDD|241535 cd13384, PH_Gab2_2, Grb2-associated binding protein family
           pleckstrin homology (PH) domain.  The Gab subfamily
           includes several Gab proteins, Drosophila DOS and C.
           elegans SOC-1. They are scaffolding adaptor proteins,
           which possess N-terminal PH domains and a C-terminus
           with proline-rich regions and multiple phosphorylation
           sites. Following activation of growth factor receptors,
           Gab proteins are tyrosine phosphorylated and activate
           PI3K, which generates 3-phosphoinositide lipids. By
           binding to these lipids via the PH domain, Gab proteins
           remain in proximity to the receptor, leading to further
           signaling. While not all Gab proteins depend on the PH
           domain for recruitment, it is required for Gab activity.
           Members here include insect, nematodes, and crustacean
           Gab2s. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 115

 Score = 47.1 bits (112), Expect = 1e-07
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 11/89 (12%)

Query: 54  WNKRWFVFDRTSRS-----LAYYSDRSEKKQRGATYFRCIEEVYVD---HLNSVKSPSPH 105
           W +R+FV  R S       L YY+DR+ +K +G+      E+V  D      +       
Sbjct: 23  WRRRYFVL-RQSEIPGQYFLEYYTDRTCRKLKGSIDLDQCEQV--DAGLTFETKNKLKDQ 79

Query: 106 LTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
             F +++  RT++L+A + + M  W++ I
Sbjct: 80  HIFDIRTPKRTYYLVADTEDEMNKWVNCI 108


>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins
           1, 2, and 3 pleckstrin homology (PH) domain.  PEPP1
           (also called PLEKHA4/PH domain-containing family A
           member 4 and RHOXF1/Rhox homeobox family member 1), and
           related homologs PEPP2 (also called PLEKHA5/PH
           domain-containing family A member 5) and PEPP3 (also
           called PLEKHA6/PH domain-containing family A member 6),
           have PH domains that interact specifically with
           PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3
           specifically are: TAPP1 (tandem PH-domain-containing
           protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd-
           Ins(3,5)P2 (centaurin-beta2). All of these proteins
           contain at least 5 of the 6 conserved amino acids that
           make up the putative phosphatidylinositol 3,4,5-
           trisphosphate-binding motif (PPBM) located at their
           N-terminus. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 104

 Score = 45.7 bits (109), Expect = 3e-07
 Identities = 25/108 (23%), Positives = 39/108 (36%), Gaps = 17/108 (15%)

Query: 34  TLDATSCRGYLNKMAG-RFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGA------TYFR 86
                   G+L+K  G    +W KRWFV       L YY D  E+K  G+      T   
Sbjct: 3   PNAPVVFSGWLHKQGGSGLKNWKKRWFVL--KDNCLYYYKDPEEEKALGSILLPSYTISP 60

Query: 87  CIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                 ++   + K           +  RT++  A + E M  W+  +
Sbjct: 61  ASPSDEINRKFAFK--------AEHAGMRTYYFAADTQEEMEQWMKAL 100


>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and
           related proteins Pleckstrin homology (PH) domain.
           RhoGAP25 (also called ArhGap25) like other RhoGaps are
           involved in cell polarity, cell morphology and
           cytoskeletal organization. They act as GTPase activators
           for the Rac-type GTPases by converting them to an
           inactive GDP-bound state and control actin remodeling by
           inactivating Rac downstream of Rho leading to suppress
           leading edge protrusion and promotes cell retraction to
           achieve cellular polarity and are able to suppress RAC1
           and CDC42 activity in vitro. Overexpression of these
           proteins induces cell rounding with partial or complete
           disruption of actin stress fibers and formation of
           membrane ruffles, lamellipodia, and filopodia. This
           hierarchy contains RhoGAP22, RhoGAP24, and RhoGAP25.
           Members here contain an N-terminal PH domain followed by
           a RhoGAP domain and either a BAR or TATA Binding Protein
           (TBP) Associated Factor 4 (TAF4) domain. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 114

 Score = 43.5 bits (103), Expect = 3e-06
 Identities = 29/109 (26%), Positives = 39/109 (35%), Gaps = 26/109 (23%)

Query: 41  RGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVK 100
            G+L K  G   +W +RWFV       L YY D  E K +G               N+VK
Sbjct: 6   SGWLKKQGGIVKNWQRRWFVL--RGDQLYYYKDEDESKPQGCIPL---------PGNTVK 54

Query: 101 -------SPSPHLTFVVKSSDR--------TFHLMAPSAEAMRIWIDVI 134
                   P   L  ++             ++ LMA S   M  W+ VI
Sbjct: 55  ELPFNPEEPGKFLFEIIPGDGGTRRSANHDSYLLMANSQAEMEEWVKVI 103


>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain.  PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 92

 Score = 42.7 bits (100), Expect = 3e-06
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 42  GYLNKMAGRFHH-WNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVK 100
           G+L K  G+    W KRWFV       L YY  + +  ++        + + V+ ++S  
Sbjct: 3   GWLKKRGGKGLKSWKKRWFVL--FDDVLLYYKSKKDSSKKPKGLIPLSDGLEVELVSSSG 60

Query: 101 SPSPHLTFVVKSSDRTFHLMAPSAEAMRIWID 132
            P+     V     RT++L A S E    W++
Sbjct: 61  KPNC-FELVTPDRGRTYYLQAESEEEREEWLE 91


>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin
           homology (PH) domain.  SWAP-70 (also called
           Differentially expressed in FDCP 6/DEF-6 or IRF4-binding
           protein) functions in cellular signal transduction
           pathways (in conjunction with Rac), regulates cell
           motility through actin rearrangement, and contributes to
           the transformation and invasion activity of mouse embryo
           fibroblasts. Metazoan SWAP-70 is found in B lymphocytes,
           mast cells, and in a variety of organs. Metazoan SWAP-70
           contains an N-terminal EF-hand motif, a centrally
           located PH domain, and a C-terminal coiled-coil domain.
           The PH domain of Metazoan SWAP-70 contains a
           phosphoinositide-binding site and a nuclear localization
           signal (NLS), which localize SWAP-70 to the plasma
           membrane and nucleus, respectively. The NLS is a
           sequence of four Lys residues located at the N-terminus
           of the C-terminal a-helix; this is a unique
           characteristic of the Metazoan SWAP-70 PH domain. The
           SWAP-70 PH domain binds PtdIns(3,4,5)P3 and
           PtdIns(4,5)P2 embedded in lipid bilayer vesicles. There
           are additional plant SWAP70 proteins, but these are not
           included in this hierarchy. Rice SWAP70 (OsSWAP70)
           exhibits GEF activity toward the its Rho GTPase, OsRac1,
           and regulates chitin-induced production of reactive
           oxygen species and defense gene expression in rice.
           Arabidopsis SWAP70 (AtSWAP70) plays a role in both PAMP-
           and effector-triggered immunity. Plant SWAP70 contains
           both DH and PH domains, but their arrangement is the
           reverse of that in typical DH-PH-type Rho GEFs, wherein
           the DH domain is flanked by a C-terminal PH domain. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 110

 Score = 42.7 bits (101), Expect = 4e-06
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 14/98 (14%)

Query: 41  RGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVK 100
           +GYL K       W +RWFV      SL+YY     K+++G        E+ +D    V+
Sbjct: 11  KGYLWKKGHLLPTWRERWFVLKP--NSLSYYKSEDLKEKKG--------EIALDSNCCVE 60

Query: 101 SPSP----HLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           S          F VK+ D+T+ L A   +  + WI  I
Sbjct: 61  SLPDREGKKCRFCVKTPDKTYELSASDHKTRQEWIQAI 98


>gnl|CDD|241297 cd01266, PH_Gab1_Gab2, Grb2-associated binding proteins 1 and 2
           pleckstrin homology (PH) domain.  The Gab subfamily
           includes several Gab proteins, Drosophila DOS and C.
           elegans SOC-1. They are scaffolding adaptor proteins,
           which possess N-terminal PH domains and a C-terminus
           with proline-rich regions and multiple phosphorylation
           sites. Following activation of growth factor receptors,
           Gab proteins are tyrosine phosphorylated and activate
           PI3K, which generates 3-phosphoinositide lipids. By
           binding to these lipids via the PH domain, Gab proteins
           remain in proximity to the receptor, leading to further
           signaling. While not all Gab proteins depend on the PH
           domain for recruitment, it is required for Gab activity.
           The members in this cd include the Gab1 and Gab2
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 123

 Score = 43.0 bits (101), Expect = 5e-06
 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 11/105 (10%)

Query: 40  CRGYLNKMAG----RFHHWNKRWFVFDRTSR------SLAYYSDRSEKKQRGATYFRCIE 89
           C G+L K       R + W KRWFV  R+ R       L YY +   KK          E
Sbjct: 6   CSGWLRKSPPEKKLRRYAWKKRWFVL-RSGRLSGDPDVLEYYKNDHAKKPIRVIDLNLCE 64

Query: 90  EVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           +V      + K       F +K+ DR F+L+A + E M  W+  I
Sbjct: 65  QVDAGLTFNKKELENSYIFDIKTIDRIFYLVAETEEDMNKWVRNI 109


>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP)
           related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin
           homology (PH) domain.  Human ORP10 is involvedt in
           intracellular transport or organelle positioning and is
           proposed to function as a regulator of cellular lipid
           metabolism. Human ORP11 localizes at the Golgi-late
           endosome interface and is thought to form a dimer with
           ORP9 functioning as an intracellular lipid sensor or
           transporter. Both ORP10 and ORP11 contain a N-terminal
           PH domain, a FFAT motif (two phenylalanines in an acidic
           tract), and a C-terminal OSBP-related domain. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 42.2 bits (100), Expect = 5e-06
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 17/108 (15%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQ--RGATYFRCIEEVYVDHL-NS 98
           G L+K       W  RWFV D  + SL Y+     K Q  RG+             L  +
Sbjct: 3   GQLSKYTNVVKGWQNRWFVLDPEAGSLEYFVSEESKNQKPRGSL-----------PLAGA 51

Query: 99  VKSPS---PHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQE 143
           V SPS    H   V  ++   + L A  A+  + W++ + + AE + E
Sbjct: 52  VISPSDEDSHTFTVNAANGEMYKLRAADAKERQEWVNRLRAVAEHHTE 99


>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin
           homology (PH) domain.  RhoGap24 (also called ARHGAP24,
           p73RhoGAp, and Filamin-A-associated RhoGAP) like other
           RhoGAPs are involved in cell polarity, cell morphology
           and cytoskeletal organization. They act as GTPase
           activators for the Rac-type GTPases by converting them
           to an inactive GDP-bound state and control actin
           remodeling by inactivating Rac downstream of Rho leading
           to suppress leading edge protrusion and promotes cell
           retraction to achieve cellular polarity and are able to
           suppress RAC1 and CDC42 activity in vitro.
           Overexpression of these proteins induces cell rounding
           with partial or complete disruption of actin stress
           fibers and formation of membrane ruffles, lamellipodia,
           and filopodia. Members here contain an N-terminal PH
           domain followed by a RhoGAP domain and either a BAR or
           TATA Binding Protein (TBP) Associated Factor 4 (TAF4)
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 41.5 bits (97), Expect = 2e-05
 Identities = 33/111 (29%), Positives = 43/111 (38%), Gaps = 19/111 (17%)

Query: 35  LDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYF---RCIEEV 91
           L+   C G+L K  G    W+ RWFV       L Y+ D  E K  G  +    R  E  
Sbjct: 1   LEVIKC-GWLRKQGGFVKTWHTRWFVL--KGDQLYYFKDEDETKPLGTIFLPGNRVTE-- 55

Query: 92  YVDHLNSVKSPSPHLTFVVKSSDR--------TFHLMAPSAEAMRIWIDVI 134
              H  + + P   L  VV   DR        T+ LMA +   M  W+  I
Sbjct: 56  ---HPCNEEEPGKFLFEVVPGGDRERMTANHETYLLMASTQNDMEDWVKSI 103


>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein 9
           Pleckstrin homology (PH) domain.  Human ORP9 is proposed
           to function in regulation of Akt phosphorylation. ORP9
           has 2 forms, a long (ORP9L) and a short (ORP9S). ORP9L
           contains an N-terminal PH domain, a FFAT motif (two
           phenylalanines in an acidic tract), and a C-terminal
           OSBP-related domain. ORP1S is truncated and contains a
           FFAT motif and an OSBP-related domain. Oxysterol binding
           proteins are a multigene family that is conserved in
           yeast, flies, worms, mammals and plants. In general
           OSBPs and ORPs have been found to be involved in the
           transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 102

 Score = 40.9 bits (96), Expect = 2e-05
 Identities = 29/96 (30%), Positives = 41/96 (42%), Gaps = 15/96 (15%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFR-CIE----EVYVDHL 96
           G L+K       W  RWFV D  +  L+YY+ + EK  RG+   R C+      + +D  
Sbjct: 3   GPLSKWTNVMKGWQYRWFVLDDNAGLLSYYTSK-EKMMRGSR--RGCVRLKGAVIGIDDE 59

Query: 97  NSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWID 132
           +         TF +    +TFH  A  AE    WI 
Sbjct: 60  DDS-------TFTITVDQKTFHFQARDAEERERWIR 88


>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
           domains Pleckstrin homology (PH) domain.  ACAP (also
           called centaurin beta) functions both as a Rab35
           effector and as an Arf6-GTPase-activating protein (GAP)
           by which it controls actin remodeling and membrane
           trafficking. ACAP contain an NH2-terminal
           bin/amphiphysin/Rvs (BAR) domain, a phospholipid-binding
           domain, a PH domain, a GAP domain, and four ankyrin
           repeats. The AZAPs constitute a family of Arf GAPs that
           are characterized by an NH2-terminal pleckstrin homology
           (PH) domain and a central Arf GAP domain followed by two
           or more ankyrin repeats. On the basis of sequence and
           domain organization, the AZAP family is further
           subdivided into four subfamilies: 1) the ACAPs contain
           an NH2-terminal bin/amphiphysin/Rvs (BAR) domain (a
           phospholipid-binding domain that is thought to sense
           membrane curvature), a single PH domain followed by the
           GAP domain, and four ankyrin repeats; 2) the ASAPs also
           contain an NH2-terminal BAR domain, the tandem PH
           domain/GAP domain, three ankyrin repeats, two
           proline-rich regions, and a COOH-terminal Src homology 3
           domain; 3) the AGAPs contain an NH2-terminal GTPase-like
           domain (GLD), a split PH domain, and the GAP domain
           followed by four ankyrin repeats; and 4) the ARAPs
           contain both an Arf GAP domain and a Rho GAP domain, as
           well as an NH2-terminal sterile-a motif (SAM), a
           proline-rich region, a GTPase-binding domain, and five
           PH domains. PMID 18003747 and 19055940 Centaurin can
           bind to phosphatidlyinositol (3,4,5)P3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 98

 Score = 39.9 bits (94), Expect = 4e-05
 Identities = 28/99 (28%), Positives = 38/99 (38%), Gaps = 18/99 (18%)

Query: 42  GYLNKMA-GRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLN--S 98
           GYL K +   F  W +RWF     +  L  Y  R +K             V V+ L   +
Sbjct: 3   GYLFKRSSNAFKTWKRRWFSIQ--NGQL-VYQKRFKKDT---------PTVVVEDLRLCT 50

Query: 99  VK-SPSPHLTFV--VKSSDRTFHLMAPSAEAMRIWIDVI 134
           VK        F   V S  +++ L A S E  + WI  I
Sbjct: 51  VKPCEDIDRRFCFEVVSPTKSYMLQAESEEDRQAWIQAI 89


>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1
           (AtPH1) PH domain.  AtPH1 is expressed in all plant
           tissue and is proposed to be the plant homolog of human
           pleckstrin. Pleckstrin consists of two PH domains
           separated by a linker region, while AtPH has a single PH
           domain with a short N-terminal extension. AtPH1 binds
           PtdIns3P specifically and is thought to be an adaptor
           molecule since it has no obvious catalytic functions. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 117

 Score = 39.6 bits (93), Expect = 6e-05
 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 13/98 (13%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKS 101
           G+L K  G    W +RWFV  +    L Y+  + E              + +    +VKS
Sbjct: 11  GWLTKQGGSIKTWRRRWFVLKQG--KLFYF--KDEDPDSEPR-----GVIDLSDCLTVKS 61

Query: 102 PSPHL----TFVVKSSDRTFHLMAPSAEAMRIWIDVIF 135
                     F V + +RTF+L+A S +    WI  I 
Sbjct: 62  AEEATNKEFAFEVSTPERTFYLIADSEKEKEEWISAIG 99


>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain, repeat 1.  ARAP
           proteins (also called centaurin delta) are
           phosphatidylinositol 3,4,5-trisphosphate-dependent
           GTPase-activating proteins that modulate actin
           cytoskeleton remodeling by regulating ARF and RHO family
           members. They bind phosphatidylinositol
           3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
           phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
           binding. There are 3 mammalian ARAP proteins: ARAP1,
           ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
           SAM (sterile alpha motif) domain, 5 PH domains, an
           ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
           Ras-associating domain. This hierarchy contains the
           first PH domain in ARAP. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 93

 Score = 38.8 bits (91), Expect = 8e-05
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 12/94 (12%)

Query: 42  GYLNKMAGRFHH-WNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVK 100
           G+L+K++ + ++ + KRW VFD    SL Y++  SEK+         I    +  + SV 
Sbjct: 4   GWLDKLSPQGNYVFQKRWVVFD--GDSLRYFN--SEKEMYSK---GIIPLSSIKTVRSVG 56

Query: 101 SPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                  F V + +RTF   A S +   +W+  +
Sbjct: 57  D----NKFEVVTGNRTFVFRAESEDERNLWVSTL 86


>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH)
           domain.  Btk is a member of the Tec family of
           cytoplasmic protein tyrosine kinases that includes BMX,
           IL2-inducible T-cell kinase (Itk) and Tec. Btk plays a
           role in the maturation of B cells. Tec proteins general
           have an N-terminal PH domain, followed by a Tek homology
           (TH) domain, a SH3 domain, a SH2 domain and a kinase
           domain. The Btk PH domain binds phosphatidylinositol
           3,4,5-trisphosphate and responds to signalling via
           phosphatidylinositol 3-kinase. The PH domain is also
           involved in membrane anchoring which is confirmed by the
           discovery of a mutation of a critical arginine residue
           in the BTK PH domain. This results in severe human
           immunodeficiency known as X-linked agammaglobulinemia
           (XLA) in humans and a related disorder is mice.PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 140

 Score = 39.1 bits (92), Expect = 1e-04
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 54  WNKRWFVFDRTSRSLAYYSDRSEK--KQRGA---TYFRCIEEVYVDHLNSVKSPSPHLTF 108
           + +RWFV   T  SL+YY     K  K++G+   +  +C+EEV     +       +  F
Sbjct: 20  YKERWFVL--TKSSLSYYEGDGGKRGKEKGSIDLSKIKCVEEV----KDDASFERKYP-F 72

Query: 109 VVKSSDRTFHLMAPSAEAMRIWI 131
            V   D T ++ APS E    WI
Sbjct: 73  QVVYDDYTLYVFAPSEEDRDEWI 95


>gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
           Pleckstrin homology (PH) domain, N-terminal repeat.  The
           binding of TAPP1 (also called PLEKHA1/pleckstrin
           homology domain containing, family A (phosphoinositide
           binding specific) member 1) and TAPP2 (also called
           PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
           5)P3, function as negative regulators of insulin and
           PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
           complex). TAPP1 and TAPP2 contain two sequential PH
           domains in which the C-terminal PH domain binds
           PtdIns(3,4)P2. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 118

 Score = 38.2 bits (89), Expect = 2e-04
 Identities = 22/99 (22%), Positives = 44/99 (44%), Gaps = 9/99 (9%)

Query: 42  GYL----NKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLN 97
           G+L    N+ +G+F     R+F+ D  +  L +Y D  +    GA     +   Y+  ++
Sbjct: 12  GFLDIEENENSGKFLR---RYFILDTAAGLLLWYMDNPQNLPDGAAPVGSLNLTYISKVS 68

Query: 98  -SVKS-PSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
            + K  P     FV+ +  R + L A   + +  W++ +
Sbjct: 69  DAPKQKPKAEFCFVINALSRRYFLQANDQQDLEEWVEAL 107


>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol
           3-beta-glucosyltransferase Pleckstrin homology (PH)
           domain, repeat 1.  ATG26 (also called
           UGT51/UDP-glycosyltransferase 51), a member of the
           glycosyltransferase 28 family, resulting in the
           biosynthesis of sterol glucoside. ATG26 in decane
           metabolism and autophagy. There are 32 known
           autophagy-related (ATG) proteins, 17 are components of
           the core autophagic machinery essential for all
           autophagy-related pathways and 15 are the additional
           components required only for certain pathways or
           species. The core autophagic machinery includes 1) the
           ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and
           ATG27), 2) the phosphatidylinositol 3-kinase complex
           (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the
           ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7,
           ATG8, ATG10, ATG12, and ATG16). Less is known about how
           the core machinery is adapted or modulated with
           additional components to accommodate the nonselective
           sequestration of bulk cytosol (autophagosome formation)
           or selective sequestration of specific cargos (Cvt
           vesicle, pexophagosome, or bacteria-containing
           autophagosome formation). The pexophagosome-specific
           additions include the ATG30-ATG11-ATG17
           receptor-adaptors complex, the coiled-coil protein
           ATG25, and the sterol glucosyltransferase ATG26. ATG26
           is necessary for the degradation of medium peroxisomes.
           It contains 2 GRAM domains and a single PH domain. PH
           domains are only found in eukaryotes. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. PH domains also have
           diverse functions. They are often involved in targeting
           proteins to the plasma membrane, but few display strong
           specificity in lipid binding. Any specificity is usually
           determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 130

 Score = 37.9 bits (89), Expect = 4e-04
 Identities = 22/102 (21%), Positives = 37/102 (36%), Gaps = 24/102 (23%)

Query: 42  GYLNKMAGRFHHWNKRWFVF--DRTSRSLAYYSDRSEKKQRGATYF-------RCIEEVY 92
           GYL+K   R   +N+ WFV   D     L++Y   ++       YF       R     Y
Sbjct: 33  GYLSKRGKRTPRYNRYWFVLKGD----VLSWYRSSTD------LYFPHGTIDLR-----Y 77

Query: 93  VDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                          F + ++ RT+   A S  + + W+  +
Sbjct: 78  GISAEITDKDKETTHFKITTNSRTYTFKADSEPSAKEWVKAL 119


>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology
           (PH) domain, repeat 2.  ADAP (also called centaurin
           alpha) is a phophatidlyinositide binding protein
           consisting of an N-terminal ArfGAP domain and two PH
           domains. In response to growth factor activation, PI3K
           phosphorylates phosphatidylinositol 4,5-bisphosphate to
           phosphatidylinositol 3,4,5-trisphosphate. Centaurin
           alpha 1 is recruited to the plasma membrane following
           growth factor stimulation by specific binding of its PH
           domain to phosphatidylinositol 3,4,5-trisphosphate.
           Centaurin alpha 2 is constitutively bound to the plasma
           membrane since it binds phosphatidylinositol
           4,5-bisphosphate and phosphatidylinositol
           3,4,5-trisphosphate with equal affinity. This cd
           contains the second PH domain repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 37.2 bits (87), Expect = 4e-04
 Identities = 28/88 (31%), Positives = 37/88 (42%), Gaps = 14/88 (15%)

Query: 54  WNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLT------ 107
           + KRWF  D   R L Y+ D  +   +G  +    EE Y     SV+   P         
Sbjct: 19  FRKRWFTLD--DRRLMYFKDPLDAFPKGEIFIGSKEEGY-----SVREGLPAGIKGHWGF 71

Query: 108 -FVVKSSDRTFHLMAPSAEAMRIWIDVI 134
            F + + DRTF L A + E  R WI  I
Sbjct: 72  GFTLVTPDRTFVLSAETEEERREWITAI 99


>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat
           2.  MyoX, a MyTH-FERM myosin, is a molecular motor that
           has crucial functions in the transport and/or tethering
           of integrins in the actin-based extensions known as
           filopodia, microtubule binding, and in netrin-mediated
           axon guidance. It functions as a dimer. MyoX walks on
           bundles of actin, rather than single filaments, unlike
           the other unconventional myosins. MyoX is present in
           organisms ranging from humans to choanoflagellates, but
           not in Drosophila and Caenorhabditis elegans.MyoX
           consists of a N-terminal motor/head region, a neck made
           of 3 IQ motifs, and a tail consisting of a coiled-coil
           domain, a PEST region, 3 PH domains, a myosin tail
           homology 4 (MyTH4), and a FERM domain at its very
           C-terminus. The first PH domain in the MyoX tail is a
           split-PH domain, interupted by the second PH domain such
           that PH 1a and PH 1b flanks PH 2. The third PH domain
           (PH 3) follows the PH 1b domain. This cd contains the
           second PH repeat. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 37.4 bits (87), Expect = 4e-04
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 54  WNKRWFVFDRTSRSLAYY-SDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKS 112
           W  RWFV   T   L YY +D+   K  G    R  +E+ VD  N+ K       F + +
Sbjct: 28  WKSRWFVLRDTV--LKYYENDQEGAKALGTIDIRSAKEI-VD--NTPKENG----FDITT 78

Query: 113 SDRTFHLMAPSAEAMRIWIDVI 134
             RT+H +A S E    W  V+
Sbjct: 79  PSRTYHFVAESPEDASQWFSVL 100


>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for
          Phosphoinositides-1-like Pleckstrin homology (PH)
          domain.  GRP1/cytohesin3 and the related proteins ARNO
          (ARF nucleotide-binding site opener)/cytohesin-2 and
          cytohesin-1 are ARF exchange factors that contain a
          pleckstrin homology (PH) domain thought to target these
          proteins to cell membranes through binding
          polyphosphoinositides. The PH domains of all three
          proteins exhibit relatively high affinity for
          PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G)
          and triglycine (3G) splice variants, differing only in
          the number of glycine residues in the PH domain,
          strongly influence the affinity and specificity for
          phosphoinositides. The 2G variants selectively bind
          PtdIns(3,4,5)P3 with high affinity,the 3G variants bind
          PtdIns(3,4,5)P3 with about 30-fold lower affinity and
          require the polybasic region for plasma membrane
          targeting. These ARF-GEFs share a common, tripartite
          structure consisting of an N-terminal coiled-coil
          domain, a central domain with homology to the yeast
          protein Sec7, a PH domain, and a C-terminal polybasic
          region. The Sec7 domain is autoinhibited by conserved
          elements proximal to the PH domain. GRP1 binds to the
          DNA binding domain of certain nuclear receptors
          (TRalpha, TRbeta, AR, ER, but not RXR), and can repress
          thyroid hormone receptor (TR)-mediated transactivation
          by decreasing TR-complex formation on thyroid hormone
          response elements. ARNO promotes sequential activation
          of Arf6, Cdc42 and Rac1 and insulin secretion.
          Cytohesin acts as a PI 3-kinase effector mediating
          biological responses including cell spreading and
          adhesion, chemotaxis, protein trafficking, and
          cytoskeletal rearrangements, only some of which appear
          to depend on their ability to activate ARFs. PH domains
          have diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 118

 Score = 35.7 bits (83), Expect = 0.002
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 42 GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRG 81
          G+L K+ GR   W +RWF+   T   L Y+   ++K+ RG
Sbjct: 7  GWLLKLGGRVKSWKRRWFIL--TDNCLYYFEYTTDKEPRG 44


>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH)
           domain.  The sesquipedalian family has 2 mammalian
           members: Ses1 and Ses2, which are also callled 7 kDa
           inositol polyphosphate phosphatase-interacting protein 1
           and 2. They play a role in endocytic trafficking and are
           required for receptor recycling from endosomes, both to
           the trans-Golgi network and the plasma membrane. Members
           of this family form homodimers and heterodimers.
           Sesquipedalian interacts with inositol polyphosphate
           5-phosphatase OCRL-1 (INPP5F) also known as Lowe
           oculocerebrorenal syndrome protein, a phosphatase enzyme
           that is involved in actin polymerization and is found in
           the trans-Golgi network and INPP5B. Sesquipedalian
           contains a single PH domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 120

 Score = 35.7 bits (83), Expect = 0.002
 Identities = 24/107 (22%), Positives = 39/107 (36%), Gaps = 14/107 (13%)

Query: 33  LTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYF-RCIEEV 91
                    GYL K   R   + KRWFV       L Y+  + +++  G      C  E+
Sbjct: 3   SCNSPVDKEGYLWKKGERNTSYQKRWFVL--KGNLLFYFEKKGDREPLGVIVLEGCTVEL 60

Query: 92  YVDHLNSVKSPSPHLTFVVK---SSDRTFHLMAPSAEAMRIWIDVIF 135
                   +   P+  F ++      R++ L A S E M  W+  + 
Sbjct: 61  -------SEDEEPY-AFAIRFDGPGSRSYVLAAESQEDMESWMKALS 99


>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin
           homology (PH) domain.  RhoGAP2 (also called RhoGap22 or
           ArhGap22) are involved in cell polarity, cell morphology
           and cytoskeletal organization. They activate a GTPase
           belonging to the RAS superfamily of small GTP-binding
           proteins. The encoded protein is insulin-responsive, is
           dependent on the kinase Akt, and requires the
           Akt-dependent 14-3-3 binding protein which binds
           sequentially to two serine residues resulting in
           regulation of cell motility. Members here contain an
           N-terminal PH domain followed by a RhoGAP domain and
           either a BAR or TATA Binding Protein (TBP) Associated
           Factor 4 (TAF4) domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 116

 Score = 35.7 bits (82), Expect = 0.002
 Identities = 29/104 (27%), Positives = 41/104 (39%), Gaps = 16/104 (15%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLN-SVK 100
           G+L K      +W +RWFV       L YY D  E K +G      ++   V+ L  + +
Sbjct: 7   GWLKKQRSIMKNWQQRWFVL--RGDQLFYYKDEEETKPQG---CISLQGSQVNELPPNPE 61

Query: 101 SPSPHLTFV----------VKSSDRTFHLMAPSAEAMRIWIDVI 134
            P  HL  +          V  +   F LMA S   M  W+  I
Sbjct: 62  EPGKHLFEILPGGAGDREKVPMNHEAFLLMANSQSDMEDWVKAI 105


>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH)
           domain, repeat 3.  MyoX, a MyTH-FERM myosin, is a
           molecular motor that has crucial functions in the
           transport and/or tethering of integrins in the
           actin-based extensions known as filopodia, microtubule
           binding, and in netrin-mediated axon guidance. It
           functions as a dimer. MyoX walks on bundles of actin,
           rather than single filaments, unlike the other
           unconventional myosins. MyoX is present in organisms
           ranging from humans to choanoflagellates, but not in
           Drosophila and Caenorhabditis elegans.MyoX consists of a
           N-terminal motor/head region, a neck made of 3 IQ
           motifs, and a tail consisting of a coiled-coil domain, a
           PEST region, 3 PH domains, a myosin tail homology 4
           (MyTH4), and a FERM domain at its very C-terminus. The
           first PH domain in the MyoX tail is a split-PH domain,
           interupted by the second PH domain such that PH 1a and
           PH 1b flanks PH 2. The third PH domain (PH 3) follows
           the PH 1b domain. This cd contains the third MyoX PH
           repeat. PLEKHH3/Pleckstrin homology (PH) domain
           containing, family H (with MyTH4 domain) member 3 is
           also part of this CD and like MyoX contains a FERM
           domain, a MyTH4 domain, and a single PH domain. Not much
           is known about the function of PLEKHH3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 123

 Score = 35.0 bits (81), Expect = 0.003
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 18/87 (20%)

Query: 56  KRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHL-------TF 108
           KRWFV   T  SL YY        +  +       + ++ L SV  P   +       TF
Sbjct: 33  KRWFVL--TPNSLDYYKSSERNALKLGS-------LVLNSLCSVVPPDEKVYKETGYWTF 83

Query: 109 VVKSSDRTFHLMAPS-AEAMRIWIDVI 134
            V     +++L      EA R W++ I
Sbjct: 84  TVHGRKHSYYLYTKLQEEANR-WVNAI 109


>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein
           homologs 1 and 2 Pleckstrin homology (PH) domain.  Yeast
           Osh1p is proposed to function in postsynthetic sterol
           regulation, piecemeal microautophagy of the nucleus, and
           cell polarity establishment. Yeast Osh2p is proposed to
           function in sterol metabolism and cell polarity
           establishment. Both Osh1p and Osh2p contain 3 N-terminal
           ankyrin repeats, a PH domain, a FFAT motif (two
           phenylalanines in an acidic tract), and a C-terminal
           OSBP-related domain. OSBP andOsh1p PH domains
           specifically localize to the Golgi apparatus in a
           PtdIns4P-dependent manner. Oxysterol binding proteins
           are a multigene family that is conserved in yeast,
           flies, worms, mammals and plants. In general OSBPs and
           ORPs have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 34.2 bits (79), Expect = 0.005
 Identities = 29/113 (25%), Positives = 42/113 (37%), Gaps = 17/113 (15%)

Query: 37  ATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDR-SEKKQ-RGATYFRCIEEVYVD 94
             + +GYL K       +  RWFV +     L+YY  +  E    RG+   +    V   
Sbjct: 1   PPTMKGYLKKWTNYAKGYKTRWFVLE--DGVLSYYRHQDDEGSACRGSINMKNARLVS-- 56

Query: 95  HLNSVKSPSPHLTFVVKSSDRT---FHLMAPS-AEAMRIWIDVIFSGAEGYQE 143
                  PS  L F V S       ++L A    EA R WI  +    E  ++
Sbjct: 57  ------DPSEKLRFEVSSKTSGSPKWYLKANHPVEAAR-WIQALQKAIEWAKD 102


>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
          domain, repeat 1.  Pleckstrin is a protein found in
          platelets. This name is derived from platelet and
          leukocyte C kinase substrate and the KSTR string of
          amino acids. Pleckstrin 2 contains two PH domains and a
          DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
          pleckstrin 1, pleckstrin 2 does not contain obvious
          sites of PKC phosphorylation. Pleckstrin 2 plays a role
          in actin rearrangement, large lamellipodia and
          peripheral ruffle formation, and may help orchestrate
          cytoskeletal arrangement. The PH domains of pleckstrin
          2 are thought to contribute to lamellipodia formation.
          This cd contains the first PH domain repeat. PH domains
          have diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 108

 Score = 34.3 bits (79), Expect = 0.005
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%)

Query: 42 GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRG 81
          G+L K     ++W  RWFV       L YY  +++   +G
Sbjct: 7  GFLVKKGHVVNNWKARWFVL--LEDKLEYYKKKTDSSPKG 44


>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin
           homology (PH) domain.  The GPBP (also called Collagen
           type IV alpha-3-binding protein/hCERT; START
           domain-containing protein 11/StARD11; StAR-related lipid
           transfer protein 11) is a kinase that phosphorylates an
           N-terminal region of the alpha 3 chain of type IV
           collagen, which is commonly known as the goodpasture
           antigen. Its splice variant the ceramide transporter
           (CERT) mediates the cytosolic transport of ceramide.
           There have been additional splice variants identified,
           but all of them function as ceramide transport proteins.
           GPBP and CERT both contain an N-terminal PH domain,
           followed by a serine rich domain, and a C-terminal START
           domain. However, GPBP has an additional serine rich
           domain just upstream of its START domain. They are
           members of the oxysterol binding protein (OSBP) family
           which includes OSBP, OSBP-related proteins (ORP),
           Goodpasture antigen binding protein (GPBP), and Four
           phosphate adaptor protein 1 (FAPP1). They have a wide
           range of purported functions including sterol transport,
           cell cycle control, pollen development and vessicle
           transport from Golgi recognize both PI lipids and ARF
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score = 33.0 bits (76), Expect = 0.014
 Identities = 30/101 (29%), Positives = 42/101 (41%), Gaps = 22/101 (21%)

Query: 41  RGYLNKMAGRFHHWNKRWFVF-DRTSRSLAYYSDRSEKKQ--RGATYFRCIEEVYVDHLN 97
           RG L+K     H W  R+FV  D T   L+YY    E +   RG+   R           
Sbjct: 2   RGVLSKWTNYIHGWQDRYFVLKDGT---LSYYKSEDETQYGCRGSISLRKA--------- 49

Query: 98  SVKSPSPH----LTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
            +K   PH      F V  +D  ++L A S E  + W+D +
Sbjct: 50  VIK---PHEFDECRFDVSVNDSVWYLRAESPEERQRWVDAL 87


>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
           Pleckstrin homology (PH) domain, C-terminal repeat.  The
           binding of TAPP1 (also called PLEKHA1/pleckstrin
           homology domain containing, family A (phosphoinositide
           binding specific) member 1) and TAPP2 (also called
           PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
           5)P3, function as negative regulators of insulin and
           PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
           complex). TAPP1 and TAPP2 contain two sequential PH
           domains in which the C-terminal PH domain specifically
           binds PtdIns(3,4)P2 with high affinity. The N-terminal
           PH domain does not interact with any phosphoinositide
           tested. They also contain a C-terminal PDZ-binding motif
           that interacts with several PDZ-binding proteins,
           including PTPN13 (known previously as PTPL1 or FAP-1) as
           well as the scaffolding proteins MUPP1 (multiple
           PDZ-domain-containing protein 1), syntrophin and
           utrophin. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 33.1 bits (76), Expect = 0.015
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 18/100 (18%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKS 101
           GY  K      +W +R+F+ D    +++YY   ++K+         +  + +  +  V  
Sbjct: 12  GYCVKQGAVRKNWKRRYFILD--DNTISYYKSETDKEP--------LRTIPLKEVLKVHE 61

Query: 102 -------PSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                     +L F + ++ RTF++ A S E M  WI  I
Sbjct: 62  CLSGDLLMRDNL-FEIITTSRTFYIQADSPEDMHSWIKAI 100


>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain.  Yeast
          Boi proteins Boi1 and Boi2 are functionally redundant
          and important for cell growth with Boi mutants
          displaying defects in bud formation and in the
          maintenance of cell polarity.They appear to be linked
          to Rho-type GTPase, Cdc42 and Rho3. Boi1 and Boi2
          display two-hybrid interactions with the GTP-bound
          ("active") form of Cdc42, while Rho3 can suppress of
          the lethality caused by deletion of Boi1 and Boi2.
          These findings suggest that Boi1 and Boi2 are targets
          of Cdc42 that promote cell growth in a manner that is
          regulated by Rho3. Boi proteins contain a N-terminal
          SH3 domain, followed by a SAM (sterile alpha motif)
          domain, a proline-rich region, which mediates binding
          to the second SH3 domain of Bem1, and C-terminal PH
          domain. The PH domain is essential for its function in
          cell growth and is important for localization to the
          bud, while the SH3 domain is needed for localization to
          the neck. PH domains have diverse functions, but in
          general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 95

 Score = 32.3 bits (74), Expect = 0.020
 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 2/42 (4%)

Query: 40 CRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRG 81
            G++ K   R+  W  R+FV   T   L Y    ++ K++G
Sbjct: 1  HSGWMKKRGERYGTWKTRYFVLKGT--RLYYLKSENDSKEKG 40


>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding
           protein related protein 2 Pleckstrin homology (PH)
           domain.  There are 2 types of ORPs found in
           Cryptosporidium: CpORP1 and CpORP2. Cryptosporium
           differs from other apicomplexans like Plasmodium,
           Toxoplasma, and Eimeria which possess only a single
           long-type ORP consisting of an N-terminal PH domain
           followed by a C-terminal ligand binding (LB) domain.
           CpORP2 is like this, but CpORP1 differs and has a
           truncated N-terminus resulting in only having a LB
           domain present. The exact functions of these proteins
           are largely unknown though CpORP1 is thought to be
           involved in lipid transport across the parasitophorous
           vacuole membrane. Oxysterol binding proteins are a
           multigene family that is conserved in yeast, flies,
           worms, mammals and plants. In general OSBPs and ORPs
           have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 88

 Score = 31.9 bits (73), Expect = 0.024
 Identities = 21/94 (22%), Positives = 32/94 (34%), Gaps = 17/94 (18%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVK- 100
           GYL K    F+ W  R+F+       +  YS +    ++G             HL     
Sbjct: 3   GYLKKWTNIFNSWKPRYFILY---PGILCYSKQKGGPKKG-----------TIHLKICDI 48

Query: 101 --SPSPHLTFVVKSSDRTFHLMAPSAEAMRIWID 132
              P   L  ++ +     HL A S E    W +
Sbjct: 49  RLVPDDPLRIIINTGTNQLHLRASSVEEKLKWYN 82


>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein
           family Pleckstrin homology (PH) domain.  Skap adaptor
           proteins couple receptors to cytoskeletal
           rearrangements. Src kinase-associated phosphoprotein of
           55 kDa (Skap55)/Src kinase-associated phosphoprotein 1
           (Skap1), Skap2, and Skap-homology (Skap-hom) have an
           N-terminal coiled-coil conformation, a central PH domain
           and a C-terminal SH3 domain. Their PH domains bind
           3'-phosphoinositides as well as directly affecting
           targets such as in Skap55 where it directly affecting
           integrin regulation by ADAP and NF-kappaB activation or
           in Skap-hom where the dimerization and PH domains
           comprise a 3'-phosphoinositide-gated molecular switch
           that controls ruffle formation. PH domains are only
           found in eukaryotes. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 106

 Score = 32.4 bits (74), Expect = 0.026
 Identities = 28/100 (28%), Positives = 37/100 (37%), Gaps = 13/100 (13%)

Query: 42  GYLNKMAGRFHH------WNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDH 95
           GYL K   R  H      W KRW V   T  +  YY    +K+Q+G              
Sbjct: 5   GYLEKR--RKDHSFFGSEWQKRWCVLSNT--AFYYYGSEKDKQQKGEFAIDGYRARMNPT 60

Query: 96  LNSVKSPSPHLTFVVKSSD-RTFHLMAPSAEAMRIWIDVI 134
           L   K       F + + D R +   A S +  R W+D I
Sbjct: 61  LR--KDSKKDCCFEISAPDKRVYQFTAASPKEAREWVDQI 98


>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin
           homology (PH) domain.  The kinesin-3 family motors KIFIA
           (Caenorhabditis elegans homolog unc-104) and KIFIB
           transport synaptic vesicle precursors that contain
           synaptic vesicle proteins, such as synaptophysin,
           synaptotagmin and the small GTPase RAB3A, but they do
           not transport organelles that contain plasma membrane
           proteins. They have a N-terminal motor domain, followed
           by a coiled-coil domain, and a C-terminal PH domain.
           KIF1A adopts a monomeric form in vitro, but acts as a
           processive dimer in vivo. KIF1B has alternatively
           spliced isoforms distinguished by the presence or
           absence of insertion sequences in the conserved
           amino-terminal region of the protein; this results in
           their different motor activities. KIF1A and KIF1B bind
           to RAB3 proteins through the adaptor protein
           mitogen-activated protein kinase (MAPK) -activating
           death domain (MADD; also calledDENN), which was first
           identified as a RAB3 guanine nucleotide exchange factor
           (GEF). PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 31.4 bits (72), Expect = 0.054
 Identities = 25/107 (23%), Positives = 38/107 (35%), Gaps = 20/107 (18%)

Query: 36  DATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDH 95
              S +GYL  +      W +RW V  R    L  YS   +  +RG      +    V++
Sbjct: 12  PVVSKKGYLLFLEDATDGWVRRWVVLRRP--YLHIYSSEKDGDERGVIN---LSTARVEY 66

Query: 96  LNSVKSPSPHL--------TFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
                  SP           F V +   ++ L A S + M  W+  I
Sbjct: 67  -------SPDQEALLGRPNVFAVYTPTNSYLLQARSEKEMHDWLYAI 106


>gnl|CDD|241443 cd13289, PH_Osh3p_yeast, Yeast oxysterol binding protein homolog 3
           Pleckstrin homology (PH) domain.  Yeast Osh3p is
           proposed to function in sterol transport and regulation
           of nuclear fusion during mating and of pseudohyphal
           growth as well as sphingolipid metabolism. Osh3 contains
           a N-GOLD (Golgi dynamics) domain, a PH domain, a FFAT
           motif (two phenylalanines in an acidic tract), and a
           C-terminal OSBP-related domain. GOLD domains are thought
           to mediate protein-protein interactions, but their role
           in ORPs are unknown. Oxysterol binding proteins are a
           multigene family that is conserved in yeast, flies,
           worms, mammals and plants. In general OSBPs and ORPs
           have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 90

 Score = 31.1 bits (71), Expect = 0.057
 Identities = 24/98 (24%), Positives = 38/98 (38%), Gaps = 19/98 (19%)

Query: 40  CRGYL-----NKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVD 94
             G+L      KM G F    +R+FV +    +L+YY +      RG    R        
Sbjct: 2   LEGWLLKKRRKKMQG-FA---RRYFVLNFKYGTLSYYFNP-NSPVRGQIPLR-------- 48

Query: 95  HLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWID 132
            L S+ +     T  + S    +HL A + E  + W+ 
Sbjct: 49  -LASISASPRRRTIHIDSGSEVWHLKALNDEDFQAWMK 85


>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
           domain, repeat 2.  Pleckstrin is a protein found in
           platelets. This name is derived from platelet and
           leukocyte C kinase substrate and the KSTR string of
           amino acids. Pleckstrin 2 contains two PH domains and a
           DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
           pleckstrin 1, pleckstrin 2 does not contain obvious
           sites of PKC phosphorylation. Pleckstrin 2 plays a role
           in actin rearrangement, large lamellipodia and
           peripheral ruffle formation, and may help orchestrate
           cytoskeletal arrangement. The PH domains of pleckstrin 2
           are thought to contribute to lamellipodia formation.
           This cd contains the second PH domain repeat. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 109

 Score = 30.9 bits (70), Expect = 0.082
 Identities = 23/100 (23%), Positives = 38/100 (38%), Gaps = 10/100 (10%)

Query: 41  RGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFR-CIEEVYVDHLNSV 99
           +G L K   R  +W  R FV       L YY     +   GA + R C+    V  +   
Sbjct: 10  QGCLLKQGHRRKNWKVRKFVLRDDPAYLHYYDPAKGEDPLGAIHLRGCV----VTAVEDN 65

Query: 100 KSPSPH-----LTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
            +P+       L  ++ + +  ++L A +      WI  I
Sbjct: 66  SNPAKGSVEGNLFEIITADEVHYYLQAATPAERTEWIKAI 105


>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and
           OSBP-related protein 4 Pleckstrin homology (PH) domain. 
           Human OSBP is proposed to function is sterol-dependent
           regulation of ERK dephosphorylation and sphingomyelin
           synthesis as well as modulation of insulin signaling and
           hepatic lipogenesis. It contains a N-terminal PH domain,
           a FFAT motif (two phenylalanines in an acidic tract),
           and a C-terminal OSBP-related domain. OSBPs and Osh1p PH
           domains specifically localize to the Golgi apparatus in
           a PtdIns4P-dependent manner. ORP4 is proposed to
           function in Vimentin-dependent sterol transport and/or
           signaling. Human ORP4 has 2 forms, a long (ORP4L) and a
           short (ORP4S). ORP4L contains a N-terminal PH domain, a
           FFAT motif (two phenylalanines in an acidic tract), and
           a C-terminal OSBP-related domain. ORP4S is truncated and
           contains only an OSBP-related domain. Oxysterol binding
           proteins are a multigene family that is conserved in
           yeast, flies, worms, mammals and plants. They all
           contain a C-terminal oxysterol binding domain, and most
           contain an N-terminal PH domain. OSBP PH domains bind to
           membrane phosphoinositides and thus likely play an
           important role in intracellular targeting. They are
           members of the oxysterol binding protein (OSBP) family
           which includes OSBP, OSBP-related proteins (ORP),
           Goodpasture antigen binding protein (GPBP), and Four
           phosphate adaptor protein 1 (FAPP1). They have a wide
           range of purported functions including sterol transport,
           cell cycle control, pollen development and vessicle
           transport from Golgi recognize both PI lipids and ARF
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 99

 Score = 30.8 bits (70), Expect = 0.088
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 17/95 (17%)

Query: 41  RGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQ--RGATYFRCIEEVYVDHLNS 98
           +G+L K       + +RWFV    +  L+YY +++E     RG           ++   +
Sbjct: 2   KGWLLKWTNYLKGYQRRWFVLS--NGLLSYYRNQAEMAHTCRGT----------INLAGA 49

Query: 99  VKSPSPHLTFVVK-SSDRTFHLMAPS-AEAMRIWI 131
           +        FV+     +TFHL A S  E  R W+
Sbjct: 50  LIHTEDSCNFVISNGGTQTFHLKASSEVERQR-WV 83


>gnl|CDD|241538 cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 3 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Both FGD1 and FGD3 are
           targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
           upon phosphorylation of two serine residues in its
           DSGIDS motif and subsequently degraded by the
           proteasome. However, FGD1 and FGD3 induced significantly
           different morphological changes in HeLa Tet-Off cells
           and while FGD1 induced long finger-like protrusions,
           FGD3 induced broad sheet-like protrusions when the level
           of GTP-bound Cdc42 was significantly increased by the
           inducible expression of FGD3. They also reciprocally
           regulated cell motility in inducibly expressed in HeLa
           Tet-Off cells, FGD1 stimulated cell migration while FGD3
           inhibited it. FGD1 and FGD3 therefore play different
           roles to regulate cellular functions, even though their
           intracellular levels are tightly controlled by the same
           destruction pathway through SCF(FWD1/beta-TrCP).  PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 30.7 bits (69), Expect = 0.097
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 99  VKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQE 143
           VK    H TF++    R+  L A + E  + WI VI +  E +++
Sbjct: 59  VKQNVAH-TFIITGKKRSLELQARTEEEKKEWIQVIQATIEKHKQ 102


>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1
           Pleckstrin homology (PH) domain.  Adaptor protein Skap1
           (also called Skap55/Src kinase-associated phosphoprotein
           of 55 kDa) and its partner, ADAP (adhesion and
           degranulation promoting adapter protein) help reorganize
           the cytoskeleton and/or promote integrin-mediated
           adhesion upon immunoreceptor activation. Skap1 is also
           involved in T Cell Receptor (TCR)-induced RapL-Rap1
           complex formation and LFA-1 activation. Skap1 has an
           N-terminal coiled-coil conformation which is proposed to
           be involved in homodimer formation, a central PH domain
           and a C-terminal SH3 domain that associates with ADAP.
           The Skap1 PH domain plays a role in controlling integrin
           function via recruitment of ADAP-SKAP complexes to
           integrins as well as in controlling the ability of ADAP
           to interact with the CBM signalosome and regulate
           NF-kappaB. SKAP1 is necessary for RapL binding to
           membranes in a PH domain-dependent manner and the PI3K
           pathway. Skap adaptor proteins couple receptors to
           cytoskeletal rearrangements. Skap55/Skap1, Skap2, and
           Skap-homology (Skap-hom) have an N-terminal coiled-coil
           conformation, a central PH domain and a C-terminal SH3
           domain. Their PH domains bind 3'-phosphoinositides as
           well as directly affecting targets such as in Skap55
           where it directly affecting integrin regulation by ADAP
           and NF-kappaB activation or in Skap-hom where the
           dimerization and PH domains comprise a
           3'-phosphoinositide-gated molecular switch that controls
           ruffle formation. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 106

 Score = 29.9 bits (67), Expect = 0.17
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 9/99 (9%)

Query: 41  RGYLNKMA---GRF-HHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHL 96
           +GYL K +   G F   W KRW V     R+  YY++   K+ +G    +        HL
Sbjct: 4   QGYLEKRSKDHGFFGSEWQKRWCVLTT--RAFYYYANEKSKQPKGGFLIKDSLAQMAPHL 61

Query: 97  NSVKSPSPHLTFVVKSSD-RTFHLMAPSAEAMRIWIDVI 134
              K       F + + + RT+   A S    R W+D I
Sbjct: 62  R--KDSRRDSCFELTTPNQRTYEFTAASPSEARDWVDQI 98


>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain.  ASAPs (ASAP1,
           ASAP2, and ASAP3) function as an Arf-specific GAPs,
           participates in rhodopsin trafficking, is associated
           with tumor cell metastasis, modulates phagocytosis,
           promotes cell proliferation, facilitates vesicle
           budding, Golgi exocytosis, and regulates vesicle coat
           assembly via a Bin/Amphiphysin/Rvs domain. ASAPs contain
           an NH2-terminal BAR domain, a tandem PH domain/GAP
           domain, three ankyrin repeats, two proline-rich regions,
           and a COOH-terminal Src homology 3 (SH3) domain. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 108

 Score = 30.0 bits (68), Expect = 0.18
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 108 FVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           F + S +RT+H  A   +    WI V+
Sbjct: 71  FDLISHNRTYHFQAEDEQEAEAWISVL 97


>gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH)
          domain.  PKB (also called Akt), a member of the AGC
          kinase family, is a phosphatidylinositol 3'-kinase
          (PI3K)-dependent Ser/Thr kinase which alters the
          activity of the targeted protein. The name AGC is based
          on the three proteins that it is most similar to
          cAMP-dependent protein kinase 1 (PKA; also known as
          PKAC), cGMP-dependent protein kinase (PKG; also known
          as CGK1) and protein kinase C (PKC). Human Akt has
          three isoforms derived for distinct genes:
          Akt1/PKBalpha, Akt2/PKBbeta, and Akt3/PKBgamma. All
          Akts have an N-terminal PH domain with an activating
          Thr phosphorylation site, a kinase domain, and a short
          C-terminal regulatory tail with an activating Ser
          phosphorylation site. The PH domain recruits Akt to the
          plasma membrane by binding to phosphoinositides
          (PtdIns-3,4-P2) and is required for activation. The
          phosphorylation of Akt at its Thr and Ser
          phosphorylation sites leads to increased Akt activity
          toward forkhead transcription factors, the mammalian
          target of rapamycin (mTOR), and the
          Bcl-xL/Bcl-2-associated death promoter (BAD), all of
          which possess a consensus motif R-X-R-XX-ST-B (X =
          amino acid, B = bulky hydrophobic residue) for Akt
          phosphorylation. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 121

 Score = 29.6 bits (67), Expect = 0.25
 Identities = 8/19 (42%), Positives = 9/19 (47%)

Query: 42 GYLNKMAGRFHHWNKRWFV 60
          G+L K       W  RWFV
Sbjct: 7  GWLTKRGEYIKTWRPRWFV 25


>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein
           Pleckstrin homology (PH) domain.  M-RIP is proposed to
           play a role in myosin phosphatase regulation by RhoA.
           M-RIP contains 2 PH domains followed by a Rho binding
           domain (Rho-BD), and a C-terminal myosin binding subunit
           (MBS) binding domain (MBS-BD). The amino terminus of
           M-RIP with its adjacent PH domains and polyproline
           motifs mediates binding to both actin and Galpha. M-RIP
           brings RhoA and MBS into close proximity where M-RIP can
           target RhoA to the myosin phosphatase complex to
           regulate the myosin phosphorylation state. M-RIP does
           this via its C-terminal coiled-coil domain which
           interacts with the MBS leucine zipper domain of myosin
           phosphatase, while its Rho-BD, directly binds RhoA in a
           nucleotide-independent manner. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 103

 Score = 29.6 bits (67), Expect = 0.26
 Identities = 22/86 (25%), Positives = 32/86 (37%), Gaps = 14/86 (16%)

Query: 54  WNKRWFVFDRTSRSLAYYSDRSEKKQR----GATYFRCIEEVYVDHLNSVKSPSPHLTFV 109
           W K WFV      SL YY D S  ++     G         V      +      +  F 
Sbjct: 14  WKKHWFVL--RDASLRYYRD-SVAEEAGELDGVIDLSTCTNV------TELPVQRNYGFQ 64

Query: 110 VKSSD-RTFHLMAPSAEAMRIWIDVI 134
           +K+ D + + L A ++   R WI  I
Sbjct: 65  IKTWDGKRYVLSAMTSGIRRNWIQAI 90


>gnl|CDD|241293 cd01262, PH_PDK1, 3-Phosphoinositide dependent protein kinase 1
           (PDK1) pleckstrin homology (PH) domain.  PDK1 plays an
           important role in insulin and growth factor signalling
           cascades. It phosphorylates and activates many AGC
           (cAMP-dependent, cGMP-dependent, protein kinase C (PKC))
           family of protein kinases members, including protein
           kinase B (PKB, also known as Akt), p70 ribosomal
           S6-kinase (S6K), serum and glucocorticoid responsive
           kinase (SGK), p90 ribosomal S6 kinase (RSK), and PKC.
           PDK1 contains an N-terminal serine/threonine kinase
           domain followed by a PH domain. Following binding of the
           PH domain to PtdIns(3,4,5)P3 and PtdIns(3,4)P2, PDK1
           activates these enzymes by phosphorylating a Ser/Thr
           residue in their activation loop. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 107

 Score = 28.7 bits (65), Expect = 0.52
 Identities = 9/28 (32%), Positives = 15/28 (53%), Gaps = 1/28 (3%)

Query: 107 TFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           TF + + +RT++L  P   A + W   I
Sbjct: 73  TFFIHTPNRTYYLEDPEGNAKK-WCKAI 99


>gnl|CDD|177836 PLN02180, PLN02180, gamma-glutamyl transpeptidase 4.
          Length = 639

 Score = 29.6 bits (66), Expect = 0.65
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 11  GDSLDLRQHIEAAGHQLEACSHL-TLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLA 69
           G  L L + IEA  H   A   L   +  +    +N+M  + H    +  +FD T+    
Sbjct: 347 GRELGLHRLIEAMKHMFAARMDLGDPEFVNITNAMNQMLSKAHAEEIQKRIFDNTTFPPE 406

Query: 70  YYSDR-SEKKQRGATYFRCI 88
           YY +R S+ + +G ++F CI
Sbjct: 407 YYLNRWSQLRDQGTSHF-CI 425


>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase
           suppressor of ras) (CNK) pleckstrin homology (PH)
           domain.  CNK family members function as protein
           scaffolds, regulating the activity and the subcellular
           localization of RAS activated RAF. There is a single CNK
           protein present in Drosophila and Caenorhabditis elegans
           in contrast to mammals which have 3 CNK proteins (CNK1,
           CNK2, and CNK3). All of the CNK members contain a
           sterile a motif (SAM), a conserved region in CNK (CRIC)
           domain, and a PSD-95/DLG-1/ZO-1 (PDZ) domain, and a PH
           domain. A CNK2 splice variant CNK2A also has a PDZ
           domain-binding motif at its C terminus and Drosophila
           CNK (D-CNK) also has a domain known as the
           Raf-interacting region (RIR) that mediates binding of
           the Drosophila Raf kinase. This cd contains CNKs from
           insects, spiders, mollusks, and nematodes. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 90

 Score = 27.7 bits (62), Expect = 0.82
 Identities = 21/80 (26%), Positives = 31/80 (38%), Gaps = 7/80 (8%)

Query: 53  HWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKS 112
            W KRWFV   +  +L  +  +   K     +   +    V     VKS      F V  
Sbjct: 17  KWAKRWFVLKGS--NLYGFRSQESTKADCVIF---LPGFTVSPAPEVKSRK--YAFKVYH 69

Query: 113 SDRTFHLMAPSAEAMRIWID 132
           +   F+  A S E M+ W+D
Sbjct: 70  TGTVFYFAAESQEDMKKWLD 89


>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology
           (PH) domain.  SH3BP2 (the gene that encodes the adaptor
           protein 3BP2), HD, ITU, IT10C3, and ADD1 are located
           near the Huntington's Disease Gene on Human Chromosome
           4pl6.3. SH3BP2 lies in a region that is often missing in
           individuals with Wolf-Hirschhorn syndrome (WHS). Gain of
           function mutations in SH3BP2 causes enhanced B-cell
           antigen receptor (BCR)-mediated activation of nuclear
           factor of activated T cells (NFAT), resulting in a rare,
           genetic disorder called cherubism. This results in an
           increase in the signaling complex formation with Syk,
           phospholipase C-gamma2 (PLC-gamma2), and Vav1. It was
           recently discovered that Tankyrase regulates 3BP2
           stability through ADP-ribosylation and ubiquitylation by
           the E3-ubiquitin ligase. Cherubism mutations uncouple
           3BP2 from Tankyrase-mediated protein destruction, which
           results in its stabilization and subsequent
           hyperactivation of the Src, Syk, and Vav signaling
           pathways. SH3BP2 is also a potential negative regulator
           of the abl oncogene. PH domains have diverse functions,
           but in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 113

 Score = 28.1 bits (63), Expect = 0.89
 Identities = 26/124 (20%), Positives = 46/124 (37%), Gaps = 23/124 (18%)

Query: 31  SHLTL--DATSCRGYLNKMAGR---FHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYF 85
           + LTL  D T   GYL K  G       W  R+ +  +    + Y+ +    K +G    
Sbjct: 1   NLLTLPRDVTHS-GYLTKKGGSQKQLLKWPLRYVIIHK--GCVYYFKNSQSAKPKGV--- 54

Query: 86  RCIEEVYVDHLNSVKSP--SPHLTFVVK-----SSDRTFHLMAPSAEAMRIWIDVIFSGA 138
                  ++  N   +   +    FV K        RT++  A S + M+ W++ +    
Sbjct: 55  -----FSLNGYNRRAAEETTSKKKFVFKIIHLSKDHRTWYFSAKSEDEMKEWMESLRKEI 109

Query: 139 EGYQ 142
           + Y 
Sbjct: 110 DRYC 113


>gnl|CDD|182781 PRK10854, PRK10854, exopolyphosphatase; Provisional.
          Length = 513

 Score = 28.9 bits (65), Expect = 0.92
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLA-YYSDRSEKKQR 80
           G L +M GRF H + R     RT++SLA +Y+   E+ +R
Sbjct: 300 GVLYEMEGRFRHQDIR----SRTAKSLANHYNIDREQARR 335


>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating
           protein) 1 Pleckstrin homology (PH) domain.  RASA1 (also
           called RasGap1 or p120) is a member of the RasGAP family
           of GTPase-activating proteins. RASA1 contains N-terminal
           SH2-SH3-SH2 domains, followed by two C2 domains, a PH
           domain, a RasGAP domain, and a BTK domain. Splice
           variants lack the N-terminal domains. It is a cytosolic
           vertebrate protein that acts as a suppressor of RAS via
           its C-terminal GAP domain function, enhancing the weak
           intrinsic GTPase activity of RAS proteins resulting in
           the inactive GDP-bound form of RAS, allowing control of
           cellular proliferation and differentiation.
           Additionally, it is involved in mitogenic signal
           transmission towards downstream interacting partners
           through its N-terminal SH2-SH3-SH2 domains. RASA1
           interacts with a number of proteins including: G3BP1,
           SOCS3, ANXA6, Huntingtin, KHDRBS1, Src, EPHB3, EPH
           receptor B2, Insulin-like growth factor 1 receptor,
           PTK2B, DOK1, PDGFRB, HCK, Caveolin 2, DNAJA3, HRAS,
           GNB2L1 and NCK1. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 27.7 bits (62), Expect = 1.1
 Identities = 22/99 (22%), Positives = 40/99 (40%), Gaps = 14/99 (14%)

Query: 41  RGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVK 100
           +GYL K +G+   W   +FV +   + L ++ +    K +G         VY  H     
Sbjct: 6   KGYLLKKSGKNKKWKNLYFVLEGAEQHLYFFENEKRTKPKGLIDLSY-SSVYPVH----- 59

Query: 101 SPS----PHLTFVVKSS---DRTFHLMAPSAEAMRIWID 132
             S    P+   +V  +      ++L A +AE  + W+ 
Sbjct: 60  -DSLFGRPNCFQIVVRALNESTIYYLCADTAELAQDWMK 97


>gnl|CDD|203092 pfam04810, zf-Sec23_Sec24, Sec23/Sec24 zinc finger.  COPII-coated
          vesicles carry proteins from the endoplasmic reticulum
          to the Golgi complex. This vesicular transport can be
          reconstituted by using three cytosolic components
          containing five proteins: the small GTPase Sar1p, the
          Sec23p/24p complex, and the Sec13p/Sec31p complex. This
          domain is found to be zinc binding domain.
          Length = 39

 Score = 26.4 bits (59), Expect = 1.3
 Identities = 8/19 (42%), Positives = 10/19 (52%), Gaps = 1/19 (5%)

Query: 40 CRGYLNKMAGRFHHWNKRW 58
          CR YLN    +F    +RW
Sbjct: 7  CRAYLNPYC-QFDFGGRRW 24


>gnl|CDD|241537 cd13386, PH1_FGD2, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 2 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Not much is known about
           FGD2.  FGD1 is the best characterized member of the
           group with mutations here leading to the X-linked
           disorder known as faciogenital dysplasia (FGDY). PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 27.2 bits (60), Expect = 1.8
 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%)

Query: 104 PHLTFVVKSSDRTFHLMAPSAEAMRIWI 131
           PH +F+V    RT  L A S E M  WI
Sbjct: 64  PH-SFLVSGKQRTLELQARSQEEMIAWI 90


>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain.
          Anillin (Rhotekin/RTKN; also called PLEKHK/Pleckstrin
          homology domain-containing family K) is an actin
          binding protein involved in cytokinesis. It interacts
          with GTP-bound Rho proteins and results in the
          inhibition of their GTPase activity. Dysregulation of
          the Rho signal transduction pathway has been implicated
          in many forms of cancer. Anillin proteins have a
          N-terminal HRI domain/ACC (anti-parallel coiled-coil)
          finger domain or Rho-binding domain binds small GTPases
          from the Rho family. The C-terminal PH domain helps
          target anillin to ectopic septin containing foci. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 119

 Score = 27.3 bits (61), Expect = 1.8
 Identities = 7/25 (28%), Positives = 11/25 (44%), Gaps = 2/25 (8%)

Query: 41 RGYLN--KMAGRFHHWNKRWFVFDR 63
          RG+L   +       W++RW V   
Sbjct: 5  RGFLTVFEDVSGLGAWHRRWCVLRG 29


>gnl|CDD|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related
           protein Pleckstrin homology (PH) domain.  Plant ORPs
           contain a N-terminal PH domain and a C-terminal
           OSBP-related domain. Not much is known about its
           specific function in plants to date. Members here
           include: Arabidopsis, spruce, and petunia. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score = 26.7 bits (59), Expect = 2.3
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 8/78 (10%)

Query: 54  WNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSS 113
           W  RWFV       L+YY      K  G    +   EV++   +  +S S    F + + 
Sbjct: 15  WRSRWFVLQ--DGVLSYY------KVHGPDKVKPSGEVHLKVSSIRESRSDDKKFYIFTG 66

Query: 114 DRTFHLMAPSAEAMRIWI 131
            +T HL A S E    W+
Sbjct: 67  TKTLHLRAESREDRAAWL 84


>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain.  There
           are 2 members of the evectin family (also called
           pleckstrin homology domain containing, family B): evt-1
           (also called PLEKHB1) and evt-2 (also called PLEKHB2).
           evt-1 is specific to the nervous system, where it is
           expressed in photoreceptors and myelinating glia. evt-2
           is widely expressed in both neural and nonneural
           tissues. Evectins possess a single N-terminal PH domain
           and a C-terminal hydrophobic region. evt-1 is thought to
           function as a mediator of post-Golgi trafficking in
           cells that produce large membrane-rich organelles. It is
           a candidate gene for the inherited human retinopathy
           autosomal dominant familial exudative vitreoretinopathy
           and a susceptibility gene for multiple sclerosis. evt-2
           is essential for retrograde endosomal membrane transport
           from the plasma membrane (PM) to the Golgi. Two membrane
           trafficking pathways pass through recycling endosomes: a
           recycling pathway and a retrograde pathway that links
           the PM to the Golgi/ER. Its PH domain that is unique in
           that it specifically recognizes phosphatidylserine (PS),
           but not polyphosphoinositides. PS is an anionic
           phospholipid class in eukaryotic biomembranes, is highly
           enriched in the PM, and plays key roles in various
           physiological processes such as the coagulation cascade,
           recruitment and activation of signaling molecules, and
           clearance of apoptotic cells. PH domains are only found
           in eukaryotes. They share little sequence conservation,
           but all have a common fold, which is electrostatically
           polarized. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 108

 Score = 26.9 bits (60), Expect = 2.5
 Identities = 24/96 (25%), Positives = 36/96 (37%), Gaps = 9/96 (9%)

Query: 42  GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFR--CIE-EVYVDHLNS 98
           G+L + +     W K WFV   +   L+YY D S +   G       C    V ++    
Sbjct: 7   GWLLRQSTILKRWKKNWFVL-YSDGELSYYEDESRRDVEGRINMPIECRNIRVGLEC-RD 64

Query: 99  VKSPSPH----LTFVVKSSDRTFHLMAPSAEAMRIW 130
           V+ P       L  +V    +   L A SA+    W
Sbjct: 65  VQPPEGRSRDCLLQIVTRDGKRLILCAESADDALAW 100


>gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2
          Pleckstrin homology (PH) domain.  Human FAPP1 (also
          called PLEKHA3/Pleckstrin homology domain-containing,
          family A member 3) regulates secretory transport from
          the trans-Golgi network to the plasma membrane. It is
          recruited through binding of PH domain to
          phosphatidylinositol 4-phosphate (PtdIns(4)P) and a
          small GTPase ADP-ribosylation factor 1 (ARF1). These
          two binding sites have little overlap the FAPP1 PH
          domain to associate with both ligands simultaneously
          and independently. FAPP1 has a N-terminal PH domain
          followed by a short proline-rich region. FAPP1 is a
          member of the oxysterol binding protein (OSBP) family
          which includes OSBP, OSBP-related proteins (ORP), and
          Goodpasture antigen binding protein (GPBP). They have a
          wide range of purported functions including sterol
          transport, cell cycle control, pollen development and
          vessicle transport from Golgi recognize both PI lipids
          and ARF proteins. FAPP2 (also called PLEKHA8/Pleckstrin
          homology domain-containing, family A member 8), a
          member of the Glycolipid lipid transfer protein(GLTP)
          family has an N-terminal PH domain that targets the TGN
          and C-terminal GLTP domain. FAPP2 functions to traffic
          glucosylceramide (GlcCer) which is made in the Golgi.
          It's interaction with vesicle-associated membrane
          protein-associated protein (VAP) could be a means of
          regulation. Some FAPP2s share the FFAT-like motifs
          found in GLTP. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 100

 Score = 26.6 bits (59), Expect = 2.5
 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 2/35 (5%)

Query: 42 GYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSE 76
          G L K       W  RWFV D     L+YY  + E
Sbjct: 3  GVLYKWTNYLSGWQPRWFVLDDG--VLSYYKSQEE 35


>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase
          suppressor of ras) (CNK) pleckstrin homology (PH)
          domain.  CNK family members function as protein
          scaffolds, regulating the activity and the subcellular
          localization of RAS activated RAF. There is a single
          CNK protein present in Drosophila and Caenorhabditis
          elegans in contrast to mammals which have 3 CNK
          proteins (CNK1, CNK2, and CNK3). All of the CNK members
          contain a sterile a motif (SAM), a conserved region in
          CNK (CRIC) domain, and a PSD-95/DLG-1/ZO-1 (PDZ)
          domain, and, with the exception of CNK3, a PH domain. A
          CNK2 splice variant CNK2A also has a PDZ domain-binding
          motif at its C terminus and Drosophila CNK (D-CNK) also
          has a domain known as the Raf-interacting region (RIR)
          that mediates binding of the Drosophila Raf kinase.
          This cd contains CNKs from mammals, chickens,
          amphibians, fish, and crustacea. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 114

 Score = 27.0 bits (60), Expect = 2.7
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 6/51 (11%)

Query: 35 LDATSCRGYL--NKMAGRF--HHWNKRWFVFDRTSRSLAYYSDRSEKKQRG 81
          L    C G+L   K A  F    W + WFV   +  SL +Y++  ++K  G
Sbjct: 10 LGRGDCDGWLWKKKEAKGFFGQKWKRYWFVLKGS--SLYWYNNPQDEKAEG 58


>gnl|CDD|241449 cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckstrin homology (PH)
           domain.  EFA6 (also called PSD/pleckstrin and Sec7
           domain containing) is an guanine nucleotide exchange
           factor for ADP ribosylation factor 6 (ARF6), which is
           involved in membrane recycling. EFA6 has four
           structurally related polypeptides: EFA6A, EFA6B, EFA6C
           and EFA6D. It consists of a N-terminal proline rich
           region (PR), a SEC7 domain, a PH domain, a PR, a
           coiled-coil region, and a C-terminal PR. The EFA6 PH
           domain regulates its association with the plasma
           membrane. EFA6 activates Arf6 through its Sec7 catalytic
           domain and modulates this activity through its
           C-terminal domain, which rearranges the actin
           cytoskeleton in fibroblastic cell lines. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 126

 Score = 26.5 bits (59), Expect = 3.4
 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 8/88 (9%)

Query: 54  WNKR-WFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLT----- 107
             KR W +F  T + L  Y  + E   +    +  +      H +S+   +   T     
Sbjct: 27  RGKRGWKMFYATLKGLVLYLHKDEYGCKKQLSYESLRNAISVH-HSLAEKATDYTKKPHV 85

Query: 108 FVVKSSD-RTFHLMAPSAEAMRIWIDVI 134
           F ++++D R F   A   E M+ WI+ I
Sbjct: 86  FRLQTADWREFLFQASDTEEMQSWIEAI 113


>gnl|CDD|241254 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 1 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Mutations in the FGD1 gene
           are responsible for the X-linked disorder known as
           faciogenital dysplasia (FGDY). Both FGD1 and FGD3 are
           targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
           upon phosphorylation of two serine residues in its
           DSGIDS motif and subsequently degraded by the
           proteasome. However, FGD1 and FGD3 induced significantly
           different morphological changes in HeLa Tet-Off cells
           and while FGD1 induced long finger-like protrusions,
           FGD3 induced broad sheet-like protrusions when the level
           of GTP-bound Cdc42 was significantly increased by the
           inducible expression of FGD3. They also reciprocally
           regulated cell motility in inducibly expressed in HeLa
           Tet-Off cells, FGD1 stimulated cell migration while FGD3
           inhibited it. FGD1 and FGD3 therefore play different
           roles to regulate cellular functions, even though their
           intracellular levels are tightly controlled by the same
           destruction pathway through SCF(FWD1/beta-TrCP).  PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 26.1 bits (57), Expect = 4.0
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 93  VDHLNSVKSPSPHL--TFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
           VD +   +S SP+L  TF+V    R+  L A + E  + WI  I
Sbjct: 50  VDGMELKESSSPNLPRTFLVSGKQRSLELQARTEEEKKDWIQAI 93


>gnl|CDD|215372 PLN02689, PLN02689, Bifunctional isoaspartyl
           peptidase/L-asparaginase.
          Length = 318

 Score = 26.6 bits (59), Expect = 4.9
 Identities = 9/14 (64%), Positives = 10/14 (71%)

Query: 37  ATSCRGYLNKMAGR 50
           ATS  G +NKM GR
Sbjct: 203 ATSTGGLVNKMVGR 216


>gnl|CDD|219419 pfam07462, MSP1_C, Merozoite surface protein 1 (MSP1) C-terminus.
           This family represents the C-terminal region of
           merozoite surface protein 1 (MSP1) which are found in a
           number of Plasmodium species. MSP-1 is a 200-kDa protein
           expressed on the surface of the P. vivax merozoite.
           MSP-1 of Plasmodium species is synthesised as a
           high-molecular-weight precursor and then processed into
           several fragments. At the time of red cell invasion by
           the merozoite, only the 19-kDa C-terminal fragment
           (MSP-119), which contains two epidermal growth
           factor-like domains, remains on the surface. Antibodies
           against MSP-119 inhibit merozoite entry into red cells,
           and immunisation with MSP-119 protects monkeys from
           challenging infections. Hence, MSP-119 is considered a
           promising vaccine candidate.
          Length = 574

 Score = 26.8 bits (59), Expect = 4.9
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 76  EKKQRGATYFRCIEEVYVDHLNSVK 100
           E  Q G +Y+  + E+Y D L +VK
Sbjct: 469 ETAQDGISYYNKMIELYKDQLEAVK 493


>gnl|CDD|241279 cd01248, PH_PLC_ELMO1, Phospholipase C and Engulfment and cell
           motility protein 1 pleckstrin homology domain.  The
           C-terminal region of ELMO1, the PH domain and Pro-rich
           sequences, binds the SH3-containing region of DOCK2
           forming a intermolecular five-helix bundle allowing for
           DOCK mediated Rac1 activation. ELMO1, a mammalian
           homolog of C. elegans CED-12, contains an N-terminal
           RhoG-binding region, a ELMO domain, a PH domain, and a
           C-terminal sequence with three PxxP motifs. Specificaly,
           PLCs catalyze the cleavage of
           phosphatidylinositol-4,5-bisphosphate (PIP2) and result
           in the release of 1,2-diacylglycerol (DAG) and inositol
           1,4,5-triphosphate (IP3). These products trigger the
           activation of protein kinase C (PKC) and the release of
           Ca2+ from intracellular stores. There are fourteen kinds
           of mammalian phospholipase C which are are classified
           into six isotypes (beta, gamma, delta, epsilon, zeta,
           eta). All PLCs, except for PLCzeta, have a PH domain
           which is for most part N-terminally located, though
           lipid binding specificity is not conserved between them.
           In addition PLC gamma contains a split PH domain within
           its catalytic domain that is separated by 2 SH2 domains
           and a single SH3 domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 108

 Score = 25.7 bits (57), Expect = 6.0
 Identities = 7/26 (26%), Positives = 16/26 (61%)

Query: 107 TFVVKSSDRTFHLMAPSAEAMRIWID 132
           + +  S ++T  L+APS +   +W++
Sbjct: 77  SIIYGSHNKTLDLVAPSEDEANLWVE 102


>gnl|CDD|241287 cd01256, PH_dynamin, Dynamin pleckstrin homology (PH) domain.
          Dynamin is a GTPase that regulates endocytic vesicle
          formation. It has an N-terminal GTPase domain, followed
          by a PH domain, a GTPase effector domain and a
          C-terminal proline arginine rich domain. Dynamin-like
          proteins, which are found in metazoa, plants and yeast
          have the same domain architecture as dynamin, but lack
          the PH domain. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 112

 Score = 25.7 bits (57), Expect = 6.6
 Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 2/23 (8%)

Query: 58 WFVFDRTSRSLAYYSDRSEKKQR 80
          WFV   T+ SL++Y D  EK+++
Sbjct: 25 WFVL--TAESLSWYKDEEEKEKK 45


>gnl|CDD|241482 cd13328, PH1_FDG_family, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia family proteins
           pleckstrin homology (PH), N-terminal domain.  In
           general, FGDs have a RhoGEF (DH) domain, followed by an
           N-terminal PH domain, a FYVE domain and a C-terminal PH
           domain. All FGDs are guanine nucleotide exchange factors
           that activates the Rho GTPase Cdc42, an important
           regulator of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Mutations in the FGD1 gene
           are responsible for the X-linked disorder known as
           faciogenital dysplasia (FGDY). PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 91

 Score = 25.1 bits (55), Expect = 8.2
 Identities = 19/80 (23%), Positives = 30/80 (37%), Gaps = 10/80 (12%)

Query: 62  DRTSRSLAYYSDR-----SEKKQRGATYFRCIEEVYVDHLN---SVKSPSPHLTFVVKSS 113
               R L  ++D       + +  G  Y      + VD +N         PH TF ++  
Sbjct: 14  TSQERHLFLFNDMLLYCVPKLRLIGQKYGV-RARMDVDGMNVQVVKGDEVPH-TFYIEGK 71

Query: 114 DRTFHLMAPSAEAMRIWIDV 133
            ++  L A +AE    WID 
Sbjct: 72  QKSLELQASTAEEKDAWIDA 91


>gnl|CDD|221786 pfam12814, Mcp5_PH, Meiotic cell cortex C-terminal pleckstrin
           homology.  The PH domain of these largely fungal
           proteins is necessary for the cortical localisation of
           the protein during meiosis, since the overall function
           of the protein is to anchor dynein at the cell cortex
           during the horsetail phase. During prophase I of fission
           yeast, horsetail nuclear movement occurs, and this
           starts when all the telomeres become bundled at the
           spindle pole body - SPB. Subsequent to this, the nucleus
           undergoes a dynamic oscillation, resulting in elongated
           nuclear morphology. Horsetail nuclear movement is
           thought to be predominantly due to the pulling of astral
           microtubules that link the SPB to cortical
           microtubule-attachment sites at the opposite end of the
           cell; the pulling force is believed to be provided by
           cytoplasmic dynein and dynactin.
          Length = 121

 Score = 25.4 bits (56), Expect = 8.6
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 11/83 (13%)

Query: 56  KRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTF------- 108
           KR+F     +R+L Y+S  + K ++ +      + V ++ + SVK  +P           
Sbjct: 32  KRYFWVHPYTRTL-YWSSPNPKSEKVSEGK--SKSVPIESVTSVKDGNPLPKGLKRFNKS 88

Query: 109 -VVKSSDRTFHLMAPSAEAMRIW 130
            V+ + DR     AP+ E   IW
Sbjct: 89  IVIVTPDRAIKFTAPTRERHNIW 111


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.324    0.136    0.433 

Gapped
Lambda     K      H
   0.267   0.0618    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 7,463,811
Number of extensions: 627967
Number of successful extensions: 751
Number of sequences better than 10.0: 1
Number of HSP's gapped: 712
Number of HSP's successfully gapped: 80
Length of query: 146
Length of database: 10,937,602
Length adjustment: 88
Effective length of query: 58
Effective length of database: 7,034,450
Effective search space: 407998100
Effective search space used: 407998100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (24.8 bits)