Diaphorina citri psyllid: psy17223


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MSDVIYKVTFGQERLMKKLGPNAFPFFFELPPSCPASVTLQPAPGDTGKPCGVDYELKAFVGETAEDKIHKRNSVRLAIRKIMYAPSKQGEQPSVEVSKEFMMSPNKLHLEASLDKELYYHGESIAVNVHVANNSNRTVKKIKVSDSGAEDDQDLKDELADSDIDGMEEDDLPNIKAWGKNKRMYYNTDYVDDDHGGIQSGTGFVWFEWLKKGSKEKSKKKYLFLYYHGESIAVNVHVANNSNRTVKKIKVSDICLFSTAQYKCTVAETESDCPIAPVSMFDTEDLAMLRHGFKRMFGHAFSTSLAMPRDELAGFRSEATEFS
cccccccccHHHHHHHHHccccCCcEEEEccccccccEEEccccccccccCEEEEEEEEEEcccccccccCEEEEEEEEEEEccccccccccccEEEEEEEECcccCEEEEEEccccccccccEEEEEEEEEcccccEEEcEEEccccccccccccccccccccccccccccccccccccCEEEEEECcccccccccccccccEEEEEEEcccccccEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEEEEEEccEEEEEEEEEccccccccccCEEEEEEEEEccccccEEEEECcccccccccccccccccccccc
****IYKVTFGQERLMKKLGPNAFPFFFELPPSCPASVTLQPAPGDTGKPCGVDYELKAFVGETAEDKIHKRNSVRLAIRKIMYAPSKQGEQP*VEVSKEFMMSPNKLHLEASLDKELYYHGESIAVNVHVANNSNRTVKKIKVSDSGAEDDQDLKDELADSDI*********NIKAWGKNKRMYYNTDYVDDDHGGIQSGTGFVWFEWLKKGSKEKSKKKYLFLYYHGESIAVNVHVANNSNRTVKKIKVSDICLFSTAQYKCTVAETESDCPIAPVSMFDTEDLAMLRHGFKRMFGHAFSTSLAMPRDELA**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDVIYKVTFGQERLMKKLGPNAFPFFFELPPSCPASVTLQPAPGDTGKPCGVDYELKAFVGETAEDKIHKRNSVRLAIRKIMYAPSKQGEQPSVEVSKEFMMSPNKLHLEASLDKELYYHGESIAVNVHVANNSNRTVKKIKVSDSGAEDDQDLKDELADSDIDGMEEDDLPNIKAWGKNKRMYYNTDYVDDDHGGIQSGTGFVWFEWLKKGSKEKSKKKYLFLYYHGESIAVNVHVANNSNRTVKKIKVSDICLFSTAQYKCTVAETESDCPIAPVSMFDTEDLAMLRHGFKRMFGHAFSTSLAMPRDELAGFRSEATEFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-arrestin-1 Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated receptor and sterically preclude its coupling to the cognate G-protein; the binding appears to require additional receptor determinants exposed only in the active receptor conformation. The beta-arrestins target many receptors for internalization by acting as endocytic adapters (CLASPs, clathrin-associated sorting proteins) and recruiting the GPRCs to the adapter protein 2 complex 2 (AP-2) in clathrin-coated pits (CCPs). However, the extent of beta-arrestin involvement appears to vary significantly depending on the receptor, agonist and cell type. Internalized arrestin-receptor complexes traffic to intracellular endosomes, where they remain uncoupled from G-proteins. Two different modes of arrestin-mediated internalization occur. Class A receptors, like ADRB2, OPRM1, ENDRA, D1AR and ADRA1B dissociate from beta-arrestin at or near the plasma membrane and undergo rapid recycling. Class B receptors, like AVPR2, AGTR1, NTSR1, TRHR and TACR1 internalize as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptors, for extended periods of time. Receptor resensitization then requires that receptor-bound arrestin is removed so that the receptor can be dephosphorylated and returned to the plasma membrane. Involved in internalization of P2RY4 and UTP-stimulated internalization of P2RY2. Involved in phopshorylation-dependent internalization of OPRD1 ands subsequent recycling. Involved in the degradation of cAMP by recruiting cAMP phosphodiesterases to ligand-activated receptors. Beta-arrestins function as multivalent adapter proteins that can switch the GPCR from a G-protein signaling mode that transmits short-lived signals from the plasma membrane via small molecule second messengers and ion channels to a beta-arrestin signaling mode that transmits a distinct set of signals that are initiated as the receptor internalizes and transits the intracellular compartment. Acts as signaling scaffold for MAPK pathways such as MAPK1/3 (ERK1/2). ERK1/2 activated by the beta-arrestin scaffold is largely excluded from the nucleus and confined to cytoplasmic locations such as endocytic vesicles, also called beta-arrestin signalosomes. Recruits c-Src/SRC to ADRB2 resulting in ERK activation. GPCRs for which the beta-arrestin-mediated signaling relies on both ARRB1 and ARRB2 (codependent regulation) include ADRB2, F2RL1 and PTH1R. For some GPCRs the beta-arrestin-mediated signaling relies on either ARRB1 or ARRB2 and is inhibited by the other respective beta-arrestin form (reciprocal regulation). Inhibits ERK1/2 signaling in AGTR1- and AVPR2-mediated activation (reciprocal regulation). Is required for SP-stimulated endocytosis of NK1R and recruits c-Src/SRC to internalized NK1R resulting in ERK1/2 activation, which is required for the antiapoptotic effects of SP. Is involved in proteinase-activated F2RL1-mediated ERK activity. Acts as signaling scaffold for the AKT1 pathway. Is involved in alpha-thrombin-stimulated AKT1 signaling. Is involved in IGF1-stimulated AKT1 signaling leading to increased protection from apoptosis. Involved in activation of the p38 MAPK signaling pathway and in actin bundle formation. Involved in F2RL1-mediated cytoskeletal rearrangement and chemotaxis. Involved in AGTR1-mediated stress fiber formation by acting together with GNAQ to activate RHOA. Appears to function as signaling scaffold involved in regulation of MIP-1-beta-stimulated CCR5-dependent chemotaxis. Involved in attenuation of NF-kappa-B-dependent transcription in response to GPCR or cytokine stimulation by interacting with and stabilizing CHUK. May serve as nuclear messenger for GPCRs. Involved in OPRD1-stimulated transcriptional regulation by translocating to CDKN1B and FOS promoter regions and recruiting EP300 resulting in acetylation of histone H4. Involved in regulation of LEF1 transcriptional activity via interaction with DVL1 and/or DVL2 Also involved in regulation of receptors other than GPCRs. Involved in Toll-like receptor and IL-1 receptor signaling through the interaction with TRAF6 which prevents TRAF6 autoubiquitination and oligomerization required for activation of NF-kappa-B and JUN. Involved in IL8-mediated granule release in neutrophils. Binds phosphoinositides. Binds inositolhexakisphosphate (InsP6).confidentQ8BWG8
Beta-arrestin-1 Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated receptor and sterically preclude its coupling to the cognate G-protein; the binding appears to require additional receptor determinants exposed only in the active receptor conformation. The beta-arrestins target many receptors for internalization by acting as endocytic adapters (CLASPs, clathrin-associated sorting proteins) and recruiting the GPRCs to the adapter protein 2 complex 2 (AP-2) in clathrin-coated pits (CCPs). However, the extent of beta-arrestin involvement appears to vary significantly depending on the receptor, agonist and cell type. Internalized arrestin-receptor complexes traffic to intracellular endosomes, where they remain uncoupled from G-proteins. Two different modes of arrestin-mediated internalization occur. Class A receptors, like ADRB2, OPRM1, ENDRA, D1AR and ADRA1B dissociate from beta-arrestin at or near the plasma membrane and undergo rapid recycling. Class B receptors, like AVPR2, AGTR1, NTSR1, TRHR and TACR1 internalize as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptors, for extended periods of time. Receptor resensitization then requires that receptor-bound arrestin is removed so that the receptor can be dephosphorylated and returned to the plasma membrane. Involved in internalization of P2RY4 and UTP-stimulated internalization of P2RY2. Involved in phopshorylation-dependent internalization of OPRD1 ands subsequent recycling. Involved in the degradation of cAMP by recruiting cAMP phosphodiesterases to ligand-activated receptors. Beta-arrestins function as multivalent adapter proteins that can switch the GPCR from a G-protein signaling mode that transmits short-lived signals from the plasma membrane via small molecule second messengers and ion channels to a beta-arrestin signaling mode that transmits a distinct set of signals that are initiated as the receptor internalizes and transits the intracellular compartment. Acts as signaling scaffold for MAPK pathways such as MAPK1/3 (ERK1/2). ERK1/2 activated by the beta-arrestin scaffold is largely excluded from the nucleus and confined to cytoplasmic locations such as endocytic vesicles, also called beta-arrestin signalosomes. Recruits c-Src/SRC to ADRB2 resulting in ERK activation. GPCRs for which the beta-arrestin-mediated signaling relies on both ARRB1 and ARRB2 (codependent regulation) include ADRB2, F2RL1 and PTH1R. For some GPCRs the beta-arrestin-mediated signaling relies on either ARRB1 or ARRB2 and is inhibited by the other respective beta-arrestin form (reciprocal regulation). Inhibits ERK1/2 signaling in AGTR1- and AVPR2-mediated activation (reciprocal regulation). Is required for SP-stimulated endocytosis of NK1R and recruits c-Src/SRC to internalized NK1R resulting in ERK1/2 activation, which is required for the antiapoptotic effects of SP. Is involved in proteinase-activated F2RL1-mediated ERK activity. Acts as signaling scaffold for the AKT1 pathway. Is involved in alpha-thrombin-stimulated AKT1 signaling. Is involved in IGF1-stimulated AKT1 signaling leading to increased protection from apoptosis. Involved in activation of the p38 MAPK signaling pathway and in actin bundle formation. Involved in F2RL1-mediated cytoskeletal rearrangement and chemotaxis. Involved in AGTR1-mediated stress fiber formation by acting together with GNAQ to activate RHOA. Appears to function as signaling scaffold involved in regulation of MIP-1-beta-stimulated CCR5-dependent chemotaxis. Involved in attenuation of NF-kappa-B-dependent transcription in response to GPCR or cytokine stimulation by interacting with and stabilizing CHUK. May serve as nuclear messenger for GPCRs. Involved in OPRD1-stimulated transcriptional regulation by translocating to CDKN1B and FOS promoter regions and recruiting EP300 resulting in acetylation of histone H4. Involved in regulation of LEF1 transcriptional activity via interaction with DVL1 and/or DVL2 Also involved in regulation of receptors other than GPCRs. Involved in Toll-like receptor and IL-1 receptor signaling through the interaction with TRAF6 which prevents TRAF6 autoubiquitination and oligomerization required for activation of NF-kappa-B and JUN. Binds phosphoinositides. Binds inositolhexakisphosphate (InsP6) (By similarity). Involved in IL8-mediated granule release in neutrophils.confidentP49407
Beta-arrestin-1 Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated receptor and sterically preclude its coupling to the cognate G-protein; the binding appears to require additional receptor determinants exposed only in the active receptor conformation. The beta-arrestins target many receptors for internalization by acting as endocytic adapters (CLASPs, clathrin-associated sorting proteins) and recruiting the GPRCs to the adapter protein 2 complex 2 (AP-2) in clathrin-coated pits (CCPs). However, the extent of beta-arrestin involvement appears to vary significantly depending on the receptor, agonist and cell type. Internalized arrestin-receptor complexes traffic to intracellular endosomes, where they remain uncoupled from G-proteins. Two different modes of arrestin-mediated internalization occur. Class A receptors, like ADRB2, OPRM1, ENDRA, D1AR and ADRA1B dissociate from beta-arrestin at or near the plasma membrane and undergo rapid recycling. Class B receptors, like AVPR2, AGTR1, NTSR1, TRHR and TACR1 internalize as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptors, for extended periods of time. Receptor resensitization then requires that receptor-bound arrestin is removed so that the receptor can be dephosphorylated and returned to the plasma membrane. Involved in internalization of P2RY4 and UTP-stimulated internalization of P2RY2. Involved in phopshorylation-dependent internalization of OPRD1 ands subsequent recycling. Involved in the degradation of cAMP by recruiting cAMP phosphodiesterases to ligand-activated receptors. Beta-arrestins function as multivalent adapter proteins that can switch the GPCR from a G-protein signaling mode that transmits short-lived signals from the plasma membrane via small molecule second messengers and ion channels to a beta-arrestin signaling mode that transmits a distinct set of signals that are initiated as the receptor internalizes and transits the intracellular compartment. Acts as signaling scaffold for MAPK pathways such as MAPK1/3 (ERK1/2). ERK1/2 activated by the beta-arrestin scaffold is largely excluded from the nucleus and confined to cytoplasmic locations such as endocytic vesicles, also called beta-arrestin signalosomes. Recruits c-Src/SRC to ADRB2 resulting in ERK activation. GPCRs for which the beta-arrestin-mediated signaling relies on both ARRB1 and ARRB2 (codependent regulation) include ADRB2, F2RL1 and PTH1R. For some GPCRs the beta-arrestin-mediated signaling relies on either ARRB1 or ARRB2 and is inhibited by the other respective beta-arrestin form (reciprocal regulation). Inhibits ERK1/2 signaling in AGTR1- and AVPR2-mediated activation (reciprocal regulation). Is required for SP-stimulated endocytosis of NK1R and recruits c-Src/SRC to internalized NK1R resulting in ERK1/2 activation, which is required for the antiapoptotic effects of SP. Is involved in proteinase-activated F2RL1-mediated ERK activity. Acts as signaling scaffold for the AKT1 pathway. Is involved in alpha-thrombin-stimulated AKT1 signaling. Is involved in IGF1-stimulated AKT1 signaling leading to increased protection from apoptosis. Involved in activation of the p38 MAPK signaling pathway and in actin bundle formation. Involved in F2RL1-mediated cytoskeletal rearrangement and chemotaxis. Involved in AGTR1-mediated stress fiber formation by acting together with GNAQ to activate RHOA. Appears to function as signaling scaffold involved in regulation of MIP-1-beta-stimulated CCR5-dependent chemotaxis. Involved in attenuation of NF-kappa-B-dependent transcription in response to GPCR or cytokine stimulation by interacting with and stabilizing CHUK. May serve as nuclear messenger for GPCRs. Involved in OPRD1-stimulated transcriptional regulation by translocating to CDKN1B and FOS promoter regions and recruiting EP300 resulting in acetylation of histone H4. Involved in regulation of LEF1 transcriptional activity via interaction with DVL1 and/or DVL2 Also involved in regulation of receptors other than GPCRs. Involved in Toll-like receptor and IL-1 receptor signaling through the interaction with TRAF6 which prevents TRAF6 autoubiquitination and oligomerization required for activation of NF-kappa-B and JUN. Binds phosphoinositides. Binds inositolhexakisphosphate (InsP6) (By similarity). Involved in IL8-mediated granule release in neutrophils.confidentP29066

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0031692 [MF]alpha-1B adrenergic receptor bindingprobableGO:0031690, GO:0003674, GO:0005488, GO:0005515, GO:0001664, GO:0005102
GO:0035641 [BP]locomotory exploration behaviorprobableGO:0007626, GO:0044708, GO:0050896, GO:0007610, GO:0035640, GO:0008150
GO:0001750 [CC]photoreceptor outer segmentprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042699 [BP]follicle-stimulating hormone signaling pathwayprobableGO:0048610, GO:0022602, GO:0061458, GO:0008585, GO:0023052, GO:0007165, GO:0007166, GO:0048608, GO:0007275, GO:0044699, GO:0051716, GO:0001541, GO:0008406, GO:0045137, GO:0050789, GO:0048511, GO:0048513, GO:0065007, GO:0007186, GO:0032502, GO:0032501, GO:0046545, GO:0048609, GO:0032504, GO:0009987, GO:0050794, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0007154, GO:0046660, GO:0000003, GO:0044700, GO:0007548, GO:0044702, GO:0044707, GO:0003006, GO:0050896, GO:0048856, GO:0044763, GO:0042698, GO:0048731
GO:0043149 [BP]stress fiber assemblyprobableGO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0051017, GO:0016043, GO:0044085, GO:0044763, GO:0030036, GO:0008150, GO:0071840
GO:0060765 [BP]regulation of androgen receptor signaling pathwayprobableGO:0033143, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0071889 [MF]14-3-3 protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0032715 [BP]negative regulation of interleukin-6 productionprobableGO:0051241, GO:0050789, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0032675, GO:0001818
GO:0005096 [MF]GTPase activator activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0008047, GO:0003674
GO:0007369 [BP]gastrulationprobableGO:0048598, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0004402 [MF]histone acetyltransferase activityprobableGO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674
GO:0051050 [BP]positive regulation of transportprobableGO:0051049, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0002168 [BP]instar larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002165, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0061099 [BP]negative regulation of protein tyrosine kinase activityprobableGO:0033673, GO:0051348, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0031324, GO:0031323, GO:0061097, GO:0006469, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0043549, GO:0031399, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0042326, GO:0008150, GO:0042325, GO:0032269, GO:0032268, GO:0050730, GO:0031400, GO:0050732, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0031762 [MF]follicle-stimulating hormone receptor bindingprobableGO:0001664, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0032717 [BP]negative regulation of interleukin-8 productionprobableGO:0051241, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0050789, GO:0001818, GO:0032677
GO:0004857 [MF]enzyme inhibitor activityprobableGO:0030234, GO:0003674
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0031397 [BP]negative regulation of protein ubiquitinationprobableGO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031400, GO:0031324, GO:0031323, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0031399, GO:0031396, GO:0009892, GO:0050789, GO:0048523
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0070374 [BP]positive regulation of ERK1 and ERK2 cascadeprobableGO:0023056, GO:0048584, GO:0010646, GO:0009966, GO:0009967, GO:0010740, GO:0048583, GO:0050794, GO:0043410, GO:0050789, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0070372, GO:0043408
GO:0031434 [MF]mitogen-activated protein kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0035612 [MF]AP-2 adaptor complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0035615 [MF]clathrin adaptor activityprobableGO:0030674, GO:0003674, GO:0005488, GO:0005515, GO:0030276, GO:0060090
GO:0031691 [MF]alpha-1A adrenergic receptor bindingprobableGO:0031690, GO:0003674, GO:0005488, GO:0005515, GO:0001664, GO:0005102
GO:0090240 [BP]positive regulation of histone H4 acetylationprobableGO:0033044, GO:0035065, GO:0035066, GO:0033043, GO:0031325, GO:0031323, GO:0051128, GO:0031056, GO:0031058, GO:0050789, GO:0009893, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0051130, GO:0060255, GO:0090239, GO:0080090, GO:0050794, GO:1901985, GO:0008150, GO:1901983, GO:0019222, GO:0032268, GO:0031401, GO:0010638, GO:2000756, GO:2000758, GO:2001252, GO:0048522
GO:0005159 [MF]insulin-like growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0001917 [CC]photoreceptor inner segmentprobableGO:0005575, GO:0044464, GO:0005623
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0043547 [BP]positive regulation of GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0043087, GO:0050789, GO:0043085, GO:0031329, GO:0051345, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0033121, GO:0033124, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0034391 [BP]regulation of smooth muscle cell apoptotic processprobableGO:0050794, GO:0043067, GO:0065007, GO:0010660, GO:0008150, GO:0010941, GO:0042981, GO:0050789
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031701 [MF]angiotensin receptor bindingprobableGO:0001664, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0002031 [BP]G-protein coupled receptor internalizationprobableGO:0048585, GO:0023051, GO:0048583, GO:0023057, GO:0008277, GO:0010648, GO:0022401, GO:0010646, GO:0050789, GO:0023058, GO:0009968, GO:0009966, GO:0071704, GO:0045744, GO:0065007, GO:0044699, GO:0048519, GO:0002029, GO:0009987, GO:0006810, GO:0044260, GO:0044765, GO:0008150, GO:0008152, GO:0051234, GO:0051179, GO:0050794, GO:0016192, GO:0006897, GO:0031623, GO:0006898, GO:0044237, GO:0043170, GO:0043112, GO:0048523
GO:0002032 [BP]desensitization of G-protein coupled receptor protein signaling pathway by arrestinprobableGO:0048585, GO:0022401, GO:0048583, GO:0051100, GO:0023057, GO:0008277, GO:0010648, GO:0023051, GO:0010646, GO:0050789, GO:0023058, GO:0032091, GO:0009968, GO:0009966, GO:0045744, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0002029, GO:0050794, GO:0043393, GO:0051098, GO:0008150, GO:0048523
GO:0042335 [BP]cuticle developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0035025 [BP]positive regulation of Rho protein signal transductionprobableGO:0051057, GO:0051056, GO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0046578, GO:0046579, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0035023, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0051219 [MF]phosphoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032947 [MF]protein complex scaffoldprobableGO:0003674, GO:0005488, GO:0005515, GO:0005198
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0019233 [BP]sensory perception of painprobableGO:0032501, GO:0044707, GO:0050877, GO:0007600, GO:0008150, GO:0044699, GO:0003008
GO:0002046 [MF]opsin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0034260 [BP]negative regulation of GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0043087, GO:0050789, GO:0043086, GO:0051346, GO:0030811, GO:0065007, GO:0044092, GO:0065009, GO:0033121, GO:0033124, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0031329, GO:0006140
GO:0031647 [BP]regulation of protein stabilityprobableGO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0031143 [CC]pseudopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0000187 [BP]activation of MAPK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G4M, chain A
Confidence level:very confident
Coverage over the Query: 6-148,251-312
View the alignment between query and template
View the model in PyMOL
Template: 3UGU, chain A
Confidence level:very confident
Coverage over the Query: 182-311
View the alignment between query and template
View the model in PyMOL