Query         psy17151
Match_columns 86
No_of_seqs    22 out of 24
Neff          1.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:14:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17151.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17151hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00595 PDZ:  PDZ domain (Also  96.3  0.0054 1.2E-07   36.2   3.0   60   16-76      1-72  (81)
  2 smart00228 PDZ Domain present   89.6     1.3 2.9E-05   24.8   4.7   47   15-63      3-49  (85)
  3 cd00992 PDZ_signaling PDZ doma  74.9      13 0.00028   21.0   5.1   57   17-75      4-72  (82)
  4 cd00136 PDZ PDZ domain, also c  59.1      15 0.00033   20.3   2.9   35   25-63      2-36  (70)
  5 PF09686 Plasmid_RAQPRD:  Plasm  58.3     5.2 0.00011   26.4   0.9   18   61-78     41-58  (81)
  6 PF00011 HSP20:  Hsp20/alpha cr  56.0      23  0.0005   21.4   3.5   26   11-47     77-102 (102)
  7 TIGR01690 ICE_RAQPRD integrati  51.8       7 0.00015   26.8   0.8   19   59-77     52-70  (94)
  8 KOG3551|consensus               44.0      15 0.00033   31.7   1.8   48   15-63     86-134 (506)
  9 KOG3466|consensus               38.7      14  0.0003   27.9   0.7   24   35-58     72-95  (157)
 10 PF08338 DUF1731:  Domain of un  38.4      12 0.00026   22.0   0.3   17   59-75     30-46  (48)
 11 PF13180 PDZ_2:  PDZ domain; PD  37.6      43 0.00093   19.7   2.6   46   26-74      3-57  (82)
 12 cd08023 GH16_laminarinase_like  37.4      21 0.00046   24.7   1.4   13   12-24     44-56  (235)
 13 smart00701 PGRP Animal peptido  35.2      36 0.00079   23.2   2.3   37    4-40     64-110 (142)
 14 PF05689 DUF823:  Salmonella re  35.0      96  0.0021   22.2   4.5   40    8-47      2-46  (184)
 15 COG0071 IbpA Molecular chapero  34.1      37 0.00079   22.7   2.1   14   11-24    122-135 (146)
 16 PLN00162 transport protein sec  30.7      35 0.00075   29.4   1.9   18   34-51    696-713 (761)
 17 COG3167 PilO Tfp pilus assembl  29.9      26 0.00057   27.4   1.0   10   39-48    159-168 (211)
 18 cd02178 GH16_beta_agarase Beta  28.4      43 0.00093   24.2   1.8   14   11-24     63-76  (258)
 19 cd00413 Glyco_hydrolase_16 gly  27.0      57  0.0012   21.7   2.1   18    7-24     32-49  (210)
 20 PRK11597 heat shock chaperone   26.6      97  0.0021   21.7   3.3   27   11-49    111-137 (142)
 21 KOG0986|consensus               26.2      45 0.00097   29.5   1.8   21    5-31    316-336 (591)
 22 PF06687 SUR7:  SUR7/PalI famil  25.6      46   0.001   22.4   1.5   23   48-70     65-87  (212)
 23 KOG3605|consensus               25.0      32  0.0007   31.4   0.8   48   17-64    649-698 (829)
 24 COG5293 Predicted ATPase [Gene  24.8      71  0.0015   28.3   2.8   27    6-32    452-479 (591)
 25 KOG3591|consensus               24.4      96  0.0021   22.4   3.0   33    9-53    136-168 (173)
 26 PRK11267 biopolymer transport   24.0 1.8E+02  0.0039   19.4   4.1   36   38-78     60-95  (141)
 27 smart00644 Ami_2 Ami_2.         23.7 1.7E+02  0.0037   18.2   3.7   33    3-35     33-80  (126)
 28 PF09947 DUF2180:  Uncharacteri  22.9      45 0.00096   21.7   0.9    9   36-44     50-58  (68)
 29 PF02852 Pyr_redox_dim:  Pyridi  22.7      55  0.0012   20.2   1.3   26    7-32     43-69  (110)
 30 KOG1515|consensus               22.5 2.5E+02  0.0054   22.2   5.2   55    5-69     64-118 (336)
 31 PF02753 PapD_C:  Pili assembly  22.4      19 0.00042   20.9  -0.8   15   59-73      6-20  (68)
 32 TIGR02567 YscW type III secret  22.4      30 0.00064   24.5   0.0   41   29-69     23-76  (124)
 33 PRK10772 cell division protein  22.2      21 0.00045   24.7  -0.7   14   31-44      2-15  (108)
 34 KOG4419|consensus               22.1      76  0.0017   28.0   2.4   29   29-57    411-439 (602)
 35 PF00661 Matrix:  Viral matrix   21.1   2E+02  0.0042   23.4   4.4   56   12-67    105-167 (348)
 36 PF10885 DUF2684:  Protein of u  20.9      79  0.0017   22.0   1.9   27    3-29     52-78  (89)
 37 TIGR02803 ExbD_1 TonB system t  20.8 2.4E+02  0.0052   18.1   4.1   37   37-78     45-81  (122)
 38 PF01273 LBP_BPI_CETP:  LBP / B  20.3      87  0.0019   20.2   1.9   30    4-33     97-129 (164)

No 1  
>PF00595 PDZ:  PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available;  InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ]. PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated.  PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....
Probab=96.26  E-value=0.0054  Score=36.20  Aligned_cols=60  Identities=13%  Similarity=0.221  Sum_probs=48.8

Q ss_pred             EEEEec-cCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCcee-----------eehhhhhhhhhhc
Q psy17151         16 RITVKK-SRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYH-----------FTYRELKSDIRSS   76 (86)
Q Consensus        16 ~i~V~K-~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~-----------~~~~~~~~~~~~~   76 (86)
                      +|++.| ...-||+.+.++.....+-..|..|.++|.|...| |++|-.           ++..+...-++++
T Consensus         1 ~v~l~k~~~~~lG~~l~~~~~~~~~~~~V~~v~~~~~a~~~g-l~~GD~Il~INg~~v~~~~~~~~~~~l~~~   72 (81)
T PF00595_consen    1 QVTLEKSGNGPLGFTLRGGSDNDEKGVFVSSVVPGSPAERAG-LKVGDRILEINGQSVRGMSHDEVVQLLKSA   72 (81)
T ss_dssp             EEEEEESTTSBSSEEEEEESTSSSEEEEEEEECTTSHHHHHT-SSTTEEEEEETTEESTTSBHHHHHHHHHHS
T ss_pred             CEEEEeCCCCCcCEEEEecCCCCcCCEEEEEEeCCChHHhcc-cchhhhhheeCCEeCCCCCHHHHHHHHHCC
Confidence            467777 88899999999999887788999999999999999 999875           4555655555554


No 2  
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities.
Probab=89.61  E-value=1.3  Score=24.84  Aligned_cols=47  Identities=11%  Similarity=0.081  Sum_probs=36.8

Q ss_pred             eEEEEeccCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCcee
Q psy17151         15 LRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYH   63 (86)
Q Consensus        15 l~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~   63 (86)
                      ..+++.|....+|+-+..+.+.. +-..|-.|..++.|+.+| |+.|--
T Consensus         3 ~~~~~~~~~~~~G~~~~~~~~~~-~~~~i~~v~~~s~a~~~g-l~~GD~   49 (85)
T smart00228        3 RLVELEKGGGGLGFSLVGGKDEG-GGVVVSSVVPGSPAAKAG-LKVGDV   49 (85)
T ss_pred             EEEEEEECCCcccEEEECCCCCC-CCEEEEEECCCCHHHHcC-CCCCCE
Confidence            35677788789999999876543 347888999999999998 887754


No 3  
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.
Probab=74.94  E-value=13  Score=20.98  Aligned_cols=57  Identities=14%  Similarity=0.158  Sum_probs=39.1

Q ss_pred             EEEecc-CCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCceee-----------ehhhhhhhhhh
Q psy17151         17 ITVKKS-RPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHF-----------TYRELKSDIRS   75 (86)
Q Consensus        17 i~V~K~-~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~~-----------~~~~~~~~~~~   75 (86)
                      +++.+. ..-+|+.+.++... .+-+.|..|..++.|.. ..|+.|...           ++.++..-++.
T Consensus         4 ~~l~~~~~~~~G~~~~~~~~~-~~~~~V~~v~~~s~a~~-~gl~~GD~I~~ing~~i~~~~~~~~~~~l~~   72 (82)
T cd00992           4 VTLRKDPGGGLGFSLRGGKDS-GGGIFVSRVEPGGPAER-GGLRVGDRILEVNGVSVEGLTHEEAVELLKN   72 (82)
T ss_pred             EEEEeCCCCCcCEEEeCcccC-CCCeEEEEECCCChHHh-CCCCCCCEEEEECCEEcCccCHHHHHHHHHh
Confidence            455555 67789999987654 34578889999888888 567776543           45555555544


No 4  
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(pos
Probab=59.06  E-value=15  Score=20.31  Aligned_cols=35  Identities=14%  Similarity=0.193  Sum_probs=25.6

Q ss_pred             ceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCcee
Q psy17151         25 LLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYH   63 (86)
Q Consensus        25 ~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~   63 (86)
                      -+|+.+.++.+   +-..|..+.+++.|+. ..|+.|-.
T Consensus         2 ~~G~~~~~~~~---~~~~V~~v~~~s~a~~-~gl~~GD~   36 (70)
T cd00136           2 GLGFSIRGGTE---GGVVVLSVEPGSPAER-AGLQAGDV   36 (70)
T ss_pred             CccEEEecCCC---CCEEEEEeCCCCHHHH-cCCCCCCE
Confidence            46888887776   4467888889988887 45777643


No 5  
>PF09686 Plasmid_RAQPRD:  Plasmid protein of unknown function (Plasmid_RAQPRD);  InterPro: IPR019110  This entry identifies a family of proteins, around 100 amino acids in length, that include a predicted signal sequence and a perfectly conserved motif, RAQPRD, towards the C terminus. They are found in the Pseudomonas putida TOL plasmid pWW0 and in cryptic plasmid regions of Salmonella enterica subsp. enterica serovar Typhi and Pseudomonas syringae pv. tomato str. DC3000. The function of these proteins is unknown. 
Probab=58.30  E-value=5.2  Score=26.41  Aligned_cols=18  Identities=39%  Similarity=0.737  Sum_probs=15.2

Q ss_pred             ceeeehhhhhhhhhhccc
Q psy17151         61 PYHFTYRELKSDIRSSRA   78 (86)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~   78 (86)
                      -|||.|.-|.+||..-|+
T Consensus        41 R~~FdY~rl~~Dl~~ir~   58 (81)
T PF09686_consen   41 RYYFDYPRLRADLERIRA   58 (81)
T ss_pred             ceeecHHHHHHHHHHHHH
Confidence            799999999999976543


No 6  
>PF00011 HSP20:  Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry.;  InterPro: IPR002068 Prokaryotic and eukaryotic organisms respond to heat shock or other environmental stress by inducing the synthesis of proteins collectively known as heat-shock proteins (hsp) []. Amongst them is a family of proteins with an average molecular weight of 20 Kd, known as the hsp20 proteins []. These seem to act as chaperones that can protect other proteins against heat-induced denaturation and aggregation. Hsp20 proteins seem to form large heterooligomeric aggregates. Structurally, this family is characterised by the presence of a conserved C-terminal domain of about 100 residues.; PDB: 2BOL_B 3N3E_B 2H50_P 2H53_F 2BYU_L 1GME_D 3VQM_J 3VQK_E 3VQL_A 3AAC_A ....
Probab=56.04  E-value=23  Score=21.42  Aligned_cols=26  Identities=31%  Similarity=0.460  Sum_probs=18.8

Q ss_pred             cccceEEEEeccCCceeeEEecCCCCCCCCceEEEEc
Q psy17151         11 VQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIH   47 (86)
Q Consensus        11 ~~Gnl~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq   47 (86)
                      .+|.|.|++.|..+           ...+-|+.|.|+
T Consensus        77 ~~GvL~I~~pk~~~-----------~~~~~~~~I~I~  102 (102)
T PF00011_consen   77 ENGVLTITIPKKEE-----------EEDSQPKRIPIK  102 (102)
T ss_dssp             TTSEEEEEEEBSSS-----------CTTSSSCEE-ET
T ss_pred             cCCEEEEEEEcccc-----------ccCCCCeEEEeC
Confidence            68999999999876           222467777775


No 7  
>TIGR01690 ICE_RAQPRD integrative conjugative element protein, RAQPRD family. This model represents a small family of proteins about 100 amino acids in length, including a predicted signal sequence and a perfectly conserved motif RAQPRD towards the C-terminus. Members are found in the Pseudomonas putida TOL plasmid pWW0 and in cryptic plasmid regions of Salmonella enterica subsp. enterica serovar Typhi and Pseudomonas syringae DC3000. The function is unknown.
Probab=51.83  E-value=7  Score=26.80  Aligned_cols=19  Identities=37%  Similarity=0.812  Sum_probs=15.1

Q ss_pred             CCceeeehhhhhhhhhhcc
Q psy17151         59 PTPYHFTYRELKSDIRSSR   77 (86)
Q Consensus        59 kv~~~~~~~~~~~~~~~~~   77 (86)
                      +.-|||.|.-|..||..-|
T Consensus        52 ~~Ry~FDY~rl~~Dl~~ir   70 (94)
T TIGR01690        52 GDRYHFDYPRLRADLKRIR   70 (94)
T ss_pred             CcCeecCHHHHHHHHHHHH
Confidence            4579999999999986543


No 8  
>KOG3551|consensus
Probab=43.97  E-value=15  Score=31.72  Aligned_cols=48  Identities=27%  Similarity=0.346  Sum_probs=39.2

Q ss_pred             eEEEEec-cCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCcee
Q psy17151         15 LRITVKK-SRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYH   63 (86)
Q Consensus        15 l~i~V~K-~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~   63 (86)
                      =+|+|.| .+.=|||.|-||--.+-|+ -|-+|-+|-+|.+.+-|.++--
T Consensus        86 R~V~V~K~d~gGLGISIKGGreNkMPI-lISKIFkGlAADQt~aL~~gDa  134 (506)
T KOG3551|consen   86 RRVRVVKQDAGGLGISIKGGRENKMPI-LISKIFKGLAADQTGALFLGDA  134 (506)
T ss_pred             ceeEEEEecCCcceEEeecCcccCCce-ehhHhccccccccccceeeccE
Confidence            3566655 5778999999999988876 4668999999999999988753


No 9  
>KOG3466|consensus
Probab=38.72  E-value=14  Score=27.90  Aligned_cols=24  Identities=17%  Similarity=0.080  Sum_probs=20.2

Q ss_pred             CCCCCCceEEEEcCCCceeccCCC
Q psy17151         35 NTKHPLPRIINIHDKLKISSMSQI   58 (86)
Q Consensus        35 NTRqPLPRIitIq~gGsA~~cgqL   58 (86)
                      -+|||-|.|+--..|||+|.---.
T Consensus        72 ~~rHpqP~ifp~spGGssy~R~~~   95 (157)
T KOG3466|consen   72 EWRHPQPYIFPDSPGGSSYEREPC   95 (157)
T ss_pred             hhcCCCccccCCCCCCCccccCCC
Confidence            479999999999999999964433


No 10 
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=38.42  E-value=12  Score=21.96  Aligned_cols=17  Identities=24%  Similarity=0.618  Sum_probs=10.1

Q ss_pred             CCceeeehhhhhhhhhh
Q psy17151         59 PTPYHFTYRELKSDIRS   75 (86)
Q Consensus        59 kv~~~~~~~~~~~~~~~   75 (86)
                      ..||.|.|.+|.+-++.
T Consensus        30 ~~GF~F~~p~l~~AL~~   46 (48)
T PF08338_consen   30 EAGFQFRYPTLEEALRD   46 (48)
T ss_dssp             HTT---S-SSHHHHHHH
T ss_pred             HCCCcccCCCHHHHHhc
Confidence            46899999999887764


No 11 
>PF13180 PDZ_2:  PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C ....
Probab=37.63  E-value=43  Score=19.66  Aligned_cols=46  Identities=7%  Similarity=0.091  Sum_probs=28.4

Q ss_pred             eeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCceee---------ehhhhhhhhh
Q psy17151         26 LGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHF---------TYRELKSDIR   74 (86)
Q Consensus        26 LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~~---------~~~~~~~~~~   74 (86)
                      ||+.++.-.+  ..-..|..+.+++.|+.+| |+.|=-.         +..++...+.
T Consensus         3 lGv~~~~~~~--~~g~~V~~V~~~spA~~aG-l~~GD~I~~ing~~v~~~~~~~~~l~   57 (82)
T PF13180_consen    3 LGVTVQNLSD--TGGVVVVSVIPGSPAAKAG-LQPGDIILAINGKPVNSSEDLVNILS   57 (82)
T ss_dssp             -SEEEEECSC--SSSEEEEEESTTSHHHHTT-S-TTEEEEEETTEESSSHHHHHHHHH
T ss_pred             ECeEEEEccC--CCeEEEEEeCCCCcHHHCC-CCCCcEEEEECCEEcCCHHHHHHHHH
Confidence            4555554333  3356788999999999988 8876443         4555555554


No 12 
>cd08023 GH16_laminarinase_like Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
Probab=37.42  E-value=21  Score=24.71  Aligned_cols=13  Identities=38%  Similarity=0.547  Sum_probs=9.2

Q ss_pred             ccceEEEEeccCC
Q psy17151         12 QGQLRITVKKSRP   24 (86)
Q Consensus        12 ~Gnl~i~V~K~~~   24 (86)
                      .|+|+|++.+...
T Consensus        44 ~G~L~i~~~~~~~   56 (235)
T cd08023          44 DGNLVITARKEPD   56 (235)
T ss_pred             CCEEEEEEEECCC
Confidence            6888888776543


No 13 
>smart00701 PGRP Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme. The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine.
Probab=35.22  E-value=36  Score=23.21  Aligned_cols=37  Identities=19%  Similarity=0.144  Sum_probs=24.5

Q ss_pred             cceeeeccccceEEE----------EeccCCceeeEEecCCCCCCCC
Q psy17151          4 SNVVISEVQGQLRIT----------VKKSRPLLGMAIEGGANTKHPL   40 (86)
Q Consensus         4 ~~~vv~d~~Gnl~i~----------V~K~~~~LGIAIEGGaNTRqPL   40 (86)
                      +-+.+.|.+|++-.-          .--+...+||+++|......|-
T Consensus        64 gYhflI~~dG~IyeGR~~~~~gah~~g~N~~sigI~~iG~~~~~~pt  110 (142)
T smart00701       64 GYNFLVGGDGKVYEGRGWNVVGAHTGGYNDISLGIAFIGNFTDKLPT  110 (142)
T ss_pred             CCeEEEcCCCEEEECCCCCcccccccCCCCCeEEEEEEeCCCCCCCc
Confidence            445556666655321          1235678999999999888774


No 14 
>PF05689 DUF823:  Salmonella repeat of unknown function (DUF823);  InterPro: IPR008541 This family consists of a series of repeated sequences (of around 180 residues) which are found in Salmonella typhimurium, Salmonella typhi and Escherichia coli. These repeats are almost always found with IPR008542 from INTERPRO. The repeats are associated with RatA and RatB, the coding sequences of which are found in the pathogeneicity island of Salmonella. The sequences may be determinants of pathogenicity [, ].
Probab=35.00  E-value=96  Score=22.21  Aligned_cols=40  Identities=18%  Similarity=0.286  Sum_probs=33.2

Q ss_pred             eeccccceEEEEeccCC-----ceeeEEecCCCCCCCCceEEEEc
Q psy17151          8 ISEVQGQLRITVKKSRP-----LLGMAIEGGANTKHPLPRIINIH   47 (86)
Q Consensus         8 v~d~~Gnl~i~V~K~~~-----~LGIAIEGGaNTRqPLPRIitIq   47 (86)
                      +.|.+|.+.++|.....     .|-+...+.+....-|+-|.|+.
T Consensus         2 ~T~~~G~~~~~vtq~~~~G~kT~l~~~~~~~~~~~~~~dvIFTV~   46 (184)
T PF05689_consen    2 VTGADGTATFTVTQPNGPGLKTPLTATLDDDATVTASLDVIFTVI   46 (184)
T ss_pred             ccCCCCcEEEEEEcCCCCCEeeeEEEEeCCCCccceeccEEEEEe
Confidence            46899999999988643     36678889998888899999985


No 15 
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]
Probab=34.14  E-value=37  Score=22.70  Aligned_cols=14  Identities=36%  Similarity=0.641  Sum_probs=12.2

Q ss_pred             cccceEEEEeccCC
Q psy17151         11 VQGQLRITVKKSRP   24 (86)
Q Consensus        11 ~~Gnl~i~V~K~~~   24 (86)
                      .+|.|+|++.|..+
T Consensus       122 ~nGvL~I~lpk~~~  135 (146)
T COG0071         122 KNGLLTVTLPKAEP  135 (146)
T ss_pred             eCcEEEEEEecccc
Confidence            47999999999776


No 16 
>PLN00162 transport protein sec23; Provisional
Probab=30.73  E-value=35  Score=29.41  Aligned_cols=18  Identities=17%  Similarity=0.453  Sum_probs=16.1

Q ss_pred             CCCCCCCceEEEEcCCCc
Q psy17151         34 ANTKHPLPRIINIHDKLK   51 (86)
Q Consensus        34 aNTRqPLPRIitIq~gGs   51 (86)
                      .+.|-|+||+|.-+.|||
T Consensus       696 ~~~Rfp~Pr~i~~~~~~S  713 (761)
T PLN00162        696 IKERFPVPRLVVCDQHGS  713 (761)
T ss_pred             HhcCCCCCeEEEeCCCCc
Confidence            357999999999999997


No 17 
>COG3167 PilO Tfp pilus assembly protein PilO [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=29.93  E-value=26  Score=27.38  Aligned_cols=10  Identities=70%  Similarity=1.288  Sum_probs=8.7

Q ss_pred             CCceEEEEcC
Q psy17151         39 PLPRIINIHD   48 (86)
Q Consensus        39 PLPRIitIq~   48 (86)
                      -||||||.|+
T Consensus       159 sLpRIiTl~d  168 (211)
T COG3167         159 SLPRIITLHD  168 (211)
T ss_pred             hcceeeeeec
Confidence            5999999875


No 18 
>cd02178 GH16_beta_agarase Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant.  This domain adopts a curved  beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
Probab=28.42  E-value=43  Score=24.18  Aligned_cols=14  Identities=14%  Similarity=0.306  Sum_probs=11.1

Q ss_pred             cccceEEEEeccCC
Q psy17151         11 VQGQLRITVKKSRP   24 (86)
Q Consensus        11 ~~Gnl~i~V~K~~~   24 (86)
                      .+|+|+|++.+...
T Consensus        63 ~~G~L~i~a~~~~~   76 (258)
T cd02178          63 EDGNLVLSATRHPG   76 (258)
T ss_pred             ECCEEEEEEEcCCC
Confidence            46999999988753


No 19 
>cd00413 Glyco_hydrolase_16 glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
Probab=26.96  E-value=57  Score=21.68  Aligned_cols=18  Identities=22%  Similarity=0.396  Sum_probs=11.7

Q ss_pred             eeeccccceEEEEeccCC
Q psy17151          7 VISEVQGQLRITVKKSRP   24 (86)
Q Consensus         7 vv~d~~Gnl~i~V~K~~~   24 (86)
                      |..+.+|+|+|++.+...
T Consensus        32 v~~~~~G~L~l~~~~~~~   49 (210)
T cd00413          32 VYVENDGGLTLRTDRDQT   49 (210)
T ss_pred             EEEeCCCeEEEEEEecCC
Confidence            344446888888876543


No 20 
>PRK11597 heat shock chaperone IbpB; Provisional
Probab=26.65  E-value=97  Score=21.69  Aligned_cols=27  Identities=30%  Similarity=0.559  Sum_probs=19.5

Q ss_pred             cccceEEEEeccCCceeeEEecCCCCCCCCceEEEEcCC
Q psy17151         11 VQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDK   49 (86)
Q Consensus        11 ~~Gnl~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~g   49 (86)
                      .+|-|+|++.|..+            .++-||-|.|++.
T Consensus       111 ~nGVL~I~lPK~~~------------~~~~~rkI~I~~~  137 (142)
T PRK11597        111 VNGLLHIDLIRNEP------------EAIAPQRIAISER  137 (142)
T ss_pred             cCCEEEEEEeccCc------------cccCCcEEEECCc
Confidence            47999999999743            2335788888764


No 21 
>KOG0986|consensus
Probab=26.24  E-value=45  Score=29.49  Aligned_cols=21  Identities=33%  Similarity=0.646  Sum_probs=17.8

Q ss_pred             ceeeeccccceEEEEeccCCceeeEEe
Q psy17151          5 NVVISEVQGQLRITVKKSRPLLGMAIE   31 (86)
Q Consensus         5 ~~vv~d~~Gnl~i~V~K~~~~LGIAIE   31 (86)
                      ++|..|..|++||      |-||+|+|
T Consensus       316 eNILLDd~GhvRI------SDLGLAve  336 (591)
T KOG0986|consen  316 ENILLDDHGHVRI------SDLGLAVE  336 (591)
T ss_pred             hheeeccCCCeEe------eccceEEe
Confidence            5788999999998      56899987


No 22 
>PF06687 SUR7:  SUR7/PalI family;  InterPro: IPR009571 This family consists of several fungal-specific SUR7 proteins. Its activity regulates expression of RVS161, a homologue of human endophilin, suggesting a function for both in endocytosis [, ]. The protein carries four transmembrane domains and is thus likely to act as an anchoring protein for the eisosome to the plasma membrane. Eisosomes are the immobile protein complexes, that include the proteins Pil1 and Lsp1, which co-localise with sites of protein and lipid endocytosis at the plasma membrane. SUR7 protein may play a role in sporulation []. Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This family also includes PalI which is part of a pH signal transduction cascade. Based on the similarity of PalI to the yeast Rim9 meiotic signal transduction component it has been suggested that PalI might be a membrane sensor for ambient pH [].
Probab=25.57  E-value=46  Score=22.43  Aligned_cols=23  Identities=30%  Similarity=0.374  Sum_probs=18.2

Q ss_pred             CCCceeccCCCCCceeeehhhhh
Q psy17151         48 DKLKISSMSQIPTPYHFTYRELK   70 (86)
Q Consensus        48 ~gGsA~~cgqLkv~~~~~~~~~~   70 (86)
                      .+...-+|+.-+++|+|.++|.-
T Consensus        65 ~~~~~~~Cs~~~~~y~f~~~~~~   87 (212)
T PF06687_consen   65 NGTNITSCSSPSPGYPFDPREIL   87 (212)
T ss_pred             CCCCCCccCCCCCCCCCCHHHHh
Confidence            44456689999999999999643


No 23 
>KOG3605|consensus
Probab=25.04  E-value=32  Score=31.40  Aligned_cols=48  Identities=19%  Similarity=0.256  Sum_probs=38.8

Q ss_pred             EEEec-cCCceeeEE-ecCCCCCCCCceEEEEcCCCceeccCCCCCceee
Q psy17151         17 ITVKK-SRPLLGMAI-EGGANTKHPLPRIINIHDKLKISSMSQIPTPYHF   64 (86)
Q Consensus        17 i~V~K-~~~~LGIAI-EGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~~   64 (86)
                      |-|.| .--+||++| |-|-+.--|-=-|.|.-.+|.|--||||..|-..
T Consensus       649 Vvv~K~kGEiLGVViVESGWGSmLPTVViAnmm~~GpAarsgkLnIGDQi  698 (829)
T KOG3605|consen  649 VVLEKHKGEILGVVIVESGWGSILPTVVIANMMHGGPAARSGKLNIGDQI  698 (829)
T ss_pred             eeeecccCceeeEEEEecCccccchHHHHHhcccCChhhhcCCcccccee
Confidence            44444 346899985 8899988887789999999999999999988654


No 24 
>COG5293 Predicted ATPase [General function prediction only]
Probab=24.83  E-value=71  Score=28.27  Aligned_cols=27  Identities=26%  Similarity=0.391  Sum_probs=23.4

Q ss_pred             eeeeccccceEEEEeccC-CceeeEEec
Q psy17151          6 VVISEVQGQLRITVKKSR-PLLGMAIEG   32 (86)
Q Consensus         6 ~vv~d~~Gnl~i~V~K~~-~~LGIAIEG   32 (86)
                      +++-|..|.|+|++-|++ .+.|+-|.-
T Consensus       452 r~~yd~~G~L~~~~~kng~~tfg~eI~~  479 (591)
T COG5293         452 REVYDCYGSLRVTTNKNGHLTFGAEITD  479 (591)
T ss_pred             HHHhcCCCeEEEEecCCCceeeeeeeec
Confidence            567899999999999999 899977755


No 25 
>KOG3591|consensus
Probab=24.44  E-value=96  Score=22.38  Aligned_cols=33  Identities=24%  Similarity=0.178  Sum_probs=25.6

Q ss_pred             eccccceEEEEeccCCceeeEEecCCCCCCCCceEEEEcCCCcee
Q psy17151          9 SEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKIS   53 (86)
Q Consensus         9 ~d~~Gnl~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~   53 (86)
                      .+.+|-|.|.+.|.++.+-            -.|+|.|+..|..+
T Consensus       136 LS~dGvLtI~ap~~~~~~~------------~er~ipI~~~~~~~  168 (173)
T KOG3591|consen  136 LSSDGVLTIEAPKPPPKQD------------NERSIPIEQVGPSA  168 (173)
T ss_pred             eCCCceEEEEccCCCCcCc------------cceEEeEeecCccc
Confidence            5689999999999887543            46888888777654


No 26 
>PRK11267 biopolymer transport protein ExbD; Provisional
Probab=24.01  E-value=1.8e+02  Score=19.43  Aligned_cols=36  Identities=6%  Similarity=0.028  Sum_probs=26.8

Q ss_pred             CCCceEEEEcCCCceeccCCCCCceeeehhhhhhhhhhccc
Q psy17151         38 HPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSDIRSSRA   78 (86)
Q Consensus        38 qPLPRIitIq~gGsA~~cgqLkv~~~~~~~~~~~~~~~~~~   78 (86)
                      .+-|.+|+|..+|..|.-++.     ++..+|++.++..++
T Consensus        60 ~~~~~~i~I~~~g~i~~~~~~-----v~~~~L~~~L~~~~~   95 (141)
T PRK11267         60 PEKPVYLSVKADNSMFIGNDP-----VTDETMITALDALTE   95 (141)
T ss_pred             CCCCEEEEEeCCCCEEECCcc-----ccHHHHHHHHHHHHh
Confidence            345779999999999886653     466888888876544


No 27 
>smart00644 Ami_2 Ami_2.
Probab=23.70  E-value=1.7e+02  Score=18.16  Aligned_cols=33  Identities=12%  Similarity=0.158  Sum_probs=21.4

Q ss_pred             ccceeeeccccceEEEEec---------------cCCceeeEEecCCC
Q psy17151          3 LSNVVISEVQGQLRITVKK---------------SRPLLGMAIEGGAN   35 (86)
Q Consensus         3 ~~~~vv~d~~Gnl~i~V~K---------------~~~~LGIAIEGGaN   35 (86)
                      .+++.+.|.+|.+---+..               +...+||+++|...
T Consensus        33 ~~~H~~I~~dG~i~~~~~~~~~awh~~~~~~~~~N~~sigIe~~g~~~   80 (126)
T smart00644       33 IGYHFLVGGDGRVYQGVGWNYVAWHAGGAHTPGYNDISIGIEFIGSFD   80 (126)
T ss_pred             eeeEEEEcCCCEEEEccCCcccccccccccccCCCCCEEEEEEEeCCc
Confidence            4666777777766555433               34578888887654


No 28 
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=22.91  E-value=45  Score=21.74  Aligned_cols=9  Identities=67%  Similarity=1.228  Sum_probs=7.8

Q ss_pred             CCCCCceEE
Q psy17151         36 TKHPLPRII   44 (86)
Q Consensus        36 TRqPLPRIi   44 (86)
                      +++|||||.
T Consensus        50 ~~~~l~Ril   58 (68)
T PF09947_consen   50 LKKPLPRIL   58 (68)
T ss_pred             ccCCCCeee
Confidence            589999996


No 29 
>PF02852 Pyr_redox_dim:  Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain;  InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ].; GO: 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0045454 cell redox homeostasis, 0055114 oxidation-reduction process, 0005737 cytoplasm; PDB: 3II4_B 2A8X_A 2BC0_B 2BC1_B 2W0H_A 2X50_B 2JK6_A 2YAU_A 2EQ9_E 2EQ6_B ....
Probab=22.70  E-value=55  Score=20.23  Aligned_cols=26  Identities=27%  Similarity=0.503  Sum_probs=21.7

Q ss_pred             eeeccccceEEEEec-cCCceeeEEec
Q psy17151          7 VISEVQGQLRITVKK-SRPLLGMAIEG   32 (86)
Q Consensus         7 vv~d~~Gnl~i~V~K-~~~~LGIAIEG   32 (86)
                      ...+.+|.+.+.+.| +..+||..+-|
T Consensus        43 ~~~~~~g~~Kli~d~~t~~IlGa~~vg   69 (110)
T PF02852_consen   43 YYPETEGFVKLIFDKKTGRILGAQIVG   69 (110)
T ss_dssp             HTTTTEEEEEEEEETTTTBEEEEEEEE
T ss_pred             ccCCcceeeEEEEEeeccceeeeeeec
Confidence            445678999998887 88999999988


No 30 
>KOG1515|consensus
Probab=22.47  E-value=2.5e+02  Score=22.19  Aligned_cols=55  Identities=15%  Similarity=0.180  Sum_probs=37.5

Q ss_pred             ceeeeccccceEEEEeccCCceeeEEecCCCCCCCCceEEEEcCCCceeccCCCCCceeeehhhh
Q psy17151          5 NVVISEVQGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSMSQIPTPYHFTYREL   69 (86)
Q Consensus         5 ~~vv~d~~Gnl~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~cgqLkv~~~~~~~~~   69 (86)
                      -.|..+..+++.+|+-.-.+.         ...+.+|-||-+|.||-+......+ .||.--+.+
T Consensus        64 ~dv~~~~~~~l~vRly~P~~~---------~~~~~~p~lvyfHGGGf~~~S~~~~-~y~~~~~~~  118 (336)
T KOG1515|consen   64 KDVTIDPFTNLPVRLYRPTSS---------SSETKLPVLVYFHGGGFCLGSANSP-AYDSFCTRL  118 (336)
T ss_pred             eeeEecCCCCeEEEEEcCCCC---------CcccCceEEEEEeCCccEeCCCCCc-hhHHHHHHH
Confidence            456778888888887655441         1117899999999999887665544 355544444


No 31 
>PF02753 PapD_C:  Pili assembly chaperone PapD, C-terminal domain;  InterPro: IPR016148 Most Gram-negative bacteria possess a supramolecular structure - the pili - on their surface, which mediates attachment to specific receptors. Many interactive subunits are required to assemble pili, but their assembly only takes place after translocation across the cytoplasmic membrane. Periplasmic chaperones assist pili assembly by binding to the subunits, thereby preventing premature aggregation [, ]. Pili chaperones are structurally, and possibly evolutionarily, related to the immunoglobulin superfamily [, ]: they contain two globular domains, with a topology identical to an immunoglobulin fold. This entry represents the C-terminal domain of pili assembly chaperone, and has a beta-sandwich fold consisting of eight strands in two sheets with a Greek key topology.; GO: 0007047 cellular cell wall organization, 0030288 outer membrane-bounded periplasmic space; PDB: 2UY7_C 2UY6_A 2W07_A 3GFU_A 3F65_F 3F6L_A 3F6I_A 3GEW_B 1PDK_A 2XG4_A ....
Probab=22.43  E-value=19  Score=20.86  Aligned_cols=15  Identities=47%  Similarity=0.638  Sum_probs=10.6

Q ss_pred             CCceeeehhhhhhhh
Q psy17151         59 PTPYHFTYRELKSDI   73 (86)
Q Consensus        59 kv~~~~~~~~~~~~~   73 (86)
                      ++|||+|+.+++-+-
T Consensus         6 pTPy~vtl~~~~~~~   20 (68)
T PF02753_consen    6 PTPYYVTLSSLKLNG   20 (68)
T ss_dssp             -SSS-EEEEEEEETH
T ss_pred             CCCcEEEEEeeeecc
Confidence            579999999887663


No 32 
>TIGR02567 YscW type III secretion system chaperone YscW. This family of proteins is found within type III secretion operons. The protein has been characterized as a chaperone for the outer membrane pore component YscC (TIGR02516). YscW is a lipoprotein which is itself localized to the outer membrane and, it is believed, facilitates the oligomerization and localization of YscC.
Probab=22.37  E-value=30  Score=24.48  Aligned_cols=41  Identities=22%  Similarity=0.271  Sum_probs=26.4

Q ss_pred             EEecCCCCCCCCceEEEEc------CCC-------ceeccCCCCCceeeehhhh
Q psy17151         29 AIEGGANTKHPLPRIINIH------DKL-------KISSMSQIPTPYHFTYREL   69 (86)
Q Consensus        29 AIEGGaNTRqPLPRIitIq------~gG-------sA~~cgqLkv~~~~~~~~~   69 (86)
                      -|.|=+.-+-+||+..+|.      -+|       ..|+-.+|+++|+|+.-.+
T Consensus        23 ~i~G~V~~~~~LP~~a~i~V~i~~V~d~~~l~vA~~~y~~~~lPv~FsF~l~~~   76 (124)
T TIGR02567        23 NVYGWVSMEYHLPRSAYIEVSMCQVVEGKVLTVAEQHYRGVQLPVQYSFLLNPI   76 (124)
T ss_pred             EEEEEEEEEEcCCCCCEEEEEEEEecCCceEEEEEeecccccccccEEEEcCHH
Confidence            3455555556777654432      122       3588899999999987653


No 33 
>PRK10772 cell division protein FtsL; Provisional
Probab=22.19  E-value=21  Score=24.66  Aligned_cols=14  Identities=50%  Similarity=0.999  Sum_probs=12.0

Q ss_pred             ecCCCCCCCCceEE
Q psy17151         31 EGGANTKHPLPRII   44 (86)
Q Consensus        31 EGGaNTRqPLPRIi   44 (86)
                      -||.++|.||++||
T Consensus         2 ~~~~~~~~~L~~iI   15 (108)
T PRK10772          2 IGGSNERHALPGVI   15 (108)
T ss_pred             CCCCCCCCChHHHH
Confidence            48899999999886


No 34 
>KOG4419|consensus
Probab=22.09  E-value=76  Score=27.99  Aligned_cols=29  Identities=17%  Similarity=0.225  Sum_probs=22.5

Q ss_pred             EEecCCCCCCCCceEEEEcCCCceeccCC
Q psy17151         29 AIEGGANTKHPLPRIINIHDKLKISSMSQ   57 (86)
Q Consensus        29 AIEGGaNTRqPLPRIitIq~gGsA~~cgq   57 (86)
                      +.-=+..-|.|+|+||.+..||..|..=.
T Consensus       411 p~l~~~~~R~pip~~i~~n~G~Iry~~l~  439 (602)
T KOG4419|consen  411 PLLNVGGNRSPIPHIIISNNGGIRYSLLE  439 (602)
T ss_pred             ceeccCCCCCCcceeEEecCCcccchhhc
Confidence            34445567999999999999999997533


No 35 
>PF00661 Matrix:  Viral matrix protein;  InterPro: IPR000982 The matrix protein plays a crucial role in virus assembly, and interacts with the RNP complex as well as with the viral membrane. It is found in Morbillivirus, Paramyxovirus, Pneumovirus.; GO: 0005198 structural molecule activity, 0019068 virion assembly
Probab=21.06  E-value=2e+02  Score=23.35  Aligned_cols=56  Identities=20%  Similarity=0.161  Sum_probs=37.8

Q ss_pred             ccceEEEEeccCCceeeEEecCCCCCCCCceEEEEcCCCceecc-------CCCCCceeeehh
Q psy17151         12 QGQLRITVKKSRPLLGMAIEGGANTKHPLPRIINIHDKLKISSM-------SQIPTPYHFTYR   67 (86)
Q Consensus        12 ~Gnl~i~V~K~~~~LGIAIEGGaNTRqPLPRIitIq~gGsA~~c-------gqLkv~~~~~~~   67 (86)
                      =-.|.|+|+|+|..==-.+-+=.+.-+.|-.--.+..+|+.+++       +.+..+-++.||
T Consensus       105 ~~~l~I~VRkTA~~~EkiVf~~~~~p~~L~~~~~v~~~g~i~~A~k~vkap~ki~~~~~y~fr  167 (348)
T PF00661_consen  105 CTELDITVRKTAGSKEKIVFSINTPPPLLTPWKKVLNGGSIFSAEKVVKAPEKIPAGVPYRFR  167 (348)
T ss_pred             HhcceEEEEecCCCceEEEEEccCCCccccceeeeccCceEEchhhhccCccccCCCCceEEE
Confidence            34689999999986555555555555555556677888888876       345555555554


No 36 
>PF10885 DUF2684:  Protein of unknown function (DUF2684);  InterPro: IPR020263 This entry contains proteins with no known function.
Probab=20.86  E-value=79  Score=22.02  Aligned_cols=27  Identities=22%  Similarity=0.347  Sum_probs=23.1

Q ss_pred             ccceeeeccccceEEEEeccCCceeeE
Q psy17151          3 LSNVVISEVQGQLRITVKKSRPLLGMA   29 (86)
Q Consensus         3 ~~~~vv~d~~Gnl~i~V~K~~~~LGIA   29 (86)
                      -...+++|.-|+++|-+.--.+.|||-
T Consensus        52 t~leIFpDna~~~rIy~L~Fs~~~GiK   78 (89)
T PF10885_consen   52 TWLEIFPDNAGIVRIYLLHFSPVLGIK   78 (89)
T ss_pred             ceeEeccCCCCcEEEEEEEEeeeeccc
Confidence            345688999999999999999999873


No 37 
>TIGR02803 ExbD_1 TonB system transport protein ExbD, group 1. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=20.80  E-value=2.4e+02  Score=18.13  Aligned_cols=37  Identities=8%  Similarity=0.139  Sum_probs=26.7

Q ss_pred             CCCCceEEEEcCCCceeccCCCCCceeeehhhhhhhhhhccc
Q psy17151         37 KHPLPRIINIHDKLKISSMSQIPTPYHFTYRELKSDIRSSRA   78 (86)
Q Consensus        37 RqPLPRIitIq~gGsA~~cgqLkv~~~~~~~~~~~~~~~~~~   78 (86)
                      ..+.|.+++|..+|..|.-++.     .+..+|...++...+
T Consensus        45 ~~~~~~~i~I~~~g~~~~~~~~-----v~~~~L~~~l~~~~~   81 (122)
T TIGR02803        45 RPEKPVYVSVKADLSLFVGNDP-----VARETLGTALDALTE   81 (122)
T ss_pred             CCCCCEEEEEeCCCCEEECCcc-----CCHHHHHHHHHHHHh
Confidence            4457889999999998886643     456788877765443


No 38 
>PF01273 LBP_BPI_CETP:  LBP / BPI / CETP family, N-terminal domain;  InterPro: IPR017942 This entry represents the N-terminal domain found in several lipid-binding serum glycoproteins. The N- and C-terminal domains share a similar two-layer alpha/beta structure, but they show little sequence identity. Proteins containing this N-terminal domain include:   Bactericidal permeability-increasing protein (BPI) Lipopolysaccharide-binding protein (LBP) Cholesteryl ester transfer protein (CETP) Phospholipid transfer protein (PLTP) Palate, lung and nasal epithelium carcinoma-associated protein (PLUNC)    Bactericidal permeability-increasing protein (BPI) is a potent antimicrobial protein of 456 residues that binds to and neutralises lipopolysaccharides from the outer membrane of Gram-negative bacteria []. BPI contains two domains that adopt the same structural fold, even though they have little sequence similarity [].   Lipopolysaccharide-binding protein (LBP) is an endotoxin-binding protein that is closely related to, and functions in a co-ordinated manner with BPI to facilitate an integrated host response to invading Gram-negative bacteria []. Cholesteryl ester transfer protein (CETP) is a glycoprotein that facilitates the transfer of lipids (cholesteryl esters and triglycerides) between the different lipoproteins that transport them through plasma, including HDL, LDL, VLDL and chylomicrons. These lipoproteins shield the lipids from water by encapsulating them within a coating of polar lipids and proteins [].  Phospholipid transfer protein (PLTP) exchanges phospholipids between lipoproteins and remodels high-density lipoproteins (HDLs) []. Palate, lung and nasal epithelium carcinoma-associated protein (PLUNC) is a potential host defensive protein that is secreted from the submucosal gland to the saliva and nasal lavage fluid. PLUNC appears to be a secreted product of neutrophil granules that participates in an aspect of the inflammatory response that contributes to host defence []. Short palate, lung and nasal epithelium clone 1 (SPLUNC1) may bind the lipopolysaccharide of Gram-negative nanobacteria, thereby playing an important role in the host defence of nasopharyngeal epithelium [].; GO: 0008289 lipid binding; PDB: 1EWF_A 1BP1_A 2OBD_A.
Probab=20.28  E-value=87  Score=20.21  Aligned_cols=30  Identities=17%  Similarity=0.356  Sum_probs=21.7

Q ss_pred             cceeeeccccceEEEEeccCCcee---eEEecC
Q psy17151          4 SNVVISEVQGQLRITVKKSRPLLG---MAIEGG   33 (86)
Q Consensus         4 ~~~vv~d~~Gnl~i~V~K~~~~LG---IAIEGG   33 (86)
                      ...+-.|.+|..++.+..|...+|   |-+.||
T Consensus        97 ~i~l~~~~~G~~~v~~~~C~~~i~~v~i~~~gg  129 (164)
T PF01273_consen   97 TIRLERDESGRPTVVVGSCSSDIGSVDIKLHGG  129 (164)
T ss_dssp             EEEEEEECCTEEEEEEEEEEEEEEEEEEEETTC
T ss_pred             EEEEEEcCCCCeEEEECCCccCcceEEEEECCC
Confidence            345667888999999999887744   555555


Done!