BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17179
         (533 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3W01|A Chain A, Crystal Structure Of Pcrb Complexed With Peg From
           Staphylococcus Aureus Subsp. Aureus Mu3
 pdb|3W01|B Chain B, Crystal Structure Of Pcrb Complexed With Peg From
           Staphylococcus Aureus Subsp. Aureus Mu3
 pdb|3W02|A Chain A, Crystal Structure Of Pcrb Complexed With So4 From
           Staphylococcus Aureus Subsp. Aureus Mu3
 pdb|3W02|B Chain B, Crystal Structure Of Pcrb Complexed With So4 From
           Staphylococcus Aureus Subsp. Aureus Mu3
          Length = 235

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 12  NNIAKTTYCGTRLDEEKLKAFIYAVKNHYWYQ-MYIDDLPIWGIVGEVEELSDH 64
           + +AK T   T L  E L+A+   V + Y    MYI+   I+G V +V+ +S+H
Sbjct: 130 SKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSKVQAVSEH 183


>pdb|2CUN|A Chain A, Crystal Structure Of Phosphoglycerate Kinase From
           Pyrococcus Horikoshii Ot3
 pdb|2CUN|B Chain B, Crystal Structure Of Phosphoglycerate Kinase From
           Pyrococcus Horikoshii Ot3
          Length = 410

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 55  VGEVEELSDHTNYYLWTHKKFDIGYNGDRIVDVNLTSENKILL 97
           V   EE+ D    Y+ T   F + Y G+R V+++L SEN+ LL
Sbjct: 255 VKHAEEILDEFYPYIRTPVDFAVDYKGER-VEIDLLSENRGLL 296


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.143    0.464 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,166,407
Number of Sequences: 62578
Number of extensions: 539230
Number of successful extensions: 1074
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1072
Number of HSP's gapped (non-prelim): 8
length of query: 533
length of database: 14,973,337
effective HSP length: 103
effective length of query: 430
effective length of database: 8,527,803
effective search space: 3666955290
effective search space used: 3666955290
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 54 (25.4 bits)