Diaphorina citri psyllid: psy17360


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MDPQQQFCLKWSSFGNNLVTTFETLFKSESLTDVTLFCEGVTFKAHKIILAACSKHFQDLFEAAPFCPNILIILDGTSSGNMSALLEFMYKGEVHVSQESLSGFLKAAESLQLLI
cccccCEEEEEcccHHHHHHHHHHHHccccCEEEEEEEccEEEEEHHHHHHHccHHHHHHHHHccccccCEEEEccccHHHHHHHHccHHcEEEEEEcccHHHHHHHHHHccccc
****QQFCLKWSSFGNNLVTTFETLFKSESLTDVTLFCEGVTFKAHKIILAACSKHFQDLFEAAPFCPNILIILDGTSSGNMSALLEFMYKGEVHVSQESLSGFLKAAESLQLLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPQQQFCLKWSSFGNNLVTTFETLFKSESLTDVTLFCEGVTFKAHKIILAACSKHFQDLFEAAPFCPNILIILDGTSSGNMSALLEFMYKGEVHVSQESLSGFLKAAESLQLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Longitudinals lacking protein-like Required, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development.confidentQ7KRI2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031519 [CC]PcG protein complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007435 [BP]salivary gland morphogenesisprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0007431, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0006342 [BP]chromatin silencingprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007426 [BP]tracheal outgrowth, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OHU, chain A
Confidence level:very confident
Coverage over the Query: 3-114
View the alignment between query and template
View the model in PyMOL