RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17181
         (75 letters)



>gnl|CDD|234729 PRK00331, PRK00331, glucosamine--fructose-6-phosphate
          aminotransferase; Reviewed.
          Length = 604

 Score = 27.7 bits (63), Expect = 0.49
 Identities = 8/10 (80%), Positives = 8/10 (80%)

Query: 52 MCGTVGYVGT 61
          MCG VGYVG 
Sbjct: 1  MCGIVGYVGQ 10


>gnl|CDD|182260 PRK10133, PRK10133, L-fucose transporter; Provisional.
          Length = 438

 Score = 26.0 bits (57), Expect = 1.6
 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 11/45 (24%)

Query: 31  GLFQTTFYFGY----------MALFSLGLGIMCGTVGYV-GTSLF 64
           GL Q+ FYFGY          M   S   GI+ G   Y  G +LF
Sbjct: 64  GLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYALGAALF 108


>gnl|CDD|212040 cd10332, SLC6sbd-B0AT-like, System B(0) neutral amino acid
           transporter AT1, 2 and 3, and related proteins;
           solute-binding domain.  This subgroup includes the
           solute-binding domain of transmembrane transporters,
           which transport, i) neutral amino acids: NTT4 (also
           called XT1), SBAT1 (also called B0AT2, v7-3, NTT7-3),
           and B0AT1 (also called HND); the human genes encoding
           these are SLC6A17, SLC6A15, and SLC6A19 respectively,
           ii) glycine: B0AT3 (also called Xtrp2, XT2), iii) imino
           acids, such as proline, pipecolate, MeAIB, and
           sarcosine: SIT1 (also called XTRP3, XT3, IMINO). The
           human genes encoding B0AT3 and SIT1 are SLC6A18 and
           SLC6A20 respectively. Transporters in this subgroup may
           play a role in disorders including major depression,
           Hartnup disorder, increased susceptibility to myocardial
           infarction, and iminoglycinuria. This subgroup belongs
           to the solute carrier 6 (SLC6) transporter family.
          Length = 565

 Score = 24.9 bits (55), Expect = 4.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 41  YMALFSLGLGIMCGTVGYVGTSLF-------VRKIYATVKI 74
           ++ L +LGLG M GT+  V T LF       V K Y T  +
Sbjct: 386 FLMLLTLGLGSMFGTLEGVLTPLFDSKILPKVPKEYLTGLV 426


>gnl|CDD|223526 COG0449, GlmS, Glucosamine 6-phosphate synthetase, contains
          amidotransferase and phosphosugar isomerase domains
          [Cell envelope biogenesis, outer membrane].
          Length = 597

 Score = 24.8 bits (55), Expect = 5.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)

Query: 52 MCGTVGYVG 60
          MCG VGY+G
Sbjct: 1  MCGIVGYIG 9


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.331    0.145    0.434 

Gapped
Lambda     K      H
   0.267   0.0690    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,823,119
Number of extensions: 297789
Number of successful extensions: 471
Number of sequences better than 10.0: 1
Number of HSP's gapped: 470
Number of HSP's successfully gapped: 25
Length of query: 75
Length of database: 10,937,602
Length adjustment: 45
Effective length of query: 30
Effective length of database: 8,941,672
Effective search space: 268250160
Effective search space used: 268250160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 53 (24.3 bits)