Diaphorina citri psyllid: psy17155


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MYVHNVKLNIEVYKNNRSIPENILSTITSAVLNALHYLHSKLQVIHRDVKPSNILINRAGDVKMCDFGISGYLVDSVAKTIDAGCKPYMADQSCEVMIT
cEEccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccEEECccccccHHHHHHHHcccccccccccccccccccc
MY*HNVKLNIEVYKNNRSIPENILSTITSAVLNALHYLHSKLQVIHRDVKPSNILINRAGDVKMCDFGISGYLVDSVAKTIDAGCKPYMADQSCEV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYVHNVKLNIEVYKNNRSIPENILSTITSAVLNALHYLHSKLQVIHRDVKPSNILINRAGDVKMCDFGISGYLVDSVAKTIDAGCKPYMADQSCEVMIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity mitogen-activated protein kinase kinase 6 Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Phosphorylation by MAP2K6 asymmetrically activates p38 on one side of the blastodisc, an event which is necessary for blastomere cleavage.confidentQ9DGE0
Dual specificity mitogen-activated protein kinase kinase 6 Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.confidentQ5E9X2
Dual specificity mitogen-activated protein kinase kinase 3 (Fragment) Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases.confidentP39746

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048609 [BP]multicellular organismal reproductive processprobableGO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0071214 [BP]cellular response to abiotic stimulusprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005934 [CC]cellular bud tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0050679 [BP]positive regulation of epithelial cell proliferationprobableGO:0008284, GO:0042127, GO:0050678, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0034142 [BP]toll-like receptor 4 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0033267 [CC]axon partprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0045927 [BP]positive regulation of growthprobableGO:0048518, GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0008545 [MF]JUN kinase kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0004712, GO:0004672, GO:0003674, GO:0004708
GO:0007257 [BP]activation of JUN kinase activityprobableGO:0000187, GO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0051247, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0007165, GO:0046328, GO:0043506, GO:0071902, GO:0035556, GO:0071900, GO:0010627, GO:0010647, GO:0043085, GO:0043408, GO:0007254, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0000165, GO:0031098, GO:0050789, GO:0023051, GO:0060255, GO:0032268, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0042325, GO:0050790, GO:0045937, GO:0044700, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0051716, GO:0050794, GO:0032872, GO:0006950, GO:0051403, GO:0044763, GO:0023052, GO:0007154, GO:0043507, GO:0043410, GO:0042327, GO:0001932, GO:0007243, GO:0050896, GO:0031401, GO:0051338, GO:0080134, GO:0033554, GO:0008150, GO:0009987, GO:0045860, GO:0001934, GO:0048522
GO:0071363 [BP]cellular response to growth factor stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0034134 [BP]toll-like receptor 2 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034130 [BP]toll-like receptor 1 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034138 [BP]toll-like receptor 3 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0035666 [BP]TRIF-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002756, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0051090 [BP]regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0042035 [BP]regulation of cytokine biosynthetic processprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051246, GO:0050794, GO:0001817, GO:0010556, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043525 [BP]positive regulation of neuron apoptotic processprobableGO:0050789, GO:0050794, GO:0043065, GO:0010942, GO:0043067, GO:0043523, GO:0065007, GO:0048518, GO:1901216, GO:0008150, GO:1901214, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0031435 [MF]mitogen-activated protein kinase kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0003002 [BP]regionalizationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0043539 [MF]protein serine/threonine kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047, GO:0030295
GO:0002755 [BP]MyD88-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0032839 [CC]dendrite cytoplasmprobableGO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0008063 [BP]Toll signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:2000145 [BP]regulation of cell motilityprobableGO:0040012, GO:0050794, GO:0051270, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0036289 [BP]peptidyl-serine autophosphorylationprobableGO:0044267, GO:0006468, GO:0018105, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0018193, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0006464, GO:0008152, GO:0006793, GO:0044237, GO:0046777

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EQC, chain A
Confidence level:very confident
Coverage over the Query: 2-96
View the alignment between query and template
View the model in PyMOL