Query         psy17213
Match_columns 69
No_of_seqs    22 out of 24
Neff          2.0 
Searched_HMMs 46136
Date          Sat Aug 17 00:45:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17213.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17213hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05715 Ig_P0-like Immunoglobu  63.7      23 0.00049   21.6   4.4   39   26-66     12-51  (116)
  2 cd05886 Ig1_Nectin-1_like Firs  57.5      36 0.00078   21.2   4.6   36   28-66      1-36  (99)
  3 smart00538 POP4 A domain found  48.9      17 0.00037   23.2   2.2   20   28-47     25-44  (92)
  4 COG4460 Uncharacterized protei  43.7      23  0.0005   25.2   2.4   24   22-46     62-87  (130)
  5 cd05879 Ig_P0 Immunoglobulin (  42.7      62  0.0013   20.7   4.1   28   26-55     12-39  (116)
  6 smart00350 MCM minichromosome   39.0      27 0.00058   27.3   2.3   26   12-37    106-131 (509)
  7 PF09104 BRCA-2_OB3:  BRCA2, ol  38.2      44 0.00095   23.6   3.1   24   40-63     68-91  (143)
  8 cd03081 TRX_Fd_NuoE_FDH_gamma   36.4      27 0.00059   20.8   1.6   23   14-36     42-64  (80)
  9 cd05753 Ig2_FcgammaR_like Seco  32.9      80  0.0017   18.3   3.2   30   25-60     12-41  (83)
 10 cd05764 Ig_2 Subgroup of the i  31.3      68  0.0015   17.4   2.6   27   27-59      1-27  (74)
 11 PF00047 ig:  Immunoglobulin do  31.2      84  0.0018   16.3   4.9   30   27-61      1-30  (64)
 12 PF07945 Toxin_16:  Janus-atrac  30.1      23 0.00049   20.5   0.5   10   22-31     14-23  (36)
 13 cd05846 Ig1_MRC-OX-2_like Firs  28.9 1.3E+02  0.0028   17.6   4.3   27   27-58      1-27  (97)
 14 PF00677 Lum_binding:  Lumazine  28.4      41  0.0009   20.6   1.5   15   19-33     69-83  (85)
 15 PF08450 SGL:  SMP-30/Gluconola  28.1   1E+02  0.0022   20.5   3.4   18   32-50      2-19  (246)
 16 PF01257 2Fe-2S_thioredx:  Thio  26.0      33 0.00072   22.7   0.8   22   14-35    106-127 (145)
 17 cd03064 TRX_Fd_NuoE TRX-like [  24.2      58  0.0013   18.9   1.5   21   15-35     43-63  (80)
 18 PF04537 Herpes_UL55:  Herpesvi  23.4      75  0.0016   23.2   2.3   24   11-39    113-136 (169)
 19 cd05877 Ig_LP_like Immunoglobu  23.0 1.7E+02  0.0037   17.0   4.3   30   26-57      1-32  (106)
 20 PF00947 Pico_P2A:  Picornaviru  22.0      39 0.00084   23.6   0.6    9   21-29     84-92  (127)
 21 cd03082 TRX_Fd_NuoE_W_FDH_beta  21.9      64  0.0014   19.2   1.4   22   14-35     34-55  (72)
 22 PRK07539 NADH dehydrogenase su  21.6      79  0.0017   21.1   2.0   22   14-35    115-136 (154)
 23 PF03376 Adeno_E3B:  Adenovirus  21.4      39 0.00084   21.7   0.4    8   16-23      4-11  (67)
 24 cd03083 TRX_Fd_NuoE_hoxF TRX-l  21.4      80  0.0017   18.7   1.8   22   14-35     42-63  (80)
 25 TIGR02841 spore_YyaC putative   20.7      47   0.001   23.5   0.8   17    4-23      4-20  (140)
 26 cd02980 TRX_Fd_family Thioredo  20.5   1E+02  0.0023   17.1   2.1   20   14-33     37-56  (77)
 27 cd05880 Ig_EVA1 Immunoglobulin  20.1 2.3E+02   0.005   17.4   4.8   11   26-36     12-22  (115)

No 1  
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=63.74  E-value=23  Score=21.58  Aligned_cols=39  Identities=23%  Similarity=0.404  Sum_probs=22.5

Q ss_pred             CCcEeeeeeeEeeecCCeEEEEEeeEE-eeccCCceeeEEEE
Q psy17213         26 PGTSVTLEGIVWHETEGTSVTLEGIVW-HETEGKGISQSLFI   66 (69)
Q Consensus        26 pGTsV~LEGIVW~Etegg~l~vvnVtW-R~teg~~~~~~~~~   66 (69)
                      .|.+|.|.|...........  ..|.| +...+.+-.+.+|.
T Consensus        12 ~G~~vtL~C~~s~~~~~~~~--~~v~W~~~~~~~~~~~~v~~   51 (116)
T cd05715          12 NGSDVRLKCTFSSSEPISDD--ISVTWSFQPEGSGDTESIFH   51 (116)
T ss_pred             cCCCeEEEeEEeCCCCcCCc--eEEEEEEecCCCCCcEEEEE
Confidence            68889999977533221111  26889 45555554455544


No 2  
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=57.47  E-value=36  Score=21.19  Aligned_cols=36  Identities=19%  Similarity=0.329  Sum_probs=22.1

Q ss_pred             cEeeeeeeEeeecCCeEEEEEeeEEeeccCCceeeEEEE
Q psy17213         28 TSVTLEGIVWHETEGTSVTLEGIVWHETEGKGISQSLFI   66 (69)
Q Consensus        28 TsV~LEGIVW~Etegg~l~vvnVtWR~teg~~~~~~~~~   66 (69)
                      |.|.|.|.-+..-+..-+  ..|+|+.... |-.+++++
T Consensus         1 ~~v~L~C~f~~~~~~~~~--~~V~W~k~~~-~~~~~va~   36 (99)
T cd05886           1 TDVVLHCSFINPLPPVKI--TQVTWQKLTN-GSKQNVAI   36 (99)
T ss_pred             CcEEEEeEeecCCCCCCe--EEEEEEECCC-CCceEEEE
Confidence            467788877754444443  4899987653 33555544


No 3  
>smart00538 POP4 A domain found in a protein subunit of human RNase MRP and RNase P ribonucleoprotein complexes and archaeal proteins.
Probab=48.93  E-value=17  Score=23.19  Aligned_cols=20  Identities=40%  Similarity=0.370  Sum_probs=16.3

Q ss_pred             cEeeeeeeEeeecCCeEEEE
Q psy17213         28 TSVTLEGIVWHETEGTSVTL   47 (69)
Q Consensus        28 TsV~LEGIVW~Etegg~l~v   47 (69)
                      +.|-++|||..||..+.+++
T Consensus        25 s~vGi~GiVv~ET~nt~~I~   44 (92)
T smart00538       25 SLVGIEGIVVDETRNTLKIE   44 (92)
T ss_pred             CccCcEEEEEEeeeeEEEEE
Confidence            34568999999999998764


No 4  
>COG4460 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.72  E-value=23  Score=25.21  Aligned_cols=24  Identities=33%  Similarity=0.603  Sum_probs=19.2

Q ss_pred             ccCCCCcEeeeeee--EeeecCCeEEE
Q psy17213         22 GPCEPGTSVTLEGI--VWHETEGTSVT   46 (69)
Q Consensus        22 GPCEpGTsV~LEGI--VW~Etegg~l~   46 (69)
                      +.|-||=.+.+|+|  +| ++++|.++
T Consensus        62 racrpGl~I~ie~i~l~a-~~~dga~l   87 (130)
T COG4460          62 RACRPGLAISIEDIRLGA-QTEDGAVL   87 (130)
T ss_pred             cCCCCCeEEEEecccccc-cCCCceee
Confidence            46999999999987  67 67777654


No 5  
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=42.70  E-value=62  Score=20.67  Aligned_cols=28  Identities=25%  Similarity=0.404  Sum_probs=20.0

Q ss_pred             CCcEeeeeeeEeeecCCeEEEEEeeEEeec
Q psy17213         26 PGTSVTLEGIVWHETEGTSVTLEGIVWHET   55 (69)
Q Consensus        26 pGTsV~LEGIVW~Etegg~l~vvnVtWR~t   55 (69)
                      .|++|.|.|..+...+....  .+|+|.-+
T Consensus        12 ~G~~v~L~C~f~~~~~~~~~--~~v~W~~~   39 (116)
T cd05879          12 VGSDVTLSCSFWSSEWISDD--ISFTWHYQ   39 (116)
T ss_pred             cCCcEEEEEEEecCCCCCCc--EEEEEEEc
Confidence            58999999999865544333  28999443


No 6  
>smart00350 MCM minichromosome  maintenance proteins.
Probab=38.97  E-value=27  Score=27.33  Aligned_cols=26  Identities=27%  Similarity=0.493  Sum_probs=22.0

Q ss_pred             eeeccCCCccccCCCCcEeeeeeeEe
Q psy17213         12 VGTITEPECLGPCEPGTSVTLEGIVW   37 (69)
Q Consensus        12 ~~t~TEp~clGPCEpGTsV~LEGIVW   37 (69)
                      +-.+=|.|..+.|.||..|.+-||+=
T Consensus       106 i~v~l~~dLvd~~~PGD~V~i~Gi~~  131 (509)
T smart00350      106 VDVILDGDLVDKAKPGDRVEVTGIYR  131 (509)
T ss_pred             EEEEEcccccCcccCCCEEEEEEEEE
Confidence            44455899999999999999999984


No 7  
>PF09104 BRCA-2_OB3:  BRCA2, oligonucleotide/oligosaccharide-binding, domain 3;  InterPro: IPR015188 This domain assumes an OB fold, which consists of a highly curved five-stranded beta-sheet that closes on itself to form a beta-barrel. OB3 has a pronounced groove formed by one face of the curved sheet and is demarcated by two loops, one between beta 1 and beta 2 and another between beta 4 and beta 5, which allows for strong ssDNA binding []. ; PDB: 1IYJ_D 1MIU_A.
Probab=38.15  E-value=44  Score=23.57  Aligned_cols=24  Identities=17%  Similarity=0.450  Sum_probs=15.9

Q ss_pred             cCCeEEEEEeeEEeeccCCceeeE
Q psy17213         40 TEGTSVTLEGIVWHETEGKGISQS   63 (69)
Q Consensus        40 tegg~l~vvnVtWR~teg~~~~~~   63 (69)
                      .++..+-..|+.||...-.+|.|.
T Consensus        68 k~~~liA~SNLqwR~~s~s~iP~~   91 (143)
T PF09104_consen   68 KPGSLIAASNLQWRPESTSGIPTL   91 (143)
T ss_dssp             -TT-EEEEEEEEE-S-TTSSS-EE
T ss_pred             CcceEEEEeeeEeecccccCCCee
Confidence            578888889999998887888664


No 8  
>cd03081 TRX_Fd_NuoE_FDH_gamma TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, NAD-dependent formate dehydrogenase (FDH) gamma subunit; composed of proteins similar to the gamma subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD+ to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH gamma subunit is closely related to NuoE, which is part of a multisubunit complex (Nuo) catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE. Similarly, the FDH gamma subunit is hypothesized to be involved in an electron transport chain involving other FDH subunits, upon the oxidat
Probab=36.44  E-value=27  Score=20.79  Aligned_cols=23  Identities=30%  Similarity=0.613  Sum_probs=18.2

Q ss_pred             eccCCCccccCCCCcEeeeeeeE
Q psy17213         14 TITEPECLGPCEPGTSVTLEGIV   36 (69)
Q Consensus        14 t~TEp~clGPCEpGTsV~LEGIV   36 (69)
                      ++.+-.|||.|.-|=.+.+++++
T Consensus        42 ~l~~~~ClG~C~~gP~~~v~~~~   64 (80)
T cd03081          42 TLEPVYCLGLCACSPAAMIDGEV   64 (80)
T ss_pred             EEEEeeecCccCCCCEEEECCEE
Confidence            45577899999999888877763


No 9  
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=32.91  E-value=80  Score=18.33  Aligned_cols=30  Identities=17%  Similarity=0.287  Sum_probs=19.8

Q ss_pred             CCCcEeeeeeeEeeecCCeEEEEEeeEEeeccCCce
Q psy17213         25 EPGTSVTLEGIVWHETEGTSVTLEGIVWHETEGKGI   60 (69)
Q Consensus        25 EpGTsV~LEGIVW~Etegg~l~vvnVtWR~teg~~~   60 (69)
                      ..|.+|.|.|-++...+.     .++.|.+ .|+.+
T Consensus        12 ~~G~~vtL~C~~~~~~~~-----~~~~w~k-~g~~~   41 (83)
T cd05753          12 FEGEPLVLRCHGWKNKPV-----YKVTYYR-DGKAK   41 (83)
T ss_pred             cCCCCEEEEeeCCCCCcc-----eEEEEEE-CCeEc
Confidence            468999999998743322     2788885 45544


No 10 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=31.30  E-value=68  Score=17.38  Aligned_cols=27  Identities=26%  Similarity=0.383  Sum_probs=14.8

Q ss_pred             CcEeeeeeeEeeecCCeEEEEEeeEEeeccCCc
Q psy17213         27 GTSVTLEGIVWHETEGTSVTLEGIVWHETEGKG   59 (69)
Q Consensus        27 GTsV~LEGIVW~Etegg~l~vvnVtWR~teg~~   59 (69)
                      |.++.|+|.+ .-.|..     .|+|....+.-
T Consensus         1 G~~~~l~C~~-~g~P~p-----~v~W~~~~~~~   27 (74)
T cd05764           1 GQRATLRCKA-RGDPEP-----AIHWISPDGKL   27 (74)
T ss_pred             CCeEEEEEEc-cCcCCC-----EEEEEeCCCEE
Confidence            5677787765 222322     56776544433


No 11 
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=31.17  E-value=84  Score=16.29  Aligned_cols=30  Identities=23%  Similarity=0.287  Sum_probs=19.5

Q ss_pred             CcEeeeeeeEeeecCCeEEEEEeeEEeeccCCcee
Q psy17213         27 GTSVTLEGIVWHETEGTSVTLEGIVWHETEGKGIS   61 (69)
Q Consensus        27 GTsV~LEGIVW~Etegg~l~vvnVtWR~teg~~~~   61 (69)
                      |.+|+|.|.+ ++.+..    .+++|......-+.
T Consensus         1 G~~v~L~C~~-~~~~~~----~~~~W~~~~~~~~~   30 (64)
T PF00047_consen    1 GSSVTLTCSV-SSGPPP----TTVTWSKNGQSLPE   30 (64)
T ss_dssp             TSEEEEEEEE-EESSST----SEEEEEETTTTTSE
T ss_pred             CCeEEEEeec-CCCCCC----cEEEEEECCccccC
Confidence            7789999998 444433    37888766554443


No 12 
>PF07945 Toxin_16:  Janus-atracotoxin;  InterPro: IPR012499 This family includes three peptides secreted by the spider Hadronyche versuta (Blue mountains funnel-web spider) (P82226 from SWISSPROT, P82227 from SWISSPROT, P82228 from SWISSPROT). These are insect-selective, excitatory neurotoxins that may function by antagonising muscle acetylcholine receptors, or acetylcholine receptor subtypes present in other invertebrate neurons []. Janus atracotoxin-Hv1c (J-ACTX-Hv1c, P82228 from SWISSPROT) is organised into a disulphide-rich globular core (residues 3-19) and a beta-hairpin (residues 20-34). There are 4 disulphide bridges, one of which is a vicinal disulphide bridge; this is known to be unimportant in the maintenance of structure but critical for insecticidal activity []. ; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1DL0_A.
Probab=30.08  E-value=23  Score=20.45  Aligned_cols=10  Identities=60%  Similarity=1.099  Sum_probs=4.9

Q ss_pred             ccCCCCcEee
Q psy17213         22 GPCEPGTSVT   31 (69)
Q Consensus        22 GPCEpGTsV~   31 (69)
                      -||-||||-.
T Consensus        14 cpccpgtsc~   23 (36)
T PF07945_consen   14 CPCCPGTSCQ   23 (36)
T ss_dssp             ----TTEEEE
T ss_pred             cCCCCCcccc
Confidence            4899999863


No 13 
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=28.92  E-value=1.3e+02  Score=17.64  Aligned_cols=27  Identities=22%  Similarity=0.408  Sum_probs=17.5

Q ss_pred             CcEeeeeeeEeeecCCeEEEEEeeEEeeccCC
Q psy17213         27 GTSVTLEGIVWHETEGTSVTLEGIVWHETEGK   58 (69)
Q Consensus        27 GTsV~LEGIVW~Etegg~l~vvnVtWR~teg~   58 (69)
                      |++|.|.|....+.  .   +..|.|.+..++
T Consensus         1 G~~vtL~C~~~~~~--~---~~~v~W~k~~~~   27 (97)
T cd05846           1 GGNVTLSCNLTLPE--E---VLQVTWQKIQGS   27 (97)
T ss_pred             CCcEEEEEEeCCCC--e---eEEEEEEEcCCC
Confidence            67899999755332  1   237899876544


No 14 
>PF00677 Lum_binding:  Lumazine binding domain;  InterPro: IPR001783 The following proteins have been shown [, ] to be structurally and evolutionary related:  Riboflavin synthase alpha chain (2.5.1.9 from EC) (RS-alpha) (gene ribC in Escherichia coli, ribB in Bacillus subtilis and Photobacterium leiognathi, RIB5 in yeast. This enzyme synthesises riboflavin from two moles of 6,7- dimethyl-8-(1'-D-ribityl)lumazine (Lum), a pteridine-derivative.  Photobacterium phosphoreum lumazine protein (LumP) (gene luxL). LumP is a protein that modulates the colour of the bioluminescence emission of bacterial luciferase. In the presence of LumP, light emission is shifted to higher energy values (shorter wavelength). LumP binds non-covalently to 6,7-dimethyl-8-(1'-D-ribityl)lumazine.  Vibrio fischeri yellow fluorescent protein (YFP) (gene luxY). Like LumP, YFP modulates light emission but towards a longer wavelength. YFP binds non-covalently to FMN.   These proteins seem to have evolved from the duplication of a domain of about 100 residues. In its C-terminal section, this domain contains a conserved motif [KR]-V-N-[LI]-E which has been proposed to be the binding site for lumazine (Lum) and some of its derivatives. RS-alpha which binds two molecules of Lum has two perfect copies of this motif, while LumP which binds one molecule of Lum, has a Glu instead of Lys/Arg in the first position of the second copy of the motif. Similarly, YFP, which binds to one molecule of FMN, also seems to have a potentially dysfunctional binding site by substitution of Gly for Glu in the last position of the first copy of the motif.; GO: 0004746 riboflavin synthase activity, 0009231 riboflavin biosynthetic process; PDB: 3DDY_A 1KZL_A 3A3G_B 3A35_B 3A3B_B 1I8D_C 1PKV_B 1HZE_B 1I18_B.
Probab=28.42  E-value=41  Score=20.55  Aligned_cols=15  Identities=40%  Similarity=0.554  Sum_probs=10.7

Q ss_pred             CccccCCCCcEeeee
Q psy17213         19 ECLGPCEPGTSVTLE   33 (69)
Q Consensus        19 ~clGPCEpGTsV~LE   33 (69)
                      --++--.+|+.||||
T Consensus        69 T~l~~~~~G~~VNlE   83 (85)
T PF00677_consen   69 TTLGNLKVGDRVNLE   83 (85)
T ss_dssp             SSGGG--TTSEEEEE
T ss_pred             chhccCCCCCEEEEe
Confidence            456888999999998


No 15 
>PF08450 SGL:  SMP-30/Gluconolaconase/LRE-like region;  InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30, Q15493 from SWISSPROT), gluconolactonase (Q01578 from SWISSPROT) and luciferin-regenerating enzyme (LRE, Q86DU5 from SWISSPROT). SMP-30 is known to hydrolyse diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 (P52430 from SWISSPROT) and LRE. ; PDB: 2GHS_A 2DG0_L 2DG1_D 2DSO_D 3E5Z_A 2IAT_A 2IAV_A 2GVV_A 3HLI_A 2GVU_A ....
Probab=28.09  E-value=1e+02  Score=20.49  Aligned_cols=18  Identities=33%  Similarity=0.466  Sum_probs=12.6

Q ss_pred             eeeeEeeecCCeEEEEEee
Q psy17213         32 LEGIVWHETEGTSVTLEGI   50 (69)
Q Consensus        32 LEGIVW~Etegg~l~vvnV   50 (69)
                      .||++|++..+..+. +++
T Consensus         2 ~Egp~~d~~~g~l~~-~D~   19 (246)
T PF08450_consen    2 GEGPVWDPRDGRLYW-VDI   19 (246)
T ss_dssp             EEEEEEETTTTEEEE-EET
T ss_pred             CcceEEECCCCEEEE-EEc
Confidence            499999777776654 444


No 16 
>PF01257 2Fe-2S_thioredx:  Thioredoxin-like [2Fe-2S] ferredoxin;  InterPro: IPR002023  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. Among the many polypeptide subunits that make up complex I, there is one with a molecular weight of 24 kDa (in mammals), which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 2Fe-2S iron-sulphur cluster. The 24 kDa subunit is nuclear encoded, as a precursor form with a transit peptide in mammals and in Neurospora crassa. There is a highly conserved region located in the central section of this subunit that contains two conserved cysteines, that are probably involved in the binding of the 2Fe-2S centre. The 24 kDa subunit is highly similar to [, ]:  Subunit E of Escherichia coli NADH-ubiquinone oxidoreductase (gene nuoE) Subunit NQO2 of Paracoccus denitrificans NADH-ubiquinone oxidoreductase  ; GO: 0016491 oxidoreductase activity, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 1M2D_A 1M2A_B 1F37_B 1M2B_B 2FUG_B 3M9S_B 3IAM_B 3IAS_K 2YBB_2 3I9V_B ....
Probab=26.01  E-value=33  Score=22.66  Aligned_cols=22  Identities=36%  Similarity=0.838  Sum_probs=17.6

Q ss_pred             eccCCCccccCCCCcEeeeeee
Q psy17213         14 TITEPECLGPCEPGTSVTLEGI   35 (69)
Q Consensus        14 t~TEp~clGPCEpGTsV~LEGI   35 (69)
                      ++.+-.|+|.|.-|=.|.+.|.
T Consensus       106 ~l~~~~ClG~C~~aP~v~V~~~  127 (145)
T PF01257_consen  106 TLEETGCLGACDQAPVVMVDGE  127 (145)
T ss_dssp             EEEEESSSSSGGGSSEEEECCC
T ss_pred             EEEECCCccccCCCCEEEECCE
Confidence            3456689999999988888775


No 17 
>cd03064 TRX_Fd_NuoE TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily; Nuo, also called respiratory chain Complex 1, is the entry point for electrons into the respiratory chains of bacteria and the mitochondria of eukaryotes. It is a multisubunit complex with at least 14 core subunits. It catalyzes the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane, providing the proton motive force required for energy-consuming processes. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE core subunit, also called the 24 kD subunit of Complex 1. This subfamily also include formate dehydrogenases, NiFe hydrogenases and NAD-reducing hydrogenases, that contain a NuoE domain. A subset of these proteins contain both NuoE and NuoF in a single chain. NuoF, also called the 51 kD subunit of Complex 1, contains one [4Fe-4S] clu
Probab=24.15  E-value=58  Score=18.89  Aligned_cols=21  Identities=29%  Similarity=0.683  Sum_probs=16.3

Q ss_pred             ccCCCccccCCCCcEeeeeee
Q psy17213         15 ITEPECLGPCEPGTSVTLEGI   35 (69)
Q Consensus        15 ~TEp~clGPCEpGTsV~LEGI   35 (69)
                      +.+-.|+|.|..|=.|.+.|+
T Consensus        43 v~~t~ClG~C~~gP~v~v~g~   63 (80)
T cd03064          43 LEEVECLGACDLAPVMMINDD   63 (80)
T ss_pred             EEEecCcCcCCCCCEEEECCE
Confidence            456789999998888777653


No 18 
>PF04537 Herpes_UL55:  Herpesvirus UL55 protein;  InterPro: IPR007622 In infected cells, UL55 is associated with the nuclear matrix, and found adjacent to compartments containing the capsid protein ICP35. UL55 was not detected in assembled virions. It is thought that UL55 may play a role in virion assembly or maturation [].; GO: 0019067 viral assembly, maturation, egress, and release
Probab=23.39  E-value=75  Score=23.18  Aligned_cols=24  Identities=29%  Similarity=0.436  Sum_probs=16.2

Q ss_pred             ceeeccCCCccccCCCCcEeeeeeeEeee
Q psy17213         11 SVGTITEPECLGPCEPGTSVTLEGIVWHE   39 (69)
Q Consensus        11 s~~t~TEp~clGPCEpGTsV~LEGIVW~E   39 (69)
                      |.||+..-.--|     -.++++||+.|+
T Consensus       113 SaaTi~d~~~~~-----~~~~I~Gl~yHC  136 (169)
T PF04537_consen  113 SAATIKDSPDDG-----YEYTINGLCYHC  136 (169)
T ss_pred             ccceeeccCCCC-----CceEEEEEEEEe
Confidence            456666533323     389999999997


No 19 
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=23.03  E-value=1.7e+02  Score=17.04  Aligned_cols=30  Identities=23%  Similarity=0.269  Sum_probs=16.3

Q ss_pred             CCcEeeeeeeEeeec--CCeEEEEEeeEEeeccC
Q psy17213         26 PGTSVTLEGIVWHET--EGTSVTLEGIVWHETEG   57 (69)
Q Consensus        26 pGTsV~LEGIVW~Et--egg~l~vvnVtWR~teg   57 (69)
                      .|..|.|.|-.=...  .+..  ...|.|.+...
T Consensus         1 ~G~~vtL~C~~~~~~~~~~~~--~~~v~W~k~~~   32 (106)
T cd05877           1 RGGNVTLPCRYHYEPELSAPR--KIRVKWTKLES   32 (106)
T ss_pred             CCCcEEEEeEeECCCcCCCCc--cceEEEEEecC
Confidence            477788888543221  1121  13678877653


No 20 
>PF00947 Pico_P2A:  Picornavirus core protein 2A;  InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This domain defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies 3CA and 3CB. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral 3C cysteine protease []. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0008233 peptidase activity, 0006508 proteolysis, 0016032 viral reproduction; PDB: 2HRV_B 1Z8R_A.
Probab=22.04  E-value=39  Score=23.59  Aligned_cols=9  Identities=56%  Similarity=1.103  Sum_probs=5.8

Q ss_pred             cccCCCCcE
Q psy17213         21 LGPCEPGTS   29 (69)
Q Consensus        21 lGPCEpGTs   29 (69)
                      .||||||.-
T Consensus        84 ~Gp~~PGdC   92 (127)
T PF00947_consen   84 EGPAEPGDC   92 (127)
T ss_dssp             E-SSSTT-T
T ss_pred             cccCCCCCC
Confidence            599999973


No 21 
>cd03082 TRX_Fd_NuoE_W_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E family, Tungsten-containing formate dehydrogenase (W-FDH) beta subunit; composed of proteins similar to the W-FDH beta subunit of Methylobacterium extorquens. W-FDH is a heterodimeric NAD-dependent enzyme catalyzing the conversion of formate to carbon dioxide. The beta subunit is a fusion protein containing an N-terminal NuoE domain and a C-terminal NuoF domain. NuoE and NuoF are components of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster in NuoE and the [4Fe-4S] cluster in NuoF. In addition, NuoF is also the NADH- and FMN-binding subunit. Similarly, the beta subunit of W-FDH is most likely involved in the electron transport chain during the NAD-dependen
Probab=21.88  E-value=64  Score=19.20  Aligned_cols=22  Identities=18%  Similarity=0.522  Sum_probs=16.9

Q ss_pred             eccCCCccccCCCCcEeeeeee
Q psy17213         14 TITEPECLGPCEPGTSVTLEGI   35 (69)
Q Consensus        14 t~TEp~clGPCEpGTsV~LEGI   35 (69)
                      ++..-.|+|.|..|=.+.+.+-
T Consensus        34 ~l~~~~ClG~C~~gP~v~V~~~   55 (72)
T cd03082          34 RVVRAPCVGRCERAPAALVGQR   55 (72)
T ss_pred             EEEecCcCCccCCCCeEEECCE
Confidence            4557789999999887776654


No 22 
>PRK07539 NADH dehydrogenase subunit E; Validated
Probab=21.58  E-value=79  Score=21.11  Aligned_cols=22  Identities=36%  Similarity=0.720  Sum_probs=17.6

Q ss_pred             eccCCCccccCCCCcEeeeeee
Q psy17213         14 TITEPECLGPCEPGTSVTLEGI   35 (69)
Q Consensus        14 t~TEp~clGPCEpGTsV~LEGI   35 (69)
                      ++.+-.|+|.|.-|=.|.+.+.
T Consensus       115 ~l~~~~ClG~C~~gPvv~V~~~  136 (154)
T PRK07539        115 TLLEVECLGACDNAPVVMINDD  136 (154)
T ss_pred             EEEEccccCccCCCCEEEECCE
Confidence            3456789999999988888764


No 23 
>PF03376 Adeno_E3B:  Adenovirus E3B protein;  InterPro: IPR005041 Adenoviruses are medium-sized, non-enveloped viruses containing double-stranded DNA. They can cause a variety of diseases including pneumonia, cystitis, conjunctivitis and diarrhoea, all of which can be fatal to patients who are immunocompromised []. These viruses have many mechanisms to evade the host immune response, including several proteins which are expressed as part of the early transcription unit 3 (E3) []. One of the regions of E3, known as the E3B region, encodes three proteins known as 10.4K, 14.5K and 14.7K. Two of these proteins, 10.4K and 14.5K, form the RID complex (receptor internalisation and degradation) which protects the infected cell from host-induced lysis by clearing the the TNF and Fas receptors from the cell surface []. Other receptors, such as the epidermal growth factor receptor, are also known to be cleared by RID [].  This entry represents the E3B region 10.4K protein, also known as the RID alpha subunit.; GO: 0016020 membrane
Probab=21.37  E-value=39  Score=21.73  Aligned_cols=8  Identities=63%  Similarity=1.418  Sum_probs=6.6

Q ss_pred             cCCCcccc
Q psy17213         16 TEPECLGP   23 (69)
Q Consensus        16 TEp~clGP   23 (69)
                      -||||++|
T Consensus         4 l~pdCl~p   11 (67)
T PF03376_consen    4 LEPDCLPP   11 (67)
T ss_pred             CCCcccch
Confidence            48999987


No 24 
>cd03083 TRX_Fd_NuoE_hoxF TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, hoxF; composed of proteins similar to the NAD-reducing hydrogenase (hoxS) alpha subunit of Alcaligenes eutrophus H16. HoxS is a cytoplasmic hydrogenase catalyzing the oxidation of molecular hydrogen accompanied by the reduction of NAD. It is composed of four structural subunits encoded by the genes hoxF, hoxU, hoxY and hoxH. The hoxF protein (or alpha subunit) is a fusion protein containing an N-terminal NuoE-like domain and a C-terminal NuoF domain. NuoE and NuoF are components of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster in NuoE and the [4Fe-4S] cluster in NuoF. In addition, NuoF is also the NADH- and FMN-binding subunit. HoxF may be involved 
Probab=21.37  E-value=80  Score=18.75  Aligned_cols=22  Identities=18%  Similarity=0.522  Sum_probs=17.0

Q ss_pred             eccCCCccccCCCCcEeeeeee
Q psy17213         14 TITEPECLGPCEPGTSVTLEGI   35 (69)
Q Consensus        14 t~TEp~clGPCEpGTsV~LEGI   35 (69)
                      ++.+-.|+|.|.-|=.+.+.++
T Consensus        42 ~l~~~gClG~C~~~P~v~V~~~   63 (80)
T cd03083          42 GLFFTSCTGLCDQGPALLINNR   63 (80)
T ss_pred             EEEEeceecCcCCCCeEEECCE
Confidence            3456689999999988888654


No 25 
>TIGR02841 spore_YyaC putative sporulation protein YyaC. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, also called YyaC, is a member of that panel and is otherwise uncharacterized. The second round of PSI-BLAST shows many similarities to the germination protease GPR, which is found in exactly the same set of organisms and has a known role in the sporulation/germination process.
Probab=20.66  E-value=47  Score=23.53  Aligned_cols=17  Identities=47%  Similarity=0.857  Sum_probs=10.4

Q ss_pred             eeeeeecceeeccCCCcccc
Q psy17213          4 ADVCIGTSVGTITEPECLGP   23 (69)
Q Consensus         4 ~~~~v~ts~~t~TEp~clGP   23 (69)
                      .=+|+||--.|   -|||||
T Consensus         4 v~lCIGTDRst---GDsLGP   20 (140)
T TIGR02841         4 VLLCIGTDRST---GDALGP   20 (140)
T ss_pred             EEEEECCCCCc---ccccch
Confidence            44788884322   367777


No 26 
>cd02980 TRX_Fd_family Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd) family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like Fds) and proteins containing domains similar to TRX-like Fd including formate dehydrogenases, NAD-reducing hydrogenases and the subunit E of NADH:ubiquinone oxidoreductase (NuoE). TRX-like Fds are soluble low-potential electron carriers containing a single [2Fe-2S] cluster. The exact role of TRX-like Fd is still unclear. It has been suggested that it may be involved in nitrogen fixation. Its homologous domains in large redox enzymes (such as Nuo and hydrogenases) function as electron carriers.
Probab=20.48  E-value=1e+02  Score=17.10  Aligned_cols=20  Identities=30%  Similarity=0.604  Sum_probs=16.0

Q ss_pred             eccCCCccccCCCCcEeeee
Q psy17213         14 TITEPECLGPCEPGTSVTLE   33 (69)
Q Consensus        14 t~TEp~clGPCEpGTsV~LE   33 (69)
                      .+.+-.|+|.|.-|=.|.+.
T Consensus        37 ~v~~~~Clg~C~~~P~v~i~   56 (77)
T cd02980          37 TVERVGCLGACGLAPVVVVY   56 (77)
T ss_pred             EEEEcCCcCcccCCCEEEEe
Confidence            34577899999998887776


No 27 
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=20.06  E-value=2.3e+02  Score=17.44  Aligned_cols=11  Identities=36%  Similarity=0.444  Sum_probs=8.1

Q ss_pred             CCcEeeeeeeE
Q psy17213         26 PGTSVTLEGIV   36 (69)
Q Consensus        26 pGTsV~LEGIV   36 (69)
                      .|.+|.|.|..
T Consensus        12 ~G~~v~L~C~~   22 (115)
T cd05880          12 NGTDVRLKCTF   22 (115)
T ss_pred             cCCCEEEEEEE
Confidence            57788888764


Done!