Diaphorina citri psyllid: psy17187


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MSAFAISIQTNVFLYSSLLQLCEERHCEYQVFPYAVSIMDRFLCYCPMEKSQLQLTASACLLIASKIRECHALCVEDLVYYSDYTFSPHTLKTTEKPAVYLNNTHVIMKKVKDLVGTSMATFS
cccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHHHHHcccEEccccHHHHHHHHccccc
**AFAISIQTNVFLYSSLLQLCEERHCEYQVFPYAVSIMDRFLCYCPMEKSQLQLTASACLLIASKIRECHALCVEDLVYYSDYTFSPHTLKTTEKPAVYLNNTHVIMKKVKDLVGTSMAT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAFAISIQTNVFLYSSLLQLCEERHCEYQVFPYAVSIMDRFLCYCPMEKSQLQLTASACLLIASKIRECHALCVEDLVYYSDYTFSPHTLKTTEKPAVYLNNTHVIMKKVKDLVGTSMATFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0000307 [CC]cyclin-dependent protein kinase holoenzyme complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0045737 [BP]positive regulation of cyclin-dependent protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0071902, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0045787, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0010604, GO:0042325, GO:0042327, GO:0045860, GO:0051726, GO:0000079, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9R, chain A
Confidence level:very confident
Coverage over the Query: 1-117
View the alignment between query and template
View the model in PyMOL