Diaphorina citri psyllid: psy17358


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
SNQVRFAHTDIKVPDFSHYRRDSVKDPGVNARETEEARKAFSYVVAAGTAIGGAYAAKAVVTQFISSMAASADVLAMAKIEVKLADIPEGRNVTFKWRGKPLFIRHRAAAEIAKEQAVAISTLRDPQADSERVKDPKWLVLIGVCTHLGCVPVANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPKYEFPEPGLLVVG
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccEEEEccccccccEEEEEEccccEEEEEEcHHHHHHHHHccccccccccccccccccccEEEEEcccccccccccccccccccEEcccccccccccccccccccccccccccEEEccccEEEEc
******A*TDIKVPDFSH********************KAFSYVVAAGTAIGGAYAAKAVVTQFISSMAASADVLAMAKIEVKLADIPEGRNVTFKWRGKPLFIRHRAAAEIAKEQAVAISTLRDPQADSERVKDPKWLVLIGVCTHLGCVPVANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPKYEFPEPGLLVVG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SNQVRFAHTDIKVPDFSHYRRDSVKDPGVNARETEEARKAFSYVVAAGTAIGGAYAAKAVVTQFISSMAASADVLAMAKIEVKLADIPEGRNVTFKWRGKPLFIRHRAAAEIAKEQAVAISTLRDPQADSERVKDPKWLVLIGVCTHLGCVPVANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPKYEFPEPGLLVVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b-c1 complex subunit Rieske, mitochondrial The transit peptide of the Rieske protein seems to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.very confidentP13272
Cytochrome b-c1 complex subunit Rieske, mitochondrial Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c.very confidentP08067
Cytochrome b-c1 complex subunit Rieske, mitochondrial The transit peptide of the Rieske protein seems to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.very confidentQ9CR68

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005750 [CC]mitochondrial respiratory chain complex IIIconfidentGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0045275, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0005488 [MF]bindingconfidentGO:0003674
GO:0006122 [BP]mitochondrial electron transport, ubiquinol to cytochrome cconfidentGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0009060 [BP]aerobic respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0008121 [MF]ubiquinol-cytochrome-c reductase activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0003674, GO:0016679, GO:0015078, GO:0016681, GO:0016491
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0046677 [BP]response to antibioticprobableGO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.10.-.-Acting on diphenols and related substances as donors.probable
1.10.2.-With a cytochrome as acceptor.probable
1.10.2.2Ubiquinol--cytochrome-c reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RIE, chain A
Confidence level:very confident
Coverage over the Query: 76-202
View the alignment between query and template
View the model in PyMOL
Template: 1PP9, chain E
Confidence level:very confident
Coverage over the Query: 7-202
View the alignment between query and template
View the model in PyMOL