Query         psy17175
Match_columns 285
No_of_seqs    203 out of 244
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:48:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17175.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17175hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00075 RNase_H:  RNase H;  In  97.1 0.00018   4E-09   57.9   1.2   25  117-142   101-126 (132)
  2 PRK08719 ribonuclease H; Revie  97.0 0.00028 6.1E-09   60.5   1.7   23  119-142   118-140 (147)
  3 PRK00203 rnhA ribonuclease H;   96.8  0.0006 1.3E-08   57.9   1.6   23  119-142   113-135 (150)
  4 PRK06548 ribonuclease H; Provi  96.6 0.00085 1.8E-08   58.7   1.4   23  119-142   113-135 (161)
  5 COG0328 RnhA Ribonuclease HI [  95.6  0.0052 1.1E-07   53.7   1.4   28  114-142   110-138 (154)
  6 cd06222 RnaseH RNase H (RNase   95.0   0.015 3.3E-07   44.2   2.1   25  117-142   101-125 (130)
  7 KOG3752|consensus               92.2   0.076 1.6E-06   52.3   1.8   25  117-142   334-358 (371)
  8 PF13966 zf-RVT:  zinc-binding   88.2    0.31 6.7E-06   37.5   1.8   26  225-250    55-83  (86)
  9 PF13966 zf-RVT:  zinc-binding   34.6      20 0.00044   27.3   1.1   41   71-121    40-85  (86)
 10 KOG0466|consensus               27.3      48   0.001   33.1   2.5   15  117-131   120-136 (466)
 11 PRK13907 rnhA ribonuclease H;   23.1      46   0.001   26.8   1.3   21  117-142   100-120 (128)
 12 PF03563 Bunya_G2:  Bunyavirus   22.6      53  0.0012   31.6   1.8   20   11-30     66-85  (285)
 13 COG2888 Predicted Zn-ribbon RN  20.6      59  0.0013   24.6   1.3   26  225-250     5-34  (61)

No 1  
>PF00075 RNase_H:  RNase H;  InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site. This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids.  The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D ....
Probab=97.11  E-value=0.00018  Score=57.89  Aligned_cols=25  Identities=24%  Similarity=0.294  Sum_probs=21.4

Q ss_pred             cccccceeeeecCCCCc-CcchhHHhh
Q psy17175        117 AALSVRHILFCHQHDNA-AGVESLFLL  142 (285)
Q Consensus       117 ~~~~vr~~~WIPGH~gI-pGNE~AD~~  142 (285)
                      ....|+ |.|||||+|+ .|||.||++
T Consensus       101 ~~~~v~-~~~V~~H~~~~~~N~~aD~l  126 (132)
T PF00075_consen  101 RGIKVR-FRWVPGHSGVPQGNERADRL  126 (132)
T ss_dssp             HSSEEE-EEESSSSSSSHHHHHHHHHH
T ss_pred             cceEEe-eeeccCcCCCchhHHHHHHH
Confidence            355675 9999999999 599999987


No 2  
>PRK08719 ribonuclease H; Reviewed
Probab=97.04  E-value=0.00028  Score=60.47  Aligned_cols=23  Identities=22%  Similarity=0.184  Sum_probs=20.7

Q ss_pred             cccceeeeecCCCCcCcchhHHhh
Q psy17175        119 LSVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       119 ~~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      ..|+ |.|||||+|++|||.||++
T Consensus       118 ~~i~-~~~VkgH~g~~~Ne~aD~l  140 (147)
T PRK08719        118 KYVE-VEKVTAHSGIEGNEAADML  140 (147)
T ss_pred             CcEE-EEEecCCCCChhHHHHHHH
Confidence            4575 9999999999999999987


No 3  
>PRK00203 rnhA ribonuclease H; Reviewed
Probab=96.78  E-value=0.0006  Score=57.88  Aligned_cols=23  Identities=13%  Similarity=0.042  Sum_probs=20.6

Q ss_pred             cccceeeeecCCCCcCcchhHHhh
Q psy17175        119 LSVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       119 ~~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      ..| ++.|||||+|++|||.||++
T Consensus       113 ~~v-~~~wV~~H~~~~~N~~AD~l  135 (150)
T PRK00203        113 HQI-KWHWVKGHAGHPENERCDEL  135 (150)
T ss_pred             Cce-EEEEecCCCCCHHHHHHHHH
Confidence            456 49999999999999999987


No 4  
>PRK06548 ribonuclease H; Provisional
Probab=96.61  E-value=0.00085  Score=58.73  Aligned_cols=23  Identities=17%  Similarity=0.171  Sum_probs=20.8

Q ss_pred             cccceeeeecCCCCcCcchhHHhh
Q psy17175        119 LSVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       119 ~~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      ..|+ |.||+||+|++|||.||++
T Consensus       113 ~~v~-~~wVkgHsg~~gNe~aD~L  135 (161)
T PRK06548        113 RNIR-MSWVNAHTGHPLNEAADSL  135 (161)
T ss_pred             CceE-EEEEecCCCCHHHHHHHHH
Confidence            3576 9999999999999999987


No 5  
>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair]
Probab=95.64  E-value=0.0052  Score=53.73  Aligned_cols=28  Identities=14%  Similarity=-0.052  Sum_probs=22.8

Q ss_pred             cccccc-ccceeeeecCCCCcCcchhHHhh
Q psy17175        114 QCGAAL-SVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       114 ~c~~~~-~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      ++-+.. .| .+.|||||.|.++||.||++
T Consensus       110 ~~~~~~~~v-~~~WVkgH~g~~~NeraD~L  138 (154)
T COG0328         110 ELLKRHELV-FWEWVKGHAGHPENERADQL  138 (154)
T ss_pred             HHHhhCCeE-EEEEeeCCCCChHHHHHHHH
Confidence            444555 44 59999999999999999987


No 6  
>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication.  RNase H knockout mice lack mitochondrial DNA replication and die as embryos. The retroviral reverse transcriptase contains an RNase H domain that plays an important role in converting a single stranded retroviral genomic RNA into a dsDNA for integration into host chromosomes. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription.
Probab=95.01  E-value=0.015  Score=44.18  Aligned_cols=25  Identities=24%  Similarity=0.190  Sum_probs=21.4

Q ss_pred             cccccceeeeecCCCCcCcchhHHhh
Q psy17175        117 AALSVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       117 ~~~~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      ....++ +.|||+|+++.+|+.||.+
T Consensus       101 ~~~~~~-i~~v~~h~~~~~n~~ad~l  125 (130)
T cd06222         101 RFHKVR-FEWVPGHSGIEGNERADAL  125 (130)
T ss_pred             CCCeEE-EEEcCCCCCCcchHHHHHH
Confidence            345565 9999999999999999987


No 7  
>KOG3752|consensus
Probab=92.21  E-value=0.076  Score=52.32  Aligned_cols=25  Identities=20%  Similarity=0.139  Sum_probs=21.7

Q ss_pred             cccccceeeeecCCCCcCcchhHHhh
Q psy17175        117 AALSVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       117 ~~~~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      ...+|+ +.|||||.||.|||+||.+
T Consensus       334 ~~~~vq-~~~V~Gh~gi~gne~Ad~l  358 (371)
T KOG3752|consen  334 SNKKVQ-QEYVGGHSGILGNEMADAL  358 (371)
T ss_pred             ccCceE-EEEecCcCCcchHHHHHHH
Confidence            456674 9999999999999999986


No 8  
>PF13966 zf-RVT:  zinc-binding in reverse transcriptase
Probab=88.16  E-value=0.31  Score=37.55  Aligned_cols=26  Identities=27%  Similarity=0.698  Sum_probs=21.6

Q ss_pred             CCCCCCCc-cCCC-ccccceeec-cccch
Q psy17175        225 TKIDPPLC-QCGA-ALSVRHILF-CHQHV  250 (285)
Q Consensus       225 ~~~~~P~C-~CG~-~~Tv~HIl~-Cp~y~  250 (285)
                      +-..++.| .||. .||+.|+|. ||...
T Consensus        55 ~~~~~~~C~~C~~~~Et~~Hlf~~C~~a~   83 (86)
T PF13966_consen   55 GIQVDPICPLCGNEEETIEHLFFHCPFAR   83 (86)
T ss_pred             CCccCCccccCCCccccccceeccCcCcc
Confidence            33577999 9996 899999999 99754


No 9  
>PF13966 zf-RVT:  zinc-binding in reverse transcriptase
Probab=34.57  E-value=20  Score=27.33  Aligned_cols=41  Identities=29%  Similarity=0.630  Sum_probs=27.1

Q ss_pred             ccceee-eccccCCC--CCCCCcc-cCC-chhhhhhhhccccCCCCcccccccccc
Q psy17175         71 IGHTRL-THNHLFTK--TDPPLCQ-CGA-ALSVRHILSCHTKIDPPLCQCGAALSV  121 (285)
Q Consensus        71 ight~~-th~~l~~k--~~~p~c~-c~~-~ltv~hi~~~~~~~~~~~~~c~~~~~v  121 (285)
                      .-|-++ |-.-|..+  ..++.|. |+. .=|+.|++.          .||.+-.+
T Consensus        40 ~~~~rL~t~~~l~~r~~~~~~~C~~C~~~~Et~~Hlf~----------~C~~a~~~   85 (86)
T PF13966_consen   40 ALHNRLPTKDNLQRRGIQVDPICPLCGNEEETIEHLFF----------HCPFAREL   85 (86)
T ss_pred             eccccchhhhhhhccCCccCCccccCCCccccccceec----------cCcCcccc
Confidence            344444 33444333  5679996 984 889999998          78776543


No 10 
>KOG0466|consensus
Probab=27.27  E-value=48  Score=33.08  Aligned_cols=15  Identities=47%  Similarity=0.820  Sum_probs=12.4

Q ss_pred             cccccceeee--ecCCC
Q psy17175        117 AALSVRHILF--CHQHD  131 (285)
Q Consensus       117 ~~~~vr~~~W--IPGH~  131 (285)
                      ++.-|||+-+  +|||.
T Consensus       120 ~~klvRHVSfVDCPGHD  136 (466)
T KOG0466|consen  120 KMKLVRHVSFVDCPGHD  136 (466)
T ss_pred             ceEEEEEEEeccCCchH
Confidence            5778999988  69995


No 11 
>PRK13907 rnhA ribonuclease H; Provisional
Probab=23.08  E-value=46  Score=26.82  Aligned_cols=21  Identities=10%  Similarity=-0.208  Sum_probs=15.7

Q ss_pred             cccccceeeeecCCCCcCcchhHHhh
Q psy17175        117 AALSVRHILFCHQHDNAAGVESLFLL  142 (285)
Q Consensus       117 ~~~~vr~~~WIPGH~gIpGNE~AD~~  142 (285)
                      .+..++ +.|||+    ++|+.||.+
T Consensus       100 ~f~~~~-~~~v~r----~~N~~Ad~L  120 (128)
T PRK13907        100 SFDLFF-IKWIPS----SQNKVADEL  120 (128)
T ss_pred             cCCceE-EEEcCc----hhchhHHHH
Confidence            344553 799998    588999986


No 12 
>PF03563 Bunya_G2:  Bunyavirus glycoprotein G2;  InterPro: IPR005168 Bunyavirus has three genomic segments: small (S), middle-sized (M), and large (L). The S segment encodes the nucleocapsid and a non-structural protein. The M segment codes for two glycoproteins, G1 and G2, and another non-structural protein (NSm). The L segment codes for an RNA polymerase. This entry represents the polyprotein region forming the G2 glycoprotein, which interacts with the IPR005167 from INTERPRO G1 glycoprotein [].
Probab=22.59  E-value=53  Score=31.58  Aligned_cols=20  Identities=35%  Similarity=0.478  Sum_probs=18.7

Q ss_pred             CCCccCCCceeeeeeecccc
Q psy17175         11 NPIQTDFGPCMLFEVKHSLN   30 (285)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~   30 (285)
                      ||+++..|+=|+|||.+.|+
T Consensus        66 nPi~~~~Gti~Vievd~dl~   85 (285)
T PF03563_consen   66 NPIKDAGGTINVIEVDNDLM   85 (285)
T ss_pred             CCeecCCCcEEEEEECCCce
Confidence            89999999999999998775


No 13 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=20.61  E-value=59  Score=24.59  Aligned_cols=26  Identities=27%  Similarity=0.660  Sum_probs=17.3

Q ss_pred             CCCCCCCc-cCCCcc-ccceeec--cccch
Q psy17175        225 TKIDPPLC-QCGAAL-SVRHILF--CHQHV  250 (285)
Q Consensus       225 ~~~~~P~C-~CG~~~-Tv~HIl~--Cp~y~  250 (285)
                      ...++|.| +||..+ -.++-..  ||.-.
T Consensus         5 ~~~~~~~CtSCg~~i~p~e~~v~F~CPnCG   34 (61)
T COG2888           5 EMKDPPVCTSCGREIAPGETAVKFPCPNCG   34 (61)
T ss_pred             cccCCceeccCCCEeccCCceeEeeCCCCC
Confidence            34458999 999877 3444443  88753


Done!