BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17268
         (293 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4B4T|Q Chain Q, Near-Atomic Resolution Structural Model Of The Yeast 26s
           Proteasome
          Length = 434

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 115 ESPTNI-ELGMFMVCAQLKDKTGDLISHSCRSAMLHYRSSLLITLKTLVQ 163
           E  T+I ELG   V    KDK  + I HS    M   +S  +  LKTL++
Sbjct: 53  EQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIE 102


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,058,924
Number of Sequences: 62578
Number of extensions: 300736
Number of successful extensions: 710
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 706
Number of HSP's gapped (non-prelim): 4
length of query: 293
length of database: 14,973,337
effective HSP length: 98
effective length of query: 195
effective length of database: 8,840,693
effective search space: 1723935135
effective search space used: 1723935135
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)