Diaphorina citri psyllid: psy17186


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
GPPQPGQPFKFTVSESCDRIKEEFNFLQAQYHNAKMEVEKLIQEKTEMQRHYVMTEIAKRLNAIIVQIMPFLSQEHQQQVATALERAKQVTMTELNAIIG
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHc
***********TVSESCDRIKEEFNFLQAQYHNAKMEVEKLIQEKTEMQRHYVMTEIAKRLNAIIVQIMPFLSQEHQQQ**************E**A***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GPPQPGQPFKFTVSESxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYVMTEIAKRLNAIIVQIMPFLSQEHQQQVATALERAKQVTMTELNAIIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transducin-like enhancer protein 3 Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (By similarity). May play an important role during spermatogenesis.confidentQ08122
Transducin-like enhancer protein 3 Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.confidentQ9JIT3
Transducin-like enhancer protein 3 Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.confidentQ04726

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0090090 [BP]negative regulation of canonical Wnt receptor signaling pathwayprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0043124 [BP]negative regulation of I-kappaB kinase/NF-kappaB cascadeprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0010627, GO:0010741, GO:0043122
GO:0031668 [BP]cellular response to extracellular stimulusprobableGO:0009991, GO:0071496, GO:0009605, GO:0050896, GO:0009987, GO:0051716, GO:0008150, GO:0044763, GO:0007154, GO:0044699
GO:0016055 [BP]Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032091 [BP]negative regulation of protein bindingprobableGO:0051098, GO:0051100, GO:0008150, GO:0065007, GO:0044092, GO:0043393, GO:0065009
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0030099 [BP]myeloid cell differentiationprobableGO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:1900052 [BP]regulation of retinoic acid biosynthetic processprobableGO:0019747, GO:0080090, GO:0019222, GO:0032350, GO:0031326, GO:0031323, GO:0019216, GO:0009889, GO:0010565, GO:0050794, GO:0065007, GO:0046890, GO:0008150, GO:0050789, GO:0030656
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:2000209 [BP]regulation of anoikisprobableGO:0050794, GO:0043067, GO:0065007, GO:0008150, GO:0010941, GO:0042981, GO:0050789
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0001106 [MF]RNA polymerase II transcription corepressor activityprobableGO:0001191, GO:0003714, GO:0003712, GO:0001104, GO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0070555 [BP]response to interleukin-1probableGO:0042221, GO:0050896, GO:0008150, GO:0034097, GO:0010033

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AJ5, chain K
Confidence level:probable
Coverage over the Query: 12-78
View the alignment between query and template
View the model in PyMOL