Diaphorina citri psyllid: psy17270

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43

SSLNFRILSFAFQVLHDHICYRYEILEVIGKGSFGQVIRALDHKTNTHALKYYGNQLTEFERTEIEKYLEIWYLGLDACKIHGEESLSQNGGFDDENGSYNKKRFHHQALIEVRILDHLRKKDADSSYNVIHMLEYFYFRNHLCISFELMNLNLYELIKRNNYQGFSLGLIRRFAFSLVQCLRLLHRENIIHCDLKPENVLLKQRGSSSIKVIDFGSSCYSHQRVYTYIQSRFYRSPEVILGLPYGPPIDMWSLGCILAELYTGCPLFPGENEVEQLACIMEILGCPPDEVINTASRRRLFFDSKGTPRCITNSKGRKRKPGSKDMASVLRCNDKAFVDFVTQCFNWDSKKRLTPDEALRHEWLKSSSSSSSSSSHHATDLRKSPSAHTNMYRLYRGVPTKPSAPADIDLNDSGTFLPPILFNIKLDKY

ccccccEEEEEcEEEccccccEEEEEEEccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEccEEEEccEEEEEEccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccCEEECccccccccccCEEEEEcccccccHHHcccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHcccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***NFRILSFAFQVLHDHICYRYEILEVIGKGSFGQVIRALDHKTNTHALKYYGNQLTEFERTEIEKYLEIWYLGLDACKIHGEESLSQNGGFDDENGSYNKKRFHHQALIEVRILDHLRKKDADSSYNVIHMLEYFYFRNHLCISFELMNLNLYELIKRNNYQGFSLGLIRRFAFSLVQCLRLLHRENIIHCDLKPENVLLKQRGSSSIKVIDFGSSCYSHQRVYTYIQSRFYRSPEVILGLPYGPPIDMWSLGCILAELYTGCPLFPGENEVEQLACIMEILGCPPDEVINTASRRRLFFDSKGT********************SVLRCNDKAFVDFVTQCFNWDSKKRLTPDEALRHEWLK*****************************************************P*LFNI*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dual specificity tyrosine-phosphorylation-regulated kinase 4	Possible non-essential role in spermiogenesis.	confident	Q9NR20
Dual specificity tyrosine-phosphorylation-regulated kinase 4	Possible non-essential role in spermiogenesis.	confident	Q8BI55
Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2	Required for oocyte-to-zygote transition in which it phosphorylates oocyte proteins, including mei-1, oma-1, oma-2, mex-5, and mex-6, modifying their activity and/or stability following meiosis. Functions in both spindle positioning and in the posterior localization of cytoplasmic determinants, including pie-1, pos-1, and pgl-1, in early embryos.	confident	Q9XTF3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0004713 [MF]	protein tyrosine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0018107 [BP]	peptidyl-threonine phosphorylation	probable	GO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0007166 [BP]	cell surface receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0035839 [CC]	non-growing cell tip	probable	GO:0051286, GO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0005826 [CC]	actomyosin contractile ring	probable	GO:0015629, GO:0043229, GO:0043228, GO:0070938, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0005938, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0071944, GO:0044448, GO:0044424, GO:0044422
GO:0051247 [BP]	positive regulation of protein metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0080090, GO:0010604
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0022414 [BP]	reproductive process	probable	GO:0008150, GO:0000003
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048610 [BP]	cellular process involved in reproduction	probable	GO:0009987, GO:0008150, GO:0000003
GO:0044732 [CC]	mitotic spindle pole body	probable	GO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0005694 [CC]	chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0042771 [BP]	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	probable	GO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0007569, GO:0072331, GO:0035556, GO:0044699, GO:0072332, GO:0051716, GO:0050789, GO:0065007, GO:0010259, GO:0009987, GO:0006915, GO:0050794, GO:0006974, GO:0012501, GO:0006950, GO:0044763, GO:0007154, GO:0044700, GO:0008630, GO:0050896, GO:0033554, GO:0008150
GO:0016605 [CC]	PML body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0051534 [BP]	negative regulation of NFAT protein import into nucleus	probable	GO:0033157, GO:0060341, GO:0051049, GO:0032386, GO:0032387, GO:0051223, GO:0051224, GO:0050789, GO:0032880, GO:0065007, GO:0048519, GO:0070201, GO:0051051, GO:0090317, GO:0050794, GO:0008150, GO:0042308, GO:0042306, GO:0032879, GO:0042992, GO:0042990, GO:1900180, GO:0051532, GO:0046822, GO:0046823
GO:0042048 [BP]	olfactory behavior	probable	GO:0007635, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0042221
GO:0043186 [CC]	P granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0000151 [CC]	ubiquitin ligase complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009966 [BP]	regulation of signal transduction	probable	GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0065009 [BP]	regulation of molecular function	probable	GO:0008150, GO:0065007
GO:0032268 [BP]	regulation of cellular protein metabolic process	probable	GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0051094 [BP]	positive regulation of developmental process	probable	GO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030427 [CC]	site of polarized growth	probable	GO:0005575, GO:0044464, GO:0005623
GO:0030218 [BP]	erythrocyte differentiation	probable	GO:0030154, GO:0042592, GO:0007275, GO:0044699, GO:0048869, GO:0002262, GO:0008150, GO:0048513, GO:0065007, GO:0048534, GO:0065008, GO:0032502, GO:0034101, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0030097, GO:0002520, GO:0048872, GO:0044707, GO:0048856, GO:0002376, GO:0030099, GO:0048731
GO:0030145 [MF]	manganese ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0051285 [CC]	cell cortex of cell tip	probable	GO:0005737, GO:0060187, GO:0051286, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0019953 [BP]	sexual reproduction	probable	GO:0008150, GO:0000003
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0045725 [BP]	positive regulation of glycogen biosynthetic process	probable	GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0010906, GO:0010907, GO:0032885, GO:0050789, GO:0010962, GO:0080090, GO:0043255, GO:0010604, GO:0043467, GO:0031328, GO:2000112, GO:0065007, GO:0032881, GO:0045913, GO:0060255, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0010675, GO:0010676, GO:0070873, GO:0070875, GO:0005979, GO:0010557, GO:0010556, GO:0006109, GO:0048522
GO:0022603 [BP]	regulation of anatomical structure morphogenesis	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0051641 [BP]	cellular localization	probable	GO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0003712 [MF]	transcription cofactor activity	probable	GO:0003674, GO:0000989, GO:0000988
GO:0043130 [MF]	ubiquitin binding	probable	GO:0003674, GO:0032182, GO:0005488, GO:0005515
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KVW, chain A
Confidence level:very confident
Coverage over the Query: 14-57,104-365
View the alignment between query and template
View the model in PyMOL

Template: 2ZV2, chain A
Confidence level:very confident
Coverage over the Query: 18-56,107-288,329-365
View the alignment between query and template
View the model in PyMOL

Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 22-51,70-77,103-296,335-390
View the alignment between query and template
View the model in PyMOL