BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy17177
(105 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3K60|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium
Falciparum Hsp90 (Pf07_0029) Bound To Adp
pdb|3K60|B Chain B, Crystal Structure Of N-Terminal Domain Of Plasmodium
Falciparum Hsp90 (Pf07_0029) Bound To Adp
Length = 223
Score = 31.2 bits (69), Expect = 0.17, Method: Compositional matrix adjust.
Identities = 13/47 (27%), Positives = 29/47 (61%)
Query: 17 LRKDYARYSKDEEVDDMIHWFSIFNSFMMVIFLERDLGDEYGWKQVH 63
L++D Y +++ + D++ S F SF + ++ ER G E+ W++++
Sbjct: 177 LKEDQLEYLEEKRIKDLVKKHSEFISFPIKLYCERGGGVEHEWEELN 223
>pdb|3QNQ|A Chain A, Crystal Structure Of The Transporter Chbc, The Iic
Component From The N,n'-diacetylchitobiose-specific
Phosphotransferase System
pdb|3QNQ|B Chain B, Crystal Structure Of The Transporter Chbc, The Iic
Component From The N,n'-diacetylchitobiose-specific
Phosphotransferase System
pdb|3QNQ|C Chain C, Crystal Structure Of The Transporter Chbc, The Iic
Component From The N,n'-diacetylchitobiose-specific
Phosphotransferase System
pdb|3QNQ|D Chain D, Crystal Structure Of The Transporter Chbc, The Iic
Component From The N,n'-diacetylchitobiose-specific
Phosphotransferase System
Length = 442
Score = 26.9 bits (58), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 6/46 (13%)
Query: 64 GDVFRPS------PHPMLFSALIGTGYQITTVTLSVILFAIVGDLY 103
G V RPS P+LFS +G+G +I+ V L ++ FA+ +Y
Sbjct: 370 GLVARPSGAAVTWTTPILFSGYLGSGGKISGVILQLVNFALAFVIY 415
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.330 0.144 0.442
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,000,172
Number of Sequences: 62578
Number of extensions: 108364
Number of successful extensions: 336
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 334
Number of HSP's gapped (non-prelim): 2
length of query: 105
length of database: 14,973,337
effective HSP length: 70
effective length of query: 35
effective length of database: 10,592,877
effective search space: 370750695
effective search space used: 370750695
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)