Diaphorina citri psyllid: psy17191

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MSKAERMMYGESSMTHAMVISAVSIDKIERCNFYLNTVVETARRGEPVDGRLVSFLMQSPNGDGGQWDMLVNLIVNHGLMPKNCLVWIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENRIIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENSRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENRIIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCEVSKRFANKLGLNDLEIHNFKAVFDSDVSLPMSKAERMMYGESSMTHAMVISAVSIDKETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ
ccHHHHcccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHccHHHHHHHHHccccccccCEEEEEccccCEEEEccccccHHHHccccccccccEEEEcccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccHHHHccccccccccHHHHHHHcccccccEEEEEEEEEccccccEEEEEEEcccccccccccEEEEEHHHHHHccEEEEEEcccccHHHHHHHHHHHHHcccccccHHHHccccccEEcccccccccccc
********YGESSMTHAMVISAVSIDKIERCNFYLNTVVETARRGEPVDGRLVSFLMQSPNGDGGQWDMLVNLIVNHGLMPKNCLVWIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENRIIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENSRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENRIIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCEVSKRFANKLGLNDLEIHNFKAVFDSDVSLPMSKAERMMYGESSMTHAMVISAVSIDKETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKAERMMYGESSMTHAMVISAVSIDKIERCNFYLNTVVETARRGEPVDGRLVSFLMQSPNGDGGQWDMLVNLIVNHGLMPKNCLVWIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENRIIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENSRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCENRIIRIRIIYNNQPVELLMKLAAESIKNNEAVWFGCEVSKRFANKLGLNDLEIHNFKAVFDSDVSLPMSKAERMMYGESSMTHAMVISAVSIDKETEEPTKWRVENSWGEEQNHKGYILMTSPWFKEYVFEVVVDKKYVPASVLDEYVFEVVVDKKYVPASVLDVFNQEPTILPAWDPMGTLAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bleomycin hydrolase The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.confidentP87362
Cysteine proteinase 1, mitochondrial The normal physiological role of the enzyme is unknown, but it is not essential for the viability of yeast cells. Has aminopeptidase activity, shortening substrate peptides sequentially by 1 amino acid. Has bleomycin hydrolase activity, which can protect the cell from the toxic effects of bleomycin. Has homocysteine-thiolactonase activity, protecting the cell against homocysteine toxicity. Acts as a repressor in the GAL4 regulatory system, but this does not require either the peptidase or nucleic acid-binding activities.confidentQ01532
Bleomycin hydrolase The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.confidentQ13867

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.22.-Cysteine endopeptidases.probable
3.4.22.40Bleomycin hydrolase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CB5, chain A
Confidence level:very confident
Coverage over the Query: 22-152,165-329,349-376
View the alignment between query and template
View the model in PyMOL
Template: 2CB5, chain A
Confidence level:confident
Coverage over the Query: 1-26,43-95
View the alignment between query and template
View the model in PyMOL