Query         psy17334
Match_columns 188
No_of_seqs    202 out of 1669
Neff          7.9 
Searched_HMMs 46136
Date          Fri Aug 16 19:37:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17334.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17334hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4219|consensus               99.5 2.1E-14 4.4E-19  122.6   4.1   86   49-136    27-112 (423)
  2 KOG4220|consensus               99.3   1E-12 2.3E-17  112.6   1.6   75   58-134    31-105 (503)
  3 PHA03234 DNA packaging protein  99.2 1.2E-12 2.7E-17  111.7   0.3   77   56-136    31-109 (338)
  4 PHA02834 chemokine receptor-li  98.9 2.5E-10 5.3E-15   96.7   1.4   76   56-136    27-102 (323)
  5 PHA02638 CC chemokine receptor  98.9 5.1E-10 1.1E-14   98.2   0.6   76   56-136    97-172 (417)
  6 PHA03235 DNA packaging protein  98.8 1.8E-09 3.8E-14   94.6   2.2   77   56-136    31-109 (409)
  7 PHA03087 G protein-coupled che  98.8 7.1E-09 1.5E-13   87.7   5.2   76   56-135    39-114 (335)
  8 PF00001 7tm_1:  7 transmembran  98.2 5.5E-08 1.2E-12   76.9  -4.8   61   74-136     1-61  (257)
  9 PF10320 7TM_GPCR_Srsx:  Serpen  97.5 9.3E-06   2E-10   66.8  -1.9   47   69-115     2-48  (257)
 10 KOG2087|consensus               96.4  0.0022 4.8E-08   54.9   2.8   59   59-117    26-84  (363)
 11 PF10324 7TM_GPCR_Srw:  Serpent  93.8   0.015 3.2E-07   48.8  -0.4   48   67-115     6-54  (318)
 12 PF11710 Git3:  G protein-coupl  93.0   0.015 3.2E-07   46.3  -1.7   49   86-136    30-78  (201)
 13 PF05462 Dicty_CAR:  Slime mold  92.6    0.04 8.7E-07   46.6   0.4   52   59-110     8-59  (303)
 14 PF05296 TAS2R:  Mammalian tast  92.1    0.11 2.4E-06   43.8   2.5   55   56-110     5-62  (303)
 15 PF10328 7TM_GPCR_Srx:  Serpent  91.7    0.05 1.1E-06   44.8  -0.1   44   67-110     3-46  (274)
 16 PF10317 7TM_GPCR_Srd:  Serpent  87.8   0.094   2E-06   43.8  -1.4   49   63-111     4-53  (292)
 17 KOG2927|consensus               85.0    0.25 5.4E-06   42.4  -0.3   18  113-130   243-262 (372)
 18 PF03344 Daxx:  Daxx Family;  I  84.0    0.32   7E-06   45.8   0.0   10   91-100   344-353 (713)
 19 PF10321 7TM_GPCR_Srt:  Serpent  82.6    0.79 1.7E-05   39.0   1.8   54   56-109    31-84  (313)
 20 PF04931 DNA_pol_phi:  DNA poly  78.5    0.15 3.2E-06   48.6  -4.4   12  101-112   590-601 (784)
 21 KOG1832|consensus               73.1    0.62 1.3E-05   44.8  -1.7    6  131-136  1391-1396(1516)
 22 PF00002 7tm_2:  7 transmembran  71.8     2.6 5.6E-05   33.7   1.8   47   63-109     6-52  (242)
 23 PF14851 FAM176:  FAM176 family  67.2     1.1 2.3E-05   34.2  -1.2   30   72-102     4-33  (153)
 24 PF09882 DUF2109:  Predicted me  64.8     1.8   4E-05   29.0  -0.3   45   70-114     6-50  (78)
 25 PF01102 Glycophorin_A:  Glycop  64.7     1.7 3.6E-05   31.9  -0.6    9   79-87     85-93  (122)
 26 KOG4156|consensus               60.8     2.8 6.1E-05   39.1   0.0    6  110-115   572-577 (1329)
 27 PF10327 7TM_GPCR_Sri:  Serpent  59.8      16 0.00035   30.7   4.4   57   58-114     9-69  (303)
 28 PF02532 PsbI:  Photosystem II   58.5      14 0.00029   21.0   2.5   18   58-75      9-26  (36)
 29 KOG1834|consensus               57.8     1.2 2.6E-05   41.4  -2.8    7  101-107   872-878 (952)
 30 PF08229 SHR3_chaperone:  ER me  56.5      13 0.00027   29.6   3.0   14   96-109   130-143 (196)
 31 KOG1189|consensus               53.4     2.3 5.1E-05   40.2  -1.7    6  122-127   865-870 (960)
 32 PF03839 Sec62:  Translocation   53.1     5.2 0.00011   32.5   0.3   10  122-131   175-184 (224)
 33 PF03402 V1R:  Vomeronasal orga  52.9     6.2 0.00013   32.8   0.8   45   87-135     6-51  (265)
 34 CHL00024 psbI photosystem II p  52.6      11 0.00023   21.5   1.4   18   58-75      9-26  (36)
 35 PRK02655 psbI photosystem II r  49.9      12 0.00026   21.4   1.4   18   58-75      9-26  (38)
 36 PF12606 RELT:  Tumour necrosis  47.0     5.5 0.00012   24.5  -0.3    6   68-73     11-16  (50)
 37 PF11446 DUF2897:  Protein of u  42.6      13 0.00027   23.4   0.9    8   72-79     16-23  (55)
 38 PF10856 DUF2678:  Protein of u  42.3      97  0.0021   22.5   5.4   16   56-71     30-45  (118)
 39 PF10873 DUF2668:  Protein of u  42.2     4.4 9.6E-05   30.5  -1.5   34   58-91     62-95  (155)
 40 TIGR01477 RIFIN variant surfac  41.9     7.1 0.00015   33.8  -0.5   29   61-89    311-339 (353)
 41 PF02009 Rifin_STEVOR:  Rifin/s  41.9     5.8 0.00013   33.6  -1.0   27   62-88    258-284 (299)
 42 PTZ00046 rifin; Provisional     39.4     8.3 0.00018   33.4  -0.5   28   62-89    317-344 (358)
 43 TIGR00869 sec62 protein transl  39.0      12 0.00025   30.6   0.4   17  115-131   174-190 (232)
 44 PF11861 DUF3381:  Domain of un  37.7      30 0.00066   26.4   2.5    7  101-107    69-75  (159)
 45 PF07423 DUF1510:  Protein of u  36.2      12 0.00026   30.2   0.0    9   94-102    13-21  (217)
 46 PF12191 stn_TNFRSF12A:  Tumour  35.6      21 0.00045   26.3   1.2   13   62-74     84-96  (129)
 47 PF15039 DUF4530:  Domain of un  35.3      13 0.00028   26.1   0.0    6   70-75     55-60  (111)
 48 PF06024 DUF912:  Nucleopolyhed  33.9 1.6E+02  0.0036   20.5   5.7   30   59-89     64-93  (101)
 49 PF10319 7TM_GPCR_Srj:  Serpent  33.2      96  0.0021   26.5   5.0   56   60-115     7-65  (310)
 50 PF05808 Podoplanin:  Podoplani  33.0      14 0.00031   28.3   0.0   21   57-77    129-149 (162)
 51 COG5137 Histone chaperone invo  32.2      15 0.00033   29.7   0.0   18   12-29     33-50  (279)
 52 PRK13183 psbN photosystem II r  31.2      70  0.0015   19.3   2.7   33   59-91      8-40  (46)
 53 CHL00020 psbN photosystem II p  30.9      67  0.0014   19.1   2.6   33   59-91      5-37  (43)
 54 PF15330 SIT:  SHP2-interacting  30.9      20 0.00044   25.6   0.5   29   59-87      2-30  (107)
 55 PF04712 Radial_spoke:  Radial   30.7      16 0.00036   33.0  -0.0   11  127-137   344-354 (491)
 56 PF02724 CDC45:  CDC45-like pro  30.0     3.8 8.2E-05   38.2  -4.3   37   93-129    54-91  (622)
 57 PF02724 CDC45:  CDC45-like pro  28.9     3.8 8.3E-05   38.1  -4.5   10   77-86     76-85  (622)
 58 COG5137 Histone chaperone invo  28.1      24 0.00052   28.6   0.5   10   77-86     93-102 (279)
 59 PHA03055 Hypothetical protein;  27.9 1.2E+02  0.0025   20.5   3.7   51   66-116    16-66  (79)
 60 CHL00204 ycf1 Ycf1; Provisiona  27.0      67  0.0015   33.7   3.4   12   78-89    184-195 (1832)
 61 PF14654 Epiglycanin_C:  Mucin,  26.7      90   0.002   22.0   3.1   22   56-77     18-39  (106)
 62 PF01299 Lamp:  Lysosome-associ  25.8      61  0.0013   27.2   2.6   12   77-88    289-300 (306)
 63 KOG4564|consensus               25.7      36 0.00078   30.7   1.2   50   62-111   149-198 (473)
 64 PF02468 PsbN:  Photosystem II   25.1      76  0.0016   18.9   2.1   16   60-75      6-21  (43)
 65 PF06679 DUF1180:  Protein of u  24.7 1.5E+02  0.0033   22.8   4.3    8   62-69     97-104 (163)
 66 PHA03099 epidermal growth fact  23.3      74  0.0016   23.6   2.3   28   60-87    103-130 (139)
 67 PRK14762 membrane protein; Pro  22.9      94   0.002   16.2   1.9    7   65-71      9-15  (27)
 68 KOG1172|consensus               22.7 1.3E+02  0.0029   29.2   4.4   43   74-116   648-692 (876)
 69 PF08229 SHR3_chaperone:  ER me  21.8      71  0.0015   25.4   2.1   12   64-75     65-76  (196)
 70 PF10329 DUF2417:  Region of un  21.7      46 0.00099   27.2   1.0   37   73-109    85-121 (232)
 71 PF10316 7TM_GPCR_Srbc:  Serpen  20.9      50  0.0011   27.5   1.1   53   60-112     8-60  (273)
 72 PHA03062 putative IMV membrane  20.8 1.6E+02  0.0035   19.8   3.3   51   66-116    17-67  (78)
 73 PF04713 Pox_I5:  Poxvirus prot  20.7 1.8E+02  0.0039   19.5   3.5   49   68-116    18-66  (77)
 74 PHA03283 envelope glycoprotein  20.3 1.1E+02  0.0023   28.1   3.1   36   57-92    397-432 (542)
 75 PF07423 DUF1510:  Protein of u  20.2      13 0.00029   30.0  -2.4   15   86-100    10-24  (217)
 76 PF15050 SCIMP:  SCIMP protein   20.2      21 0.00047   26.1  -1.0    8   77-84     25-32  (133)
 77 PF05961 Chordopox_A13L:  Chord  20.1      46 0.00099   21.8   0.6   18   68-87     10-27  (68)

No 1  
>KOG4219|consensus
Probab=99.48  E-value=2.1e-14  Score=122.64  Aligned_cols=86  Identities=26%  Similarity=0.402  Sum_probs=77.1

Q ss_pred             CCCCCccchhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCccccc
Q psy17334         49 GPQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMG  128 (188)
Q Consensus        49 ~~~~~~~~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg  128 (188)
                      ....|.+.+.++.++|+++++++++||++|||++..+|++|+.+|+|++|||+||+++++++.++...+.  ....|.||
T Consensus        27 ~f~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~ya--l~~~W~~G  104 (423)
T KOG4219|consen   27 LFVLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYA--LHQEWYFG  104 (423)
T ss_pred             cccCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHH--HHhccccc
Confidence            3456677888899999999999999999999999999999999999999999999999999999877644  44889999


Q ss_pred             cccccccc
Q psy17334        129 EHISNTQE  136 (188)
Q Consensus       129 ~~~Cki~~  136 (188)
                      .++|++..
T Consensus       105 ~f~C~f~n  112 (423)
T KOG4219|consen  105 SFYCRFVN  112 (423)
T ss_pred             cceeeecc
Confidence            99999864


No 2  
>KOG4220|consensus
Probab=99.27  E-value=1e-12  Score=112.59  Aligned_cols=75  Identities=19%  Similarity=0.306  Sum_probs=68.0

Q ss_pred             hhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCccccccccccc
Q psy17334         58 TPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNT  134 (188)
Q Consensus        58 ~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Cki  134 (188)
                      ++++++..++.++.++||++|++.+...|+|++..|||+++||+|||+++.+.+|++.++.+.  ++|++|..+|.+
T Consensus        31 v~i~~v~~~lsLVTv~GNlLVmiSfKvnrqLqTVnNYfLfSLAcADliIG~~SMnl~t~Y~lm--g~W~LG~~~Cdl  105 (503)
T KOG4220|consen   31 VFIVVVTGSLSLVTVVGNLLVMISFKVNRQLQTVNNYFLFSLACADLIIGAFSMNLYTTYTLM--GYWPLGPLVCDL  105 (503)
T ss_pred             EeeehhhhHHHHHhhhccEEEEEEEEecceeeeecceeehHHHHhhhhhheeechHHHHHHHH--cccccchHHHHH
Confidence            346677788899999999999999999999999999999999999999999999999886544  899999999975


No 3  
>PHA03234 DNA packaging protein UL33; Provisional
Probab=99.24  E-value=1.2e-12  Score=111.65  Aligned_cols=77  Identities=14%  Similarity=0.261  Sum_probs=62.9

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEe--eecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccccc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVI--LKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISN  133 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i--~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Ck  133 (188)
                      .+.++.++|.+++++|++||++|++++  .+++++|+++|+|++|||++|++++++ +|+.++.   ....|+||..+||
T Consensus        31 ~~~~~~~~y~~vf~~gl~gN~lvl~v~~~~~~~~~rt~tn~fi~NLAvaDLL~~l~-lp~~~~~---~~~~w~fG~~lCk  106 (338)
T PHA03234         31 AQILESAINGIMLTLIIPMIIIVICTLIIYHKVAKHNATSFYLITLFASDFLHMLC-VFFLTLN---REALFNFNQAFCQ  106 (338)
T ss_pred             HHHHhhHHHHHHHHHHhhhHHHHHHHHHHHhccccccHHHHHHHHHHHHHHHHHHH-HHHHHHH---HhCCccCchhHHH
Confidence            567788999999999999999999854  455677899999999999999999875 5554432   2357999999999


Q ss_pred             ccc
Q psy17334        134 TQE  136 (188)
Q Consensus       134 i~~  136 (188)
                      +..
T Consensus       107 ~~~  109 (338)
T PHA03234        107 CVL  109 (338)
T ss_pred             HHH
Confidence            853


No 4  
>PHA02834 chemokine receptor-like protein; Provisional
Probab=98.94  E-value=2.5e-10  Score=96.66  Aligned_cols=76  Identities=21%  Similarity=0.500  Sum_probs=61.3

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccccccc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNTQ  135 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Cki~  135 (188)
                      .+.++.+++.+++++|++||+++++++.+++++ +++|+|++|||++|++. ++++|+.+...   ...|.+|...|++.
T Consensus        27 ~~~~~~~~~~li~v~~~~gN~lVi~vi~~~~~~-~~~n~~i~nLAiaDll~-~~~lP~~i~~~---~~~w~~g~~~C~~~  101 (323)
T PHA02834         27 VNYFVIVFYILLFIFGLIGNVLVIAVLIVKRFM-FVVDVYLFNIAMSDLML-VFSFPFIIHND---LNEWIFGEFMCKLV  101 (323)
T ss_pred             hhhhHHHHHHHHHHHHHhhHHHHHHHHHhcccc-chhhhhhHHHHHHHHHH-HHHHHHHHHHH---cCCcCCcchHHHhH
Confidence            455788999999999999999999888776654 56899999999999986 55688765422   24699999999975


Q ss_pred             c
Q psy17334        136 E  136 (188)
Q Consensus       136 ~  136 (188)
                      .
T Consensus       102 ~  102 (323)
T PHA02834        102 L  102 (323)
T ss_pred             H
Confidence            3


No 5  
>PHA02638 CC chemokine receptor-like protein; Provisional
Probab=98.86  E-value=5.1e-10  Score=98.17  Aligned_cols=76  Identities=22%  Similarity=0.536  Sum_probs=62.3

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccccccc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNTQ  135 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Cki~  135 (188)
                      ...++.+++.+++++|++||+++++++. +|++|++++++++|||++|++.++ .+|+.+...   .+.|.||...|++.
T Consensus        97 ~~~~l~~~y~lvfvlgliGN~LVl~il~-~k~lrt~t~i~llnLAisDLl~~l-~lPf~i~~~---~~~W~fg~~~Ck~~  171 (417)
T PHA02638         97 ISEYIKIFYIIIFILGLFGNAAIIMILF-CKKIKTITDIYIFNLAISDLIFVI-DFPFIIYNE---FDQWIFGDFMCKVI  171 (417)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHH-hccCCCHhHHHHHHHHHHHHHHHH-HHHHHHHHH---hccccccccchhhH
Confidence            4456778899999999999999997665 488899999999999999998754 588776422   36799999999985


Q ss_pred             c
Q psy17334        136 E  136 (188)
Q Consensus       136 ~  136 (188)
                      .
T Consensus       172 ~  172 (417)
T PHA02638        172 S  172 (417)
T ss_pred             H
Confidence            3


No 6  
>PHA03235 DNA packaging protein UL33; Provisional
Probab=98.81  E-value=1.8e-09  Score=94.59  Aligned_cols=77  Identities=17%  Similarity=0.236  Sum_probs=56.9

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEeee-cCc-CCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccccc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVILK-SKD-MRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISN  133 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i~~-~~~-l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Ck  133 (188)
                      .+.+..+++.+++++|++||++|++++.+ +|+ .++..++|++|||++|++. ++++|+.+.   .....|.+|...|+
T Consensus        31 ~~~~~~~~~~li~vvGiigN~lVL~~~~~~~r~~~~~~~~~~I~NLAvsDLl~-l~~lP~~i~---~~~~~~~~g~~~Ck  106 (409)
T PHA03235         31 ARTTETFINLLIISVGGPLNLIVLVTQLLANRVHGFSTPTLYMTNLYLANLLT-VFVLPFIML---SNQGLLSGSVAGCK  106 (409)
T ss_pred             hHhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCccHHHHHHHHHHHHHH-HHHHHHHHH---hcCccccCCCCeeh
Confidence            56688899999999999999999987543 332 2356689999999999986 456887653   12233445678999


Q ss_pred             ccc
Q psy17334        134 TQE  136 (188)
Q Consensus       134 i~~  136 (188)
                      +..
T Consensus       107 ~~~  109 (409)
T PHA03235        107 FAS  109 (409)
T ss_pred             hHH
Confidence            853


No 7  
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional
Probab=98.78  E-value=7.1e-09  Score=87.66  Aligned_cols=76  Identities=28%  Similarity=0.514  Sum_probs=63.1

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccccccc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNTQ  135 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Cki~  135 (188)
                      .+.+..+++.+++++|++||+++++++.++ ++|++.++|+.|||++|++.++. .|..+.  ......|.+|...|++.
T Consensus        39 ~~~~~~~~~~~i~~~gl~gN~lvl~~~~~~-~~~~~~~~ll~~laisDll~~~~-~~~~~~--~~~~~~~~~~~~~C~~~  114 (335)
T PHA03087         39 NSTILIVVYSTIFFFGLVGNIIVIYVLTKT-KIKTPMDIYLLNLAVSDLLFVMT-LPFQIY--YYILFQWSFGEFACKIV  114 (335)
T ss_pred             hhhHHHHHHHHHHHHHHHhhHhEEeeehhc-cccCchHHHHHHHHHHHHHHHHh-HHHHHH--HHhCCCCCCCcHHHHHH
Confidence            455788888999999999999999998887 88999999999999999987764 665542  33447899999999864


No 8  
>PF00001 7tm_1:  7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature;  InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The rhodopsin-like GPCRs themselves represent a widespread protein family that includes hormone, neurotransmitter and light receptors, all of which transduce extracellular signals through interaction with guanine nucleotide-binding (G) proteins. Although their activating ligands vary widely in structure and character, the amino acid sequences of the receptors are very similar and are believed to adopt a common structural framework comprising 7 transmembrane (TM) helices [, , ].; GO: 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane; PDB: 2KI9_A 3QAK_A 2YDV_A 3VGA_A 3PWH_A 3RFM_A 3EML_A 3VG9_A 3REY_A 3UZA_A ....
Probab=98.17  E-value=5.5e-08  Score=76.86  Aligned_cols=61  Identities=38%  Similarity=0.659  Sum_probs=51.9

Q ss_pred             cccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCccccccccccccc
Q psy17334         74 GNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNTQE  136 (188)
Q Consensus        74 GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Cki~~  136 (188)
                      ||+++++++.++|++|++.++|++|||++|++.++...|..+.....  ..|.++...|++..
T Consensus         1 GN~lvi~~~~~~~~~~~~~~~~l~~Lav~Dll~~~~~~~~~~~~~~~--~~~~~~~~~C~~~~   61 (257)
T PF00001_consen    1 GNILVILVILRSKRLRTPSNILLLNLAVADLLVGLFCIPFYIYSLLF--DDWIFSSFLCRIFG   61 (257)
T ss_dssp             HHHHHHHHHHHSGGG-SHHHHHHHHHHHHHHHHHHTHHHHHHHHHHH--SSCTSHHHHHHHHH
T ss_pred             CchhehhhhhhhccCCChhHHHHHHHHHHHHhhcccccccccccccc--cccccccccccccc
Confidence            89999999999999999999999999999999999888876654332  68999999998753


No 9  
>PF10320 7TM_GPCR_Srsx:  Serpentine type 7TM GPCR chemoreceptor Srsx;  InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class sx (Srsx), which is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=97.53  E-value=9.3e-06  Score=66.80  Aligned_cols=47  Identities=34%  Similarity=0.618  Sum_probs=43.2

Q ss_pred             HHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceee
Q psy17334         69 CIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVL  115 (188)
Q Consensus        69 l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i  115 (188)
                      ++|++||+++++++.++|++|+|+++++..+|++|++.++..+|...
T Consensus         2 ~ig~~gN~~~i~~~~~~~~Lrs~~~~li~~~~~~d~~~~~~~~~~~~   48 (257)
T PF10320_consen    2 IIGLFGNLLLIILIFRNKSLRSPCYILICILCFADLICLLGTLPFML   48 (257)
T ss_pred             EEEEEccHHHHHHHHhccccccchHHHHHHHHHHHHHHHhhHHHHHH
Confidence            57999999999999999999999999999999999999887777665


No 10 
>KOG2087|consensus
Probab=96.44  E-value=0.0022  Score=54.94  Aligned_cols=59  Identities=22%  Similarity=0.280  Sum_probs=47.2

Q ss_pred             hHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEE
Q psy17334         59 PSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVE  117 (188)
Q Consensus        59 ~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~  117 (188)
                      ++-+..-++.+++++||++|++.+...+...+...+++.|||++|+++++....+..++
T Consensus        26 ~lRi~vW~i~~lAi~gN~~Vl~~~~~~~~~~~~~~~li~~la~ad~~mGiYl~~ia~vD   84 (363)
T KOG2087|consen   26 ILRISVWVIALLAIVGNLLVLLTRFTSRYELNSHRFLICNLAFADLLMGIYLGLIASVD   84 (363)
T ss_pred             eeeehhhhhhhHHhccCeeeeeeeeehhhhccchHHHHHHHHHHHHHcchHHHHHHHhh
Confidence            34455566778899999999999888888788899999999999999988755554443


No 11 
>PF10324 7TM_GPCR_Srw:  Serpentine type 7TM GPCR chemoreceptor Srw;  InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz []. 
Probab=93.82  E-value=0.015  Score=48.79  Aligned_cols=48  Identities=33%  Similarity=0.475  Sum_probs=38.9

Q ss_pred             HHHHHhhcccceeeEeeecCcCCC-cchhHhHHhHHHHHhhhhhccceee
Q psy17334         67 ILCIGVLGNIMVPCVILKSKDMRN-STNIFLMNLSIADLMVLLVCTPTVL  115 (188)
Q Consensus        67 i~l~gl~GN~lvi~~i~~~~~l~~-~~~~fi~nLa~aDLl~~l~~~P~~i  115 (188)
                      +.++|+++|++.++++.| |.+|+ ++|.+++.+|++|++..+..++..+
T Consensus         6 ~~~~g~~~N~~h~~VLtr-k~mR~~~in~~l~~Iai~Dl~~~~~~~~~~~   54 (318)
T PF10324_consen    6 LSIFGLFINIFHLIVLTR-KSMRSSSINILLIGIAICDLLYMLSILIWEL   54 (318)
T ss_pred             EeHHHHHHHHHHhhhcCC-hhhhcCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            457899999888887765 55564 8999999999999999887766554


No 12 
>PF11710 Git3:  G protein-coupled glucose receptor regulating Gpa2;  InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This is the conserved N-terminal domain of the member proteins. 
Probab=92.97  E-value=0.015  Score=46.33  Aligned_cols=49  Identities=14%  Similarity=0.100  Sum_probs=32.7

Q ss_pred             CcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCccccccccccccc
Q psy17334         86 KDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNTQE  136 (188)
Q Consensus        86 ~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~Cki~~  136 (188)
                      ++++...+.+++||.++|++.++..+...+..+  ..+.-.-+...|.+++
T Consensus        30 ~r~~~fR~~LIl~L~~aD~~qal~~~i~~~~~l--~~~~i~~~s~~C~aqG   78 (201)
T PF11710_consen   30 YRRRSFRHQLILNLLLADFIQALAFLISPIRWL--ARGGIIAPSPFCQAQG   78 (201)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH--hcCCeeCCCCchhhhH
Confidence            455667788999999999999987554222211  2233445667888865


No 13 
>PF05462 Dicty_CAR:  Slime mold cyclic AMP receptor
Probab=92.57  E-value=0.04  Score=46.60  Aligned_cols=52  Identities=19%  Similarity=0.296  Sum_probs=43.6

Q ss_pred             hHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhc
Q psy17334         59 PSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVC  110 (188)
Q Consensus        59 ~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~  110 (188)
                      .+.++..+..+++++|-++++..+++.|++|++.+-++.-++++|++..+..
T Consensus         8 ~~~~i~~~~s~lSllGclfiI~tf~~~k~~r~~~~rli~yl~~~~ll~~v~~   59 (303)
T PF05462_consen    8 TLYAIELVASVLSLLGCLFIIITFCLFKRLRKPINRLIFYLSIANLLTNVAS   59 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCccHHHHHHHHHHHHHHHHHHH
Confidence            4556666778888999999999999999999999999999999999866543


No 14 
>PF05296 TAS2R:  Mammalian taste receptor protein (TAS2R);  InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs). TAS2Rs are G protein-coupled receptors expressed in subsets of taste receptor cells of the tongue and palate epithelia and are organised in the genome in clusters. The proteins are genetically linked to loci that influence bitter perception in mice and humans [].; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0050909 sensory perception of taste, 0016021 integral to membrane
Probab=92.06  E-value=0.11  Score=43.76  Aligned_cols=55  Identities=18%  Similarity=0.299  Sum_probs=41.6

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEee---ecCcCCCcchhHhHHhHHHHHhhhhhc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVIL---KSKDMRNSTNIFLMNLSIADLMVLLVC  110 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i~---~~~~l~~~~~~fi~nLa~aDLl~~l~~  110 (188)
                      ...+..++.++.+++|++||+.++.+..   ++++.-.|.+..+.+||++.++.....
T Consensus         5 ~~~i~~~i~~~~~~~Gi~~N~FI~~vn~~~w~k~~~l~~~d~IL~~La~sr~~l~~~~   62 (303)
T PF05296_consen    5 LEIIFLIILVVEFIIGILGNGFIVLVNCSDWVKSRKLSPSDQILTSLAISRILLQWVI   62 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHcCCCCChHHHHHHHHHHHHHHHHHHH
Confidence            4556778888889999999999876654   223334588999999999988766543


No 15 
>PF10328 7TM_GPCR_Srx:  Serpentine type 7TM GPCR chemoreceptor Srx;  InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class x (Srx) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=91.69  E-value=0.05  Score=44.83  Aligned_cols=44  Identities=34%  Similarity=0.514  Sum_probs=39.5

Q ss_pred             HHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhc
Q psy17334         67 ILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVC  110 (188)
Q Consensus        67 i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~  110 (188)
                      +.++|++.|.++++.+.+.+++|++.+++-.+.|++|.+.+++.
T Consensus         3 ~s~~G~~~N~~v~~~~~~~~~~~~sF~~l~~~~a~~n~i~~~~~   46 (274)
T PF10328_consen    3 ISIIGIILNWLVFIIIFKLKSLRNSFGILCASQAIANIIICLIF   46 (274)
T ss_pred             eeHHHHHHHHHHHHHHHhcccccCCHHHHHHHHHHHHHHHHHHH
Confidence            45789999999999999999999999999999999999988753


No 16 
>PF10317 7TM_GPCR_Srd:  Serpentine type 7TM GPCR chemoreceptor Srd;  InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents the chemoreceptor Srd []. 
Probab=87.84  E-value=0.094  Score=43.75  Aligned_cols=49  Identities=22%  Similarity=0.404  Sum_probs=37.6

Q ss_pred             HHHHHHHHHhhcccceeeEeeec-CcCCCcchhHhHHhHHHHHhhhhhcc
Q psy17334         63 LCSIILCIGVLGNIMVPCVILKS-KDMRNSTNIFLMNLSIADLMVLLVCT  111 (188)
Q Consensus        63 ~~~~i~l~gl~GN~lvi~~i~~~-~~l~~~~~~fi~nLa~aDLl~~l~~~  111 (188)
                      ++.+++.+|++.|+++++++.++ ++.-+...+++.|-|+.|++.++...
T Consensus         4 ~~~~~~~~~~~~n~~Ll~~i~~~tp~~l~~~~~~l~~~~~~~~~~~~~~~   53 (292)
T PF10317_consen    4 YHPIFFILGIILNILLLYLIIFKTPKSLRTYSILLLNTAIFDLISIISAF   53 (292)
T ss_pred             eHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45677889999999999887655 33334568999999999999876543


No 17 
>KOG2927|consensus
Probab=84.96  E-value=0.25  Score=42.39  Aligned_cols=18  Identities=6%  Similarity=0.021  Sum_probs=10.3

Q ss_pred             eeeEEeccC--CCccccccc
Q psy17334        113 TVLVEVNSK--PETWQMGEH  130 (188)
Q Consensus       113 ~~i~~~~~~--~~~W~fg~~  130 (188)
                      +.++++++.  .+-|.|.+.
T Consensus       243 F~I~~il~~g~~g~W~FPNL  262 (372)
T KOG2927|consen  243 FGITWILTGGKHGFWLFPNL  262 (372)
T ss_pred             HHHHHHHhCCCCceEeccch
Confidence            333434445  578887765


No 18 
>PF03344 Daxx:  Daxx Family;  InterPro: IPR005012  Daxx is a ubiquitously expressed protein that functions, in part, as a transcriptional co-repressor through its interaction with a growing number of nuclear, DNA-associated proteins. Human Daxx contains four structural domains commonly found in transcriptional regulatory proteins: two predicted paired amphipathic helices, an acid-rich domain and a Ser/Pro/Thr (SPT)-rich domain. The post-translational modification status of the SPT-domain of hDaxx regulates its association with transcription factors such as Pax3 and ETS-1, effectively bringing hDaxx to sites of active transcription. Through its presence at the site of active transcription, hDaxx could then be able to associate with acetylated histones present in the nucleosomes and Dek that is associated with chromatin. Through its association with the SPT-domain of hDaxx, histone deacetylases may also be brought to the site of active transcription. As a consequence, nucleosomes in the vicinity of the site of active transcription will have the histone tails deacetylated, allowing the deactylated tail to bind to DNA, thereby leading to an inactive chromatin structure and transcriptional repression [].  The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis as a component of nuclear promyelocytic leukemia protein (PML) oncogenic domains (PODS). Daxx associates with PODs through a direct interaction with PML, a critical component of PODs. The interaction is a dynamic, cell cycle regulated event and is dependent on the post-translational modification of PML by the small ubiquitin-related modifier SUMO-1. ; PDB: 2KZS_A 2KZU_A.
Probab=84.04  E-value=0.32  Score=45.77  Aligned_cols=10  Identities=20%  Similarity=-0.044  Sum_probs=0.0

Q ss_pred             cchhHhHHhH
Q psy17334         91 STNIFLMNLS  100 (188)
Q Consensus        91 ~~~~fi~nLa  100 (188)
                      ..|-|.+||.
T Consensus       344 l~~~~~~~lt  353 (713)
T PF03344_consen  344 LWYNFGCHLT  353 (713)
T ss_dssp             ----------
T ss_pred             cccccccccc
Confidence            3466667665


No 19 
>PF10321 7TM_GPCR_Srt:  Serpentine type 7TM GPCR chemoreceptor Srt;  InterPro: IPR019425  Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type []. Srt is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=82.62  E-value=0.79  Score=38.97  Aligned_cols=54  Identities=22%  Similarity=0.172  Sum_probs=43.7

Q ss_pred             chhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhh
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLV  109 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~  109 (188)
                      .+.++++.+++..++..+-.+.+++++.+.+.+|.+.|-+..-|++.|++...+
T Consensus        31 ~~p~~G~~~~~~g~~~~~lY~p~~~~i~~~~~~k~~~ykiM~~L~i~Di~~l~~   84 (313)
T PF10321_consen   31 KRPILGIYFLIFGIIIIILYIPCLIAIFKKKLFKMSCYKIMFFLAIFDIIQLFI   84 (313)
T ss_pred             cccchhHHHHHHHHHHHHHHHHHHHHHHHhccccCcHHHHHHHHHHHHHHHHHh
Confidence            445677777777777777788888888887777889999999999999997754


No 20 
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=78.46  E-value=0.15  Score=48.57  Aligned_cols=12  Identities=17%  Similarity=0.678  Sum_probs=5.8

Q ss_pred             HHHHhhhhhccc
Q psy17334        101 IADLMVLLVCTP  112 (188)
Q Consensus       101 ~aDLl~~l~~~P  112 (188)
                      +.|++.+++.-|
T Consensus       590 lveiLLslls~~  601 (784)
T PF04931_consen  590 LVEILLSLLSQP  601 (784)
T ss_pred             HHHHHHHHHhCc
Confidence            345555554444


No 21 
>KOG1832|consensus
Probab=73.11  E-value=0.62  Score=44.79  Aligned_cols=6  Identities=17%  Similarity=0.052  Sum_probs=2.8

Q ss_pred             cccccc
Q psy17334        131 ISNTQE  136 (188)
Q Consensus       131 ~Cki~~  136 (188)
                      .||+..
T Consensus      1391 ~~r~yE 1396 (1516)
T KOG1832|consen 1391 SARMYE 1396 (1516)
T ss_pred             hhhhhh
Confidence            455543


No 22 
>PF00002 7tm_2:  7 transmembrane receptor (Secretin family);  InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The secretin-like GPCRs include secretin [], calcitonin [], parathyroid hormone/parathyroid hormone-related peptides [] and vasoactive intestinal peptide [], all of which activate adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. These receptors contain seven transmembrane regions, in a manner reminiscent of the rhodopsins and other receptors believed to interact with G-proteins (however there is no significant sequence identity between these families, the secretin-like receptors thus bear their own unique '7TM' signature). Their N terminus is probably located on the extracellular side of the membrane and potentially glycosylated. This N-terminal region contains a long conserved region which allow the binding of large peptidic ligand such as glucagon, secretin, VIP and PACAP; this region contains five conserved cysteines residues which could be involved in disulphide bond. The C-terminal region of these receptor is probably cytoplasmic. Every receptor gene in this family is encoded on multiple exons, and several of these genes are alternatively spliced to yield functionally distinct products. ; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane; PDB: 3L2J_A 1BL1_A.
Probab=71.77  E-value=2.6  Score=33.66  Aligned_cols=47  Identities=15%  Similarity=0.211  Sum_probs=3.0

Q ss_pred             HHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhh
Q psy17334         63 LCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLV  109 (188)
Q Consensus        63 ~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~  109 (188)
                      +..+-+.+++++-++++......|++|+..+....||+++.++..+.
T Consensus         6 i~~vg~~~Si~~ll~~i~~~~~~r~lr~~~~~i~~~l~~sll~~~~~   52 (242)
T PF00002_consen    6 ISYVGCSLSIICLLLTIITYLLFRKLRSFRNKIHLNLCLSLLLANLS   52 (242)
T ss_dssp             HHHHHHH----------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhcccchhhhhhhHHHHHHHHHH
Confidence            33444455556655555555556778887788889999987775543


No 23 
>PF14851 FAM176:  FAM176 family
Probab=67.20  E-value=1.1  Score=34.22  Aligned_cols=30  Identities=10%  Similarity=0.214  Sum_probs=15.4

Q ss_pred             hhcccceeeEeeecCcCCCcchhHhHHhHHH
Q psy17334         72 VLGNIMVPCVILKSKDMRNSTNIFLMNLSIA  102 (188)
Q Consensus        72 l~GN~lvi~~i~~~~~l~~~~~~fi~nLa~a  102 (188)
                      ++.|.+..|+.++... -+.--||++..|+-
T Consensus         4 llSnsLaaya~I~~~P-E~~aLYFv~gVC~G   33 (153)
T PF14851_consen    4 LLSNSLAAYAHIRDNP-ERFALYFVSGVCAG   33 (153)
T ss_pred             HHHHHHHHHHHHHhCh-HHHHHHHHHHHHHH
Confidence            4566666665544222 22345666665554


No 24 
>PF09882 DUF2109:  Predicted membrane protein (DUF2109);  InterPro: IPR019214  This entry is found in various hypothetical archaeal proteins and has no known function. 
Probab=64.83  E-value=1.8  Score=28.97  Aligned_cols=45  Identities=24%  Similarity=0.429  Sum_probs=30.6

Q ss_pred             HHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhcccee
Q psy17334         70 IGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTV  114 (188)
Q Consensus        70 ~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~  114 (188)
                      +|+++=..++-++..+.+.++-.|..++|.+++.++....-.|+-
T Consensus         6 ~g~Iai~~~iR~~~~~~r~~KL~yLnv~~F~iaalIaL~i~~P~g   50 (78)
T PF09882_consen    6 IGIIAILMAIRIFLTKSRARKLLYLNVINFAIAALIALYIKSPMG   50 (78)
T ss_pred             HHHHHHHHHHHHHHhHhHHHhhhHHHHHHHHHHHHHHHHhCCcHH
Confidence            333333344444555566677789999999999998887766653


No 25 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=64.75  E-value=1.7  Score=31.92  Aligned_cols=9  Identities=11%  Similarity=0.206  Sum_probs=3.3

Q ss_pred             eeEeeecCc
Q psy17334         79 PCVILKSKD   87 (188)
Q Consensus        79 i~~i~~~~~   87 (188)
                      +|+++|.|+
T Consensus        85 ~y~irR~~K   93 (122)
T PF01102_consen   85 SYCIRRLRK   93 (122)
T ss_dssp             HHHHHHHS-
T ss_pred             HHHHHHHhc
Confidence            344443333


No 26 
>KOG4156|consensus
Probab=60.83  E-value=2.8  Score=39.09  Aligned_cols=6  Identities=33%  Similarity=0.645  Sum_probs=2.7

Q ss_pred             ccceee
Q psy17334        110 CTPTVL  115 (188)
Q Consensus       110 ~~P~~i  115 (188)
                      .+|..+
T Consensus       572 vVP~tl  577 (1329)
T KOG4156|consen  572 VVPVTL  577 (1329)
T ss_pred             ccceec
Confidence            345444


No 27 
>PF10327 7TM_GPCR_Sri:  Serpentine type 7TM GPCR chemoreceptor Sri;  InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents Sri, which is part of the Str superfamily of chemoreceptors.
Probab=59.75  E-value=16  Score=30.72  Aligned_cols=57  Identities=18%  Similarity=0.159  Sum_probs=39.5

Q ss_pred             hhHHHHHHHHHHHHhhcccceeeEeee-cCcCCCcchhHhHH---hHHHHHhhhhhcccee
Q psy17334         58 TPSMVLCSIILCIGVLGNIMVPCVILK-SKDMRNSTNIFLMN---LSIADLMVLLVCTPTV  114 (188)
Q Consensus        58 ~~~~~~~~~i~l~gl~GN~lvi~~i~~-~~~l~~~~~~fi~n---La~aDLl~~l~~~P~~  114 (188)
                      .++...+-++.+++++-|.+.++++.. .+++.+..|+++..   ..++|+-.++..-|..
T Consensus         9 ~~li~~~~~ig~iS~~~n~~~iyLi~fks~k~~~fry~ll~~Qi~~~l~di~~t~L~qpip   69 (303)
T PF10327_consen    9 QWLINYYHIIGVISFILNSLGIYLIIFKSPKLDNFRYYLLYFQISCTLTDIHLTFLMQPIP   69 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHheeEEEecCCccchhhHHHHHHHHHHHhhhhhhhhccchh
Confidence            467778888899999999999877664 56667666655543   3356777776654443


No 28 
>PF02532 PsbI:  Photosystem II reaction centre I protein (PSII 4.8 kDa protein);  InterPro: IPR003686 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbI, which is tightly associated with the D1/D2 heterodimer in PSII. The function of PsbI is unknown, but it may be involved in the assembly, dimerisation or stabilisation of PSII dimers [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_i 3ARC_I 3A0B_i 3BZ2_I 3PRQ_I 3KZI_I 3PRR_I 2AXT_i 4FBY_I 1S5L_i ....
Probab=58.49  E-value=14  Score=21.02  Aligned_cols=18  Identities=17%  Similarity=0.370  Sum_probs=13.2

Q ss_pred             hhHHHHHHHHHHHHhhcc
Q psy17334         58 TPSMVLCSIILCIGVLGN   75 (188)
Q Consensus        58 ~~~~~~~~~i~l~gl~GN   75 (188)
                      +..+++++.++++|++.|
T Consensus         9 y~vV~ffv~LFifGflsn   26 (36)
T PF02532_consen    9 YTVVIFFVSLFIFGFLSN   26 (36)
T ss_dssp             HHHHHHHHHHHHHHHHTT
T ss_pred             hhhHHHHHHHHhccccCC
Confidence            345666777888888887


No 29 
>KOG1834|consensus
Probab=57.78  E-value=1.2  Score=41.41  Aligned_cols=7  Identities=14%  Similarity=0.017  Sum_probs=2.6

Q ss_pred             HHHHhhh
Q psy17334        101 IADLMVL  107 (188)
Q Consensus       101 ~aDLl~~  107 (188)
                      +-|..+.
T Consensus       872 WDDSalt  878 (952)
T KOG1834|consen  872 WDDSALT  878 (952)
T ss_pred             cccccce
Confidence            3344333


No 30 
>PF08229 SHR3_chaperone:  ER membrane protein SH3 ;  InterPro: IPR013248 This family of proteins are membrane localised chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs) []. Shr3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of Shr3, AAPs are retained in the ER.
Probab=56.47  E-value=13  Score=29.61  Aligned_cols=14  Identities=29%  Similarity=0.434  Sum_probs=7.9

Q ss_pred             hHHhHHHHHhhhhh
Q psy17334         96 LMNLSIADLMVLLV  109 (188)
Q Consensus        96 i~nLa~aDLl~~l~  109 (188)
                      +--||.++.+++++
T Consensus       130 l~VlAASn~Ii~~~  143 (196)
T PF08229_consen  130 LRVLAASNTIIALV  143 (196)
T ss_pred             HHHHHHhhHHHHHH
Confidence            33456666665554


No 31 
>KOG1189|consensus
Probab=53.42  E-value=2.3  Score=40.16  Aligned_cols=6  Identities=17%  Similarity=0.745  Sum_probs=3.3

Q ss_pred             CCcccc
Q psy17334        122 PETWQM  127 (188)
Q Consensus       122 ~~~W~f  127 (188)
                      .+-|.|
T Consensus       865 ~GgW~f  870 (960)
T KOG1189|consen  865 DGGWSF  870 (960)
T ss_pred             cCCeee
Confidence            355665


No 32 
>PF03839 Sec62:  Translocation protein Sec62;  InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane
Probab=53.06  E-value=5.2  Score=32.47  Aligned_cols=10  Identities=10%  Similarity=0.285  Sum_probs=6.9

Q ss_pred             CCcccccccc
Q psy17334        122 PETWQMGEHI  131 (188)
Q Consensus       122 ~~~W~fg~~~  131 (188)
                      .+-|.|.+..
T Consensus       175 ~~fWlfPNLf  184 (224)
T PF03839_consen  175 HGFWLFPNLF  184 (224)
T ss_pred             CCEEeCCccc
Confidence            5788887653


No 33 
>PF03402 V1R:  Vomeronasal organ pheromone receptor family, V1R;  InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The rhodopsin-like GPCRs themselves represent a widespread protein family that includes hormone, neurotransmitter and light receptors, all of which transduce extracellular signals through interaction with guanine nucleotide-binding (G) proteins. Although their activating ligands vary widely in structure and character, the amino acid sequences of the receptors are very similar and are believed to adopt a common structural framework comprising 7 transmembrane (TM) helices [, , ]. Pheromones have evolved in all animal phyla, to signal sex and dominance status, and are responsible for stereotypical social and sexual behaviour among members of the same species. In mammals, these chemical signals are believed to be detected primarily by the vomeronasal organ (VNO), a chemosensory organ located at the base of the nasal septum []. The VNO is present in most amphibia, reptiles and non-primate mammals but is absent in birds, adult catarrhine monkeys and apes []. An active role for the human VNO in the detection of pheromones is disputed; the VNO is clearly present in the foetus but appears to be atrophied or absent in adults. Three distinct families of putative pheromone receptors have been identified in the vomeronasal organ (V1Rs, V2Rs and V3Rs). All are G protein-coupled receptors but are only distantly related to the receptors of the main olfactory system, highlighting their different role []. The V1 receptors share between 50 and 90% sequence identity but have little similarity to other families of G protein-coupled receptors. They appear to be distantly related to the mammalian T2R bitter taste receptors and the rhodopsin-like GPCRs []. In rat, the family comprises 30-40 genes. These are expressed in the apical regions of the VNO, in neurons expressing Gi2. Coupling of the receptors to this protein mediates inositol trisphosphate signalling []. A number of human V1 receptor homologues have also been found. The majority of these human sequences are pseudogenes [] but an apparently functional receptor has been identified that is expressed in the human olfactory system [].; GO: 0016503 pheromone receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane
Probab=52.91  E-value=6.2  Score=32.82  Aligned_cols=45  Identities=16%  Similarity=0.250  Sum_probs=31.0

Q ss_pred             cCCCcchhHhHHhHHHHHhhhhh-ccceeeEEeccCCCcccccccccccc
Q psy17334         87 DMRNSTNIFLMNLSIADLMVLLV-CTPTVLVEVNSKPETWQMGEHISNTQ  135 (188)
Q Consensus        87 ~l~~~~~~fi~nLa~aDLl~~l~-~~P~~i~~~~~~~~~W~fg~~~Cki~  135 (188)
                      +..+|++..+.|||++++++.+. ++|.... + .+.+  .|++..||+.
T Consensus         6 ~r~kp~dlIl~hLa~aN~lvLl~rGip~~~~-~-~~~~--~~~d~gCK~v   51 (265)
T PF03402_consen    6 HRLKPIDLILIHLALANILVLLSRGIPQTMA-F-FGWK--FFDDIGCKIV   51 (265)
T ss_pred             CCCCcHHHHHHHHHHHHHHHHHHhhHHHHHH-H-hhcc--cCCCceeeee
Confidence            34568999999999999998875 4564332 1 1212  3688999974


No 34 
>CHL00024 psbI photosystem II protein I
Probab=52.55  E-value=11  Score=21.47  Aligned_cols=18  Identities=17%  Similarity=0.370  Sum_probs=13.4

Q ss_pred             hhHHHHHHHHHHHHhhcc
Q psy17334         58 TPSMVLCSIILCIGVLGN   75 (188)
Q Consensus        58 ~~~~~~~~~i~l~gl~GN   75 (188)
                      +..+++++.++++|++.|
T Consensus         9 y~vV~ffvsLFifGFlsn   26 (36)
T CHL00024          9 YTVVIFFVSLFIFGFLSN   26 (36)
T ss_pred             hhHHHHHHHHHHccccCC
Confidence            356667778888888877


No 35 
>PRK02655 psbI photosystem II reaction center I protein I; Provisional
Probab=49.94  E-value=12  Score=21.43  Aligned_cols=18  Identities=11%  Similarity=0.181  Sum_probs=13.2

Q ss_pred             hhHHHHHHHHHHHHhhcc
Q psy17334         58 TPSMVLCSIILCIGVLGN   75 (188)
Q Consensus        58 ~~~~~~~~~i~l~gl~GN   75 (188)
                      +..+++++.++++|++.|
T Consensus         9 y~vV~ffvsLFiFGflsn   26 (38)
T PRK02655          9 YIVVFFFVGLFVFGFLSS   26 (38)
T ss_pred             hhhHHHHHHHHHcccCCC
Confidence            346667777888888877


No 36 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=47.03  E-value=5.5  Score=24.52  Aligned_cols=6  Identities=33%  Similarity=0.982  Sum_probs=2.2

Q ss_pred             HHHHhh
Q psy17334         68 LCIGVL   73 (188)
Q Consensus        68 ~l~gl~   73 (188)
                      +++|++
T Consensus        11 iv~~lL   16 (50)
T PF12606_consen   11 IVMGLL   16 (50)
T ss_pred             HHHHHH
Confidence            333333


No 37 
>PF11446 DUF2897:  Protein of unknown function (DUF2897);  InterPro: IPR021550  This is a bacterial family of uncharacterised proteins. 
Probab=42.61  E-value=13  Score=23.37  Aligned_cols=8  Identities=38%  Similarity=0.725  Sum_probs=4.4

Q ss_pred             hhccccee
Q psy17334         72 VLGNIMVP   79 (188)
Q Consensus        72 l~GN~lvi   79 (188)
                      ++||+.++
T Consensus        16 IigNia~L   23 (55)
T PF11446_consen   16 IIGNIAAL   23 (55)
T ss_pred             HHhHHHHH
Confidence            45665544


No 38 
>PF10856 DUF2678:  Protein of unknown function (DUF2678);  InterPro: IPR022564  This family of proteins has no known function. 
Probab=42.29  E-value=97  Score=22.54  Aligned_cols=16  Identities=13%  Similarity=0.102  Sum_probs=7.1

Q ss_pred             chhhHHHHHHHHHHHH
Q psy17334         56 IRTPSMVLCSIILCIG   71 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~g   71 (188)
                      ...+..++..+..+++
T Consensus        30 inliiG~vT~l~VLvt   45 (118)
T PF10856_consen   30 INLIIGAVTSLFVLVT   45 (118)
T ss_pred             EEeehHHHHHHHHHHH
Confidence            4444444444444443


No 39 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=42.20  E-value=4.4  Score=30.52  Aligned_cols=34  Identities=12%  Similarity=0.253  Sum_probs=24.1

Q ss_pred             hhHHHHHHHHHHHHhhcccceeeEeeecCcCCCc
Q psy17334         58 TPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNS   91 (188)
Q Consensus        58 ~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~   91 (188)
                      .+..++|.++|++|+++-+++++..+.+++.+++
T Consensus        62 AIaGIVfgiVfimgvva~i~icvCmc~kn~rgsR   95 (155)
T PF10873_consen   62 AIAGIVFGIVFIMGVVAGIAICVCMCMKNSRGSR   95 (155)
T ss_pred             eeeeeehhhHHHHHHHHHHHHHHhhhhhcCCCcc
Confidence            3566788899999999887777666655554443


No 40 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=41.95  E-value=7.1  Score=33.76  Aligned_cols=29  Identities=17%  Similarity=0.304  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHhhcccceeeEeeecCcCC
Q psy17334         61 MVLCSIILCIGVLGNIMVPCVILKSKDMR   89 (188)
Q Consensus        61 ~~~~~~i~l~gl~GN~lvi~~i~~~~~l~   89 (188)
                      +++++++.++.++--.++||+|+|+||.+
T Consensus       311 ~IiaSiIAIvvIVLIMvIIYLILRYRRKK  339 (353)
T TIGR01477       311 PIIASIIAILIIVLIMVIIYLILRYRRKK  339 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhcc
Confidence            34445555555555567888888887754


No 41 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=41.89  E-value=5.8  Score=33.58  Aligned_cols=27  Identities=19%  Similarity=0.322  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHhhcccceeeEeeecCcC
Q psy17334         62 VLCSIILCIGVLGNIMVPCVILKSKDM   88 (188)
Q Consensus        62 ~~~~~i~l~gl~GN~lvi~~i~~~~~l   88 (188)
                      ++.+++.++.++--+++||+|+|+||.
T Consensus       258 I~aSiiaIliIVLIMvIIYLILRYRRK  284 (299)
T PF02009_consen  258 IIASIIAILIIVLIMVIIYLILRYRRK  284 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334444444444445777888877763


No 42 
>PTZ00046 rifin; Provisional
Probab=39.43  E-value=8.3  Score=33.44  Aligned_cols=28  Identities=14%  Similarity=0.350  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHhhcccceeeEeeecCcCC
Q psy17334         62 VLCSIILCIGVLGNIMVPCVILKSKDMR   89 (188)
Q Consensus        62 ~~~~~i~l~gl~GN~lvi~~i~~~~~l~   89 (188)
                      ++++++.++.++--.++||+|+|+||.+
T Consensus       317 IiaSiiAIvVIVLIMvIIYLILRYRRKK  344 (358)
T PTZ00046        317 IIASIVAIVVIVLIMVIIYLILRYRRKK  344 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhcc
Confidence            4445555555555567788888887754


No 43 
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=38.99  E-value=12  Score=30.59  Aligned_cols=17  Identities=24%  Similarity=0.448  Sum_probs=10.0

Q ss_pred             eEEeccCCCcccccccc
Q psy17334        115 LVEVNSKPETWQMGEHI  131 (188)
Q Consensus       115 i~~~~~~~~~W~fg~~~  131 (188)
                      ++++..+.+-|.|.+..
T Consensus       174 i~~~~~g~~fWlfPNLf  190 (232)
T TIGR00869       174 LTLIVVKPGIWIFPNLF  190 (232)
T ss_pred             HHHHHhCCCeeeecchh
Confidence            33334456888887653


No 44 
>PF11861 DUF3381:  Domain of unknown function (DUF3381);  InterPro: IPR024576 This uncharacterised domain is found in eukaryotic rRNA methyltransferases like yeast Spb1 and mammalian homologue Ftsj3. Spb1 is required for proper assembly of pre-ribosomal particles during the biogenesis of the 60S ribosomal subunit [, ].
Probab=37.73  E-value=30  Score=26.42  Aligned_cols=7  Identities=57%  Similarity=0.629  Sum_probs=3.4

Q ss_pred             HHHHhhh
Q psy17334        101 IADLMVL  107 (188)
Q Consensus       101 ~aDLl~~  107 (188)
                      |.||-++
T Consensus        69 c~DLKVL   75 (159)
T PF11861_consen   69 CKDLKVL   75 (159)
T ss_pred             HHHHHhc
Confidence            4455543


No 45 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=36.16  E-value=12  Score=30.19  Aligned_cols=9  Identities=22%  Similarity=0.434  Sum_probs=4.5

Q ss_pred             hHhHHhHHH
Q psy17334         94 IFLMNLSIA  102 (188)
Q Consensus        94 ~fi~nLa~a  102 (188)
                      -.|+|++|+
T Consensus        13 N~iLNiaI~   21 (217)
T PF07423_consen   13 NKILNIAIG   21 (217)
T ss_pred             hhhHHHHHH
Confidence            345555544


No 46 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=35.60  E-value=21  Score=26.33  Aligned_cols=13  Identities=23%  Similarity=0.468  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHhhc
Q psy17334         62 VLCSIILCIGVLG   74 (188)
Q Consensus        62 ~~~~~i~l~gl~G   74 (188)
                      ....++++++++.
T Consensus        84 sal~v~lVl~lls   96 (129)
T PF12191_consen   84 SALSVVLVLALLS   96 (129)
T ss_dssp             -------------
T ss_pred             hHHHHHHHHHHHH
Confidence            3344444455444


No 47 
>PF15039 DUF4530:  Domain of unknown function (DUF4530)
Probab=35.25  E-value=13  Score=26.08  Aligned_cols=6  Identities=50%  Similarity=0.551  Sum_probs=2.9

Q ss_pred             HHhhcc
Q psy17334         70 IGVLGN   75 (188)
Q Consensus        70 ~gl~GN   75 (188)
                      .-=+||
T Consensus        55 weelgn   60 (111)
T PF15039_consen   55 WEELGN   60 (111)
T ss_pred             HHHhcc
Confidence            334555


No 48 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=33.89  E-value=1.6e+02  Score=20.47  Aligned_cols=30  Identities=20%  Similarity=0.208  Sum_probs=14.0

Q ss_pred             hHHHHHHHHHHHHhhcccceeeEeeecCcCC
Q psy17334         59 PSMVLCSIILCIGVLGNIMVPCVILKSKDMR   89 (188)
Q Consensus        59 ~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~   89 (188)
                      ++++++++++++.++- ++..++|+|.|+.+
T Consensus        64 ili~lls~v~IlVily-~IyYFVILRer~~~   93 (101)
T PF06024_consen   64 ILISLLSFVCILVILY-AIYYFVILRERQKS   93 (101)
T ss_pred             hHHHHHHHHHHHHHHh-hheEEEEEeccccc
Confidence            3444444444443332 24456666666543


No 49 
>PF10319 7TM_GPCR_Srj:  Serpentine type 7TM GPCR chemoreceptor Srj;  InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class j (Srj) from the Str superfamily [, ]. The Srj family is designated as the out-group based on its location in preliminary phylogenetic analyses of the entire superfamily []. 
Probab=33.23  E-value=96  Score=26.46  Aligned_cols=56  Identities=16%  Similarity=0.228  Sum_probs=39.5

Q ss_pred             HHHHHHHHHHHHhhcccceeeEeeecCcCCCcc-hhHhHHhHHHHHhhhhh--ccceee
Q psy17334         60 SMVLCSIILCIGVLGNIMVPCVILKSKDMRNST-NIFLMNLSIADLMVLLV--CTPTVL  115 (188)
Q Consensus        60 ~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~-~~fi~nLa~aDLl~~l~--~~P~~i  115 (188)
                      .-.+.-+.++++++-|-+.++++...|+.+--. .++++..|+-|++.+++  .+|.-+
T Consensus         7 h~~~Pk~~~~lsf~~Np~fiyli~~~~~~~~G~Yr~LL~~Fa~fn~~~S~~~~~vp~~v   65 (310)
T PF10319_consen    7 HHYIPKIFGILSFIVNPIFIYLIFTEKKSQFGNYRYLLLFFAIFNLIYSVVDLLVPICV   65 (310)
T ss_pred             HHHHHHHHHHHHHHHhhhhheeEEcccccccccHHHHHHHHHHHHHHHHHHHHHhhhee
Confidence            334455667788899999999998888766533 46667788888887764  355443


No 50 
>PF05808 Podoplanin:  Podoplanin;  InterPro: IPR008783 This family consists of several mammalian podoplanin-like proteins which are thought to control specifically the unique shape of podocytes [].; GO: 0016021 integral to membrane; PDB: 3IET_X.
Probab=33.02  E-value=14  Score=28.34  Aligned_cols=21  Identities=29%  Similarity=0.594  Sum_probs=0.0

Q ss_pred             hhhHHHHHHHHHHHHhhcccc
Q psy17334         57 RTPSMVLCSIILCIGVLGNIM   77 (188)
Q Consensus        57 ~~~~~~~~~~i~l~gl~GN~l   77 (188)
                      -.+..++..++..+|++|-++
T Consensus       129 ~tLVGIIVGVLlaIG~igGII  149 (162)
T PF05808_consen  129 VTLVGIIVGVLLAIGFIGGII  149 (162)
T ss_dssp             ---------------------
T ss_pred             eeeeeehhhHHHHHHHHhhee
Confidence            346778888889999999644


No 51 
>COG5137 Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics]
Probab=32.23  E-value=15  Score=29.70  Aligned_cols=18  Identities=17%  Similarity=0.338  Sum_probs=8.9

Q ss_pred             CCCCCCCcccccccCCCC
Q psy17334         12 NLTSPDNWTLAIGAAENA   29 (188)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~   29 (188)
                      .+-...-|-....+...+
T Consensus        33 ~lK~dlEwkltYvgs~~S   50 (279)
T COG5137          33 ELKCDLEWKLTYVGSVHS   50 (279)
T ss_pred             hhcCCceEEEEEeecccc
Confidence            444455566655444433


No 52 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=31.22  E-value=70  Score=19.26  Aligned_cols=33  Identities=12%  Similarity=0.177  Sum_probs=17.4

Q ss_pred             hHHHHHHHHHHHHhhcccceeeEeeecCcCCCc
Q psy17334         59 PSMVLCSIILCIGVLGNIMVPCVILKSKDMRNS   91 (188)
Q Consensus        59 ~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~   91 (188)
                      .++++++..+++|+.|-.+-...=-..+.||.|
T Consensus         8 ~~~~i~i~~lL~~~TgyaiYtaFGppSk~LrDP   40 (46)
T PRK13183          8 LSLAITILAILLALTGFGIYTAFGPPSKELDDP   40 (46)
T ss_pred             HHHHHHHHHHHHHHhhheeeeccCCcccccCCc
Confidence            455566677778877754322222233445544


No 53 
>CHL00020 psbN photosystem II protein N
Probab=30.91  E-value=67  Score=19.09  Aligned_cols=33  Identities=15%  Similarity=0.152  Sum_probs=16.7

Q ss_pred             hHHHHHHHHHHHHhhcccceeeEeeecCcCCCc
Q psy17334         59 PSMVLCSIILCIGVLGNIMVPCVILKSKDMRNS   91 (188)
Q Consensus        59 ~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~   91 (188)
                      .++++++..+++|+.|-.+-...=-..+.||.|
T Consensus         5 ~~~~i~i~~ll~~~Tgy~iYtaFGppSk~LrDP   37 (43)
T CHL00020          5 TLVAIFISGLLVSFTGYALYTAFGQPSKQLRDP   37 (43)
T ss_pred             hhHHHHHHHHHHHhhheeeeeccCCchhccCCc
Confidence            345566666777777743322222233445544


No 54 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=30.86  E-value=20  Score=25.59  Aligned_cols=29  Identities=7%  Similarity=0.161  Sum_probs=18.2

Q ss_pred             hHHHHHHHHHHHHhhcccceeeEeeecCc
Q psy17334         59 PSMVLCSIILCIGVLGNIMVPCVILKSKD   87 (188)
Q Consensus        59 ~~~~~~~~i~l~gl~GN~lvi~~i~~~~~   87 (188)
                      ++.+++.+++++.++.|++......+.++
T Consensus         2 ~Ll~il~llLll~l~asl~~wr~~~rq~k   30 (107)
T PF15330_consen    2 LLLGILALLLLLSLAASLLAWRMKQRQKK   30 (107)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhhhcc
Confidence            45666677777778888766554444443


No 55 
>PF04712 Radial_spoke:  Radial spokehead-like protein
Probab=30.69  E-value=16  Score=33.04  Aligned_cols=11  Identities=0%  Similarity=-0.151  Sum_probs=6.6

Q ss_pred             cccccccccch
Q psy17334        127 MGEHISNTQEE  137 (188)
Q Consensus       127 fg~~~Cki~~~  137 (188)
                      .....|.....
T Consensus       344 l~qGR~~~~~~  354 (491)
T PF04712_consen  344 LPQGRCTWYNP  354 (491)
T ss_pred             ccCceEeCCCC
Confidence            44556777744


No 56 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=30.01  E-value=3.8  Score=38.17  Aligned_cols=37  Identities=22%  Similarity=0.383  Sum_probs=14.4

Q ss_pred             hhHhHHhH-HHHHhhhhhccceeeEEeccCCCcccccc
Q psy17334         93 NIFLMNLS-IADLMVLLVCTPTVLVEVNSKPETWQMGE  129 (188)
Q Consensus        93 ~~fi~nLa-~aDLl~~l~~~P~~i~~~~~~~~~W~fg~  129 (188)
                      +++++|.. ..||.-.+-.-+-..++++-..+.|.+.+
T Consensus        54 ~vilIncGa~~dl~~~l~~~~~~~iyViDshRP~~L~N   91 (622)
T PF02724_consen   54 SVILINCGATVDLEEFLELDEDVTIYVIDSHRPWNLDN   91 (622)
T ss_pred             eEEEEecCchhhHHHHhCCCCceEEEEEeCCCCccHhh
Confidence            34455543 33444322211233333333445565433


No 57 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=28.85  E-value=3.8  Score=38.14  Aligned_cols=10  Identities=20%  Similarity=0.152  Sum_probs=4.3

Q ss_pred             ceeeEeeecC
Q psy17334         77 MVPCVILKSK   86 (188)
Q Consensus        77 lvi~~i~~~~   86 (188)
                      +.++++=.+|
T Consensus        76 ~~iyViDshR   85 (622)
T PF02724_consen   76 VTIYVIDSHR   85 (622)
T ss_pred             eEEEEEeCCC
Confidence            3445444433


No 58 
>COG5137 Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics]
Probab=28.12  E-value=24  Score=28.61  Aligned_cols=10  Identities=20%  Similarity=0.042  Sum_probs=4.4

Q ss_pred             ceeeEeeecC
Q psy17334         77 MVPCVILKSK   86 (188)
Q Consensus        77 lvi~~i~~~~   86 (188)
                      ++|++.++++
T Consensus        93 TvILlsc~Y~  102 (279)
T COG5137          93 TVILLSCRYK  102 (279)
T ss_pred             eEEEEEEeec
Confidence            3444444444


No 59 
>PHA03055 Hypothetical protein; Provisional
Probab=27.95  E-value=1.2e+02  Score=20.49  Aligned_cols=51  Identities=14%  Similarity=0.230  Sum_probs=30.7

Q ss_pred             HHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeE
Q psy17334         66 IILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLV  116 (188)
Q Consensus        66 ~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~  116 (188)
                      ++.+..+.|..+++-.+..+|.+-..+--|---+.+.++...++.+|..++
T Consensus        16 L~llMiisG~ali~k~~~p~r~~~~RS~~~~rVl~~lE~va~lifIPgti~   66 (79)
T PHA03055         16 LMLLMVISGTAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTII   66 (79)
T ss_pred             HHHHHHHhccHHHhhhcCccceeeehhhhhHHHHHHHHHHHHHHhhccHHH
Confidence            333444556666655444443333333456666788888888888887654


No 60 
>CHL00204 ycf1 Ycf1; Provisional
Probab=26.96  E-value=67  Score=33.68  Aligned_cols=12  Identities=25%  Similarity=0.329  Sum_probs=5.3

Q ss_pred             eeeEeeecCcCC
Q psy17334         78 VPCVILKSKDMR   89 (188)
Q Consensus        78 vi~~i~~~~~l~   89 (188)
                      |++.|..+...|
T Consensus       184 vlvwI~qn~sIr  195 (1832)
T CHL00204        184 VLVWIQQNNSIR  195 (1832)
T ss_pred             heeeeecCCccc
Confidence            444444444443


No 61 
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=26.72  E-value=90  Score=21.99  Aligned_cols=22  Identities=14%  Similarity=0.434  Sum_probs=14.5

Q ss_pred             chhhHHHHHHHHHHHHhhcccc
Q psy17334         56 IRTPSMVLCSIILCIGVLGNIM   77 (188)
Q Consensus        56 ~~~~~~~~~~~i~l~gl~GN~l   77 (188)
                      ..++++.+..++..+|++..++
T Consensus        18 WeIfLItLasVvvavGl~aGLf   39 (106)
T PF14654_consen   18 WEIFLITLASVVVAVGLFAGLF   39 (106)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Confidence            4556666777777777776543


No 62 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=25.82  E-value=61  Score=27.21  Aligned_cols=12  Identities=8%  Similarity=0.310  Sum_probs=7.1

Q ss_pred             ceeeEeeecCcC
Q psy17334         77 MVPCVILKSKDM   88 (188)
Q Consensus        77 lvi~~i~~~~~l   88 (188)
                      ++.|+|.|+|+.
T Consensus       289 LiaYli~Rrr~~  300 (306)
T PF01299_consen  289 LIAYLIGRRRSR  300 (306)
T ss_pred             HHhheeEecccc
Confidence            555666665553


No 63 
>KOG4564|consensus
Probab=25.66  E-value=36  Score=30.74  Aligned_cols=50  Identities=12%  Similarity=0.186  Sum_probs=33.2

Q ss_pred             HHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhcc
Q psy17334         62 VLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCT  111 (188)
Q Consensus        62 ~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~  111 (188)
                      +++.+=+.++++.=++.+.++..-|++|-..|++=.||-++-++.++..+
T Consensus       149 ~lytvGyslSl~sL~vAl~If~~FR~L~CtRn~IH~nLF~SfiLra~~~~  198 (473)
T KOG4564|consen  149 ILYTVGYSLSLVSLLVALIIFLYFRSLHCTRNYIHMNLFASFILRAASVL  198 (473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHHHHHHHHHHHHHHHHHHH
Confidence            34444455555554444556667789999899999999888776665543


No 64 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=25.10  E-value=76  Score=18.86  Aligned_cols=16  Identities=13%  Similarity=0.256  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHhhcc
Q psy17334         60 SMVLCSIILCIGVLGN   75 (188)
Q Consensus        60 ~~~~~~~i~l~gl~GN   75 (188)
                      .+++++..+++|+.|-
T Consensus         6 ~~~i~i~~~lv~~Tgy   21 (43)
T PF02468_consen    6 VLAIFISCLLVSITGY   21 (43)
T ss_pred             eHHHHHHHHHHHHHhh
Confidence            4556666677777773


No 65 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=24.72  E-value=1.5e+02  Score=22.82  Aligned_cols=8  Identities=13%  Similarity=0.110  Sum_probs=2.9

Q ss_pred             HHHHHHHH
Q psy17334         62 VLCSIILC   69 (188)
Q Consensus        62 ~~~~~i~l   69 (188)
                      .+|+++.+
T Consensus        97 ~~~Vl~g~  104 (163)
T PF06679_consen   97 ALYVLVGL  104 (163)
T ss_pred             hHHHHHHH
Confidence            33333333


No 66 
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional
Probab=23.29  E-value=74  Score=23.62  Aligned_cols=28  Identities=7%  Similarity=0.044  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHhhcccceeeEeeecCc
Q psy17334         60 SMVLCSIILCIGVLGNIMVPCVILKSKD   87 (188)
Q Consensus        60 ~~~~~~~i~l~gl~GN~lvi~~i~~~~~   87 (188)
                      +.+++++++++.+.|-+..++...|+++
T Consensus       103 ~~~il~il~~i~is~~~~~~yr~~r~~~  130 (139)
T PHA03099        103 SPGIVLVLVGIIITCCLLSVYRFTRRTK  130 (139)
T ss_pred             hhHHHHHHHHHHHHHHHHhhheeeeccc
Confidence            3344444455555554444444444443


No 67 
>PRK14762 membrane protein; Provisional
Probab=22.85  E-value=94  Score=16.22  Aligned_cols=7  Identities=57%  Similarity=0.809  Sum_probs=3.0

Q ss_pred             HHHHHHH
Q psy17334         65 SIILCIG   71 (188)
Q Consensus        65 ~~i~l~g   71 (188)
                      +++|++|
T Consensus         9 ~iiflig   15 (27)
T PRK14762          9 LIIFLIG   15 (27)
T ss_pred             HHHHHHH
Confidence            3444444


No 68 
>KOG1172|consensus
Probab=22.74  E-value=1.3e+02  Score=29.24  Aligned_cols=43  Identities=21%  Similarity=0.228  Sum_probs=33.7

Q ss_pred             cccceeeEeeecCcCCCcc--hhHhHHhHHHHHhhhhhccceeeE
Q psy17334         74 GNIMVPCVILKSKDMRNST--NIFLMNLSIADLMVLLVCTPTVLV  116 (188)
Q Consensus        74 GN~lvi~~i~~~~~l~~~~--~~fi~nLa~aDLl~~l~~~P~~i~  116 (188)
                      -|+...++..+.++|+++.  ++=++-|++..++++++++|++..
T Consensus       648 qqIts~iv~rke~kLKKgsgyH~DLlllgil~~icsllGLPw~~~  692 (876)
T KOG1172|consen  648 QQITAVIVNRKENKLKKGSGYHLDLLLLGILTLICSLLGLPWSNA  692 (876)
T ss_pred             chHHHHHhhcccccCCCCcchhHHHHHHHHHHHHHHhcCCCcccc
Confidence            4666677777888888876  566777888899999999998764


No 69 
>PF08229 SHR3_chaperone:  ER membrane protein SH3 ;  InterPro: IPR013248 This family of proteins are membrane localised chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs) []. Shr3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of Shr3, AAPs are retained in the ER.
Probab=21.84  E-value=71  Score=25.40  Aligned_cols=12  Identities=25%  Similarity=0.661  Sum_probs=6.1

Q ss_pred             HHHHHHHHhhcc
Q psy17334         64 CSIILCIGVLGN   75 (188)
Q Consensus        64 ~~~i~l~gl~GN   75 (188)
                      +-++..+|++|.
T Consensus        65 Lh~v~~lglig~   76 (196)
T PF08229_consen   65 LHIVIGLGLIGL   76 (196)
T ss_pred             HHHHHHHHHHHH
Confidence            334455556664


No 70 
>PF10329 DUF2417:  Region of unknown function (DUF2417);  InterPro: IPR019431  This entry represents a family of fungal proteins with no known function. In some cases these proteins also contain an alpha/beta hydrolase fold (IPR000073 from INTERPRO). 
Probab=21.68  E-value=46  Score=27.19  Aligned_cols=37  Identities=22%  Similarity=0.336  Sum_probs=16.9

Q ss_pred             hcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhh
Q psy17334         73 LGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLV  109 (188)
Q Consensus        73 ~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~  109 (188)
                      +.|++.++.+....+.-...++.++-|.+.|++..+.
T Consensus        85 ~~~~~~L~Ff~vpS~~~r~l~~vl~~Lllvdlilil~  121 (232)
T PF10329_consen   85 ITNLFNLWFFGVPSKLERILNIVLAGLLLVDLILILA  121 (232)
T ss_pred             HHHHHHHHheecCcHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3343333333333333333455555555566665544


No 71 
>PF10316 7TM_GPCR_Srbc:  Serpentine type 7TM GPCR chemoreceptor Srbc ;  InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class b (Srb) from the Sra superfamily []. Srb receptors contain 6-8 hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. Srbc is a solo family amongst the superfamilies of chemoreceptors.
Probab=20.89  E-value=50  Score=27.53  Aligned_cols=53  Identities=15%  Similarity=0.046  Sum_probs=32.3

Q ss_pred             HHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccc
Q psy17334         60 SMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTP  112 (188)
Q Consensus        60 ~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P  112 (188)
                      ..++-++...+..+.|..+++.+.+.|+.+++-..++.-..+.|.+.+....+
T Consensus         8 v~~i~i~~s~~~~~iN~~lL~~if~~Kk~kk~~l~LfY~Rf~~D~~~~~~~~~   60 (273)
T PF10316_consen    8 VSIIGIIFSIITCLINFYLLYSIFYSKKKKKPDLSLFYFRFAIDVFYGFSVFI   60 (273)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhccccCCCCEEeeHHHHHHHHHHHHHHHH
Confidence            33444555667778898888887766654444444444445677777765443


No 72 
>PHA03062 putative IMV membrane protein; Provisional
Probab=20.83  E-value=1.6e+02  Score=19.79  Aligned_cols=51  Identities=14%  Similarity=0.216  Sum_probs=30.3

Q ss_pred             HHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeE
Q psy17334         66 IILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLV  116 (188)
Q Consensus        66 ~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~  116 (188)
                      ++.+..+.|..+++-.+..+|.+-..+--|---+.+.++...++.+|..++
T Consensus        17 L~llMivsG~ali~k~~~p~r~~~~RS~~~~rVl~~lE~va~lifIPgti~   67 (78)
T PHA03062         17 LALLMIVSGGALLFKSLAPHRVVMMRSATFNKVVSFLEYVAILIFVPGTIA   67 (78)
T ss_pred             HHHHHHHhChHHHHhhcCccceeeehhhhhHHHHHHHHHHHHHHhhccHHH
Confidence            334444556666655444443333333456666788888888888886654


No 73 
>PF04713 Pox_I5:  Poxvirus protein I5;  InterPro: IPR006803 This entry represents the Poxvirus protein I5.
Probab=20.69  E-value=1.8e+02  Score=19.52  Aligned_cols=49  Identities=14%  Similarity=0.275  Sum_probs=28.9

Q ss_pred             HHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeE
Q psy17334         68 LCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLV  116 (188)
Q Consensus        68 ~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~  116 (188)
                      .+..+.|-.+++-.+..+|.+-...-.+---|.+.+.+..++.+|..++
T Consensus        18 llMvisG~ali~k~~ap~~~v~~rS~~~~rVl~~le~vailifIPGTIi   66 (77)
T PF04713_consen   18 LLMVISGGALIFKRIAPHRSVMMRSATFNRVLTFLEYVAILIFIPGTII   66 (77)
T ss_pred             HHHHHhChHHHhhccCCcceehhhhhhhHHHHHHHHHHHHHhhcccHHH
Confidence            3344556666554444444433333445555778888888888886554


No 74 
>PHA03283 envelope glycoprotein E; Provisional
Probab=20.30  E-value=1.1e+02  Score=28.11  Aligned_cols=36  Identities=17%  Similarity=0.038  Sum_probs=17.1

Q ss_pred             hhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcc
Q psy17334         57 RTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNST   92 (188)
Q Consensus        57 ~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~   92 (188)
                      +..+.++.++++++|++.=++++|+..++++.+..+
T Consensus       397 ~~~l~~~~~~~~~~~~~~~~l~vw~c~~~r~~~~~~  432 (542)
T PHA03283        397 RHYLAFLLAIICTCAALLVALVVWGCILYRRSNRKP  432 (542)
T ss_pred             cccchhHHHHHHHHHHHHHHHhhhheeeehhhcCCc
Confidence            334444444444444443335555555555544433


No 75 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=20.24  E-value=13  Score=29.97  Aligned_cols=15  Identities=20%  Similarity=0.149  Sum_probs=9.0

Q ss_pred             CcCCCcchhHhHHhH
Q psy17334         86 KDMRNSTNIFLMNLS  100 (188)
Q Consensus        86 ~~l~~~~~~fi~nLa  100 (188)
                      |+.....|++|.-.+
T Consensus        10 RK~N~iLNiaI~IV~   24 (217)
T PF07423_consen   10 RKTNKILNIAIGIVS   24 (217)
T ss_pred             hhhhhhHHHHHHHHH
Confidence            444456677777544


No 76 
>PF15050 SCIMP:  SCIMP protein
Probab=20.17  E-value=21  Score=26.07  Aligned_cols=8  Identities=0%  Similarity=0.310  Sum_probs=4.2

Q ss_pred             ceeeEeee
Q psy17334         77 MVPCVILK   84 (188)
Q Consensus        77 lvi~~i~~   84 (188)
                      +++++++|
T Consensus        25 lIlyCvcR   32 (133)
T PF15050_consen   25 LILYCVCR   32 (133)
T ss_pred             HHHHHHHH
Confidence            55555544


No 77 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=20.10  E-value=46  Score=21.75  Aligned_cols=18  Identities=22%  Similarity=0.713  Sum_probs=8.8

Q ss_pred             HHHHhhcccceeeEeeecCc
Q psy17334         68 LCIGVLGNIMVPCVILKSKD   87 (188)
Q Consensus        68 ~l~gl~GN~lvi~~i~~~~~   87 (188)
                      .+++++|  ++++.+..+++
T Consensus        10 ICVaii~--lIlY~iYnr~~   27 (68)
T PF05961_consen   10 ICVAIIG--LILYGIYNRKK   27 (68)
T ss_pred             HHHHHHH--HHHHHHHhccc
Confidence            3334444  55666655443


Done!