Diaphorina citri psyllid: psy1729


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MDIESEKMISTTKLLVTKLLGNEWSKLSLPEKKVYLDRAEVDKKRYREELKVTKLLGNEWSKLSLPEKKVYLDRAEVDKKRYREELKVYRKSDAYQSYLRRKRVKSLQANGTEESDIATDATDEIDEEEEDNEELYCRVCDQWFTTLHNKREHLNGRQHFQRFDRRNCNC
cccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
**********TTKLLVTKLLGNEWSKLSLPEKKVYLDRAEVDKKRYREELKVTKLLGNEWSKLSLPEKKVYLDRAEVDKKRYREELKVYRK**AY*******************************************VCDQWFT*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIESEKMISTTKLLVTKLLGNEWSKLSLPEKKVYxxxxxxxxxxxxxxxxxxxxxGNEWSKLSLPEKKVYxxxxxxxxxxxxxxxxxxxxxDAYQSYLRRKRVKSLQANGTEESDIxxxxxxxxxxxxxxxxxxxxxVCDQWFTTLHNKREHLNGRQHFQRFDRRNCNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TQ6, chain A
Confidence level:very confident
Coverage over the Query: 4-93
View the alignment between query and template
View the model in PyMOL
Template: 1ZR9, chain A
Confidence level:probable
Coverage over the Query: 124-164
View the alignment between query and template
View the model in PyMOL