Query         psy17370
Match_columns 262
No_of_seqs    220 out of 1587
Neff          7.4 
Searched_HMMs 46136
Date          Fri Aug 16 20:41:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17370.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17370hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01370 KISc_KIP3_like Kinesin 100.0 9.8E-42 2.1E-46  313.6  15.6  164   99-262     1-187 (338)
  2 cd01368 KISc_KIF23_like Kinesi 100.0 2.1E-41 4.7E-46  312.1  16.1  162   99-262     2-188 (345)
  3 KOG4280|consensus              100.0   3E-42 6.6E-47  328.8   6.8  166   97-262     4-187 (574)
  4 KOG0243|consensus              100.0 2.3E-41   5E-46  336.0  13.0  167   96-262    47-242 (1041)
  5 cd01373 KISc_KLP2_like Kinesin 100.0 1.3E-40 2.9E-45  306.0  15.1  163   98-262     1-186 (337)
  6 PLN03188 kinesin-12 family pro 100.0 2.9E-40 6.3E-45  331.5  17.0  160   96-262    96-280 (1320)
  7 cd01365 KISc_KIF1A_KIF1B Kines 100.0 3.9E-40 8.4E-45  305.0  15.7  165   98-262     1-192 (356)
  8 cd01367 KISc_KIF2_like Kinesin 100.0 3.4E-40 7.3E-45  301.6  14.4  165   98-262     1-181 (322)
  9 KOG0242|consensus              100.0   6E-40 1.3E-44  322.6  13.3  166   97-262     5-185 (675)
 10 cd01376 KISc_KID_like Kinesin  100.0 4.2E-39 9.1E-44  294.0  15.9  164   99-262     1-178 (319)
 11 cd01374 KISc_CENP_E Kinesin mo 100.0 5.3E-39 1.2E-43  293.6  16.2  163   99-262     1-172 (321)
 12 cd01371 KISc_KIF3 Kinesin moto 100.0 4.3E-39 9.4E-44  295.6  15.2  165   98-262     1-184 (333)
 13 KOG0245|consensus              100.0 3.1E-40 6.8E-45  323.9   6.4  165   97-261     3-191 (1221)
 14 cd01369 KISc_KHC_KIF5 Kinesin  100.0 1.2E-38 2.5E-43  291.8  15.1  164   98-262     2-179 (325)
 15 KOG0240|consensus              100.0 2.4E-39 5.2E-44  303.2   9.9  167   96-262     5-185 (607)
 16 cd01364 KISc_BimC_Eg5 Kinesin  100.0 1.9E-38 4.2E-43  293.3  15.5  165   98-262     2-195 (352)
 17 cd01372 KISc_KIF4 Kinesin moto 100.0 5.9E-38 1.3E-42  288.8  13.8  161   99-262     2-182 (341)
 18 cd01366 KISc_C_terminal Kinesi 100.0 2.9E-37 6.2E-42  283.0  16.7  165   97-262     1-181 (329)
 19 cd01375 KISc_KIF9_like Kinesin 100.0 1.6E-37 3.5E-42  285.3  14.5  159   99-262     1-188 (334)
 20 cd00106 KISc Kinesin motor dom 100.0 1.4E-36 3.1E-41  277.9  16.5  164   99-262     1-181 (328)
 21 KOG0239|consensus              100.0 2.1E-37 4.6E-42  303.7   6.0  177   83-262   301-495 (670)
 22 smart00129 KISc Kinesin motor, 100.0 1.2E-35 2.6E-40  272.8  16.3  164   99-262     1-179 (335)
 23 KOG0246|consensus              100.0   6E-36 1.3E-40  280.1  12.6  170   93-262   203-397 (676)
 24 KOG0241|consensus              100.0 1.8E-36 3.8E-41  294.4   7.4  166   96-261     2-195 (1714)
 25 PF00225 Kinesin:  Kinesin moto 100.0 5.6E-35 1.2E-39  268.1   9.7  158  105-262     1-183 (335)
 26 KOG0247|consensus              100.0 2.4E-32 5.2E-37  262.1   7.3  164   97-262    30-284 (809)
 27 COG5059 KIP1 Kinesin-like prot  99.9 9.8E-28 2.1E-32  233.6   8.0  159   97-262    21-189 (568)
 28 KOG0244|consensus               99.9   1E-24 2.2E-29  214.8   2.0  152  106-261     1-168 (913)
 29 cd01363 Motor_domain Myosin an  99.7 2.9E-18 6.3E-23  145.3   3.2   53  156-209     8-60  (186)
 30 COG0556 UvrB Helicase subunit   95.7   0.014   3E-07   56.6   4.6   83  139-226     3-96  (663)
 31 PF00308 Bac_DnaA:  Bacterial d  95.0  0.0091   2E-07   51.8   0.8   50  139-191     3-52  (219)
 32 COG2805 PilT Tfp pilus assembl  93.2   0.039 8.4E-07   50.3   1.2   30  161-190   113-142 (353)
 33 PRK06893 DNA replication initi  93.1   0.046 9.9E-07   47.6   1.5   48  138-191    10-57  (229)
 34 COG2804 PulE Type II secretory  92.5   0.048   1E-06   52.7   0.9   32  161-192   246-277 (500)
 35 PRK14086 dnaA chromosomal repl  92.0   0.055 1.2E-06   53.8   0.6   52  137-191   281-332 (617)
 36 PRK09087 hypothetical protein;  91.9   0.075 1.6E-06   46.3   1.3   49  137-191    14-62  (226)
 37 PRK06620 hypothetical protein;  91.7   0.059 1.3E-06   46.6   0.5   52  137-192     9-63  (214)
 38 PRK05642 DNA replication initi  90.9   0.099 2.2E-06   45.7   1.1   48  137-191    12-63  (234)
 39 PRK06526 transposase; Provisio  90.0    0.13 2.9E-06   45.7   1.1   40  147-191    77-116 (254)
 40 PRK14088 dnaA chromosomal repl  89.9    0.11 2.3E-06   49.9   0.4   51  137-191    98-148 (440)
 41 PRK08084 DNA replication initi  89.1    0.17 3.7E-06   44.2   1.0   49  137-191    15-63  (235)
 42 PF04851 ResIII:  Type III rest  88.7    0.16 3.5E-06   41.2   0.6   19  173-191    25-43  (184)
 43 PRK14087 dnaA chromosomal repl  88.7    0.16 3.5E-06   48.8   0.7   49  140-191   111-159 (450)
 44 TIGR02928 orc1/cdc6 family rep  88.4    0.19 4.1E-06   46.3   0.9   49  141-190     8-57  (365)
 45 PRK12377 putative replication   88.2    0.21 4.6E-06   44.3   1.0   49  141-191    71-119 (248)
 46 PRK08116 hypothetical protein;  87.8    0.18 3.8E-06   45.2   0.2   53  137-191    78-132 (268)
 47 TIGR00362 DnaA chromosomal rep  87.7     0.2 4.2E-06   47.3   0.6   52  137-191   103-154 (405)
 48 PRK00149 dnaA chromosomal repl  87.2    0.23 4.9E-06   47.6   0.6   52  137-191   115-166 (450)
 49 PRK00411 cdc6 cell division co  87.1    0.27 5.9E-06   45.8   1.1   46  144-190    26-72  (394)
 50 cd00009 AAA The AAA+ (ATPases   86.6    0.29 6.3E-06   37.5   0.9   19  172-190    18-36  (151)
 51 PF01935 DUF87:  Domain of unkn  86.1    0.24 5.2E-06   42.6   0.2   15  176-190    26-40  (229)
 52 PRK07952 DNA replication prote  86.0    0.34 7.5E-06   42.8   1.1   50  140-191    68-117 (244)
 53 cd00046 DEXDc DEAD-like helica  86.0    0.26 5.7E-06   37.3   0.3   17  176-192     3-19  (144)
 54 PRK08903 DnaA regulatory inact  85.7    0.36 7.9E-06   41.5   1.1   49  137-190    11-59  (227)
 55 TIGR02533 type_II_gspE general  85.3    0.34 7.3E-06   47.1   0.7   28  164-191   233-260 (486)
 56 PF00270 DEAD:  DEAD/DEAH box h  85.2    0.38 8.3E-06   38.7   1.0   27  163-191     6-32  (169)
 57 TIGR02538 type_IV_pilB type IV  85.0     0.3 6.5E-06   48.4   0.3   28  164-191   307-334 (564)
 58 PRK08181 transposase; Validate  84.9    0.49 1.1E-05   42.4   1.6   20  170-191   105-124 (269)
 59 PRK10436 hypothetical protein;  84.8    0.33 7.1E-06   46.9   0.4   28  164-191   209-236 (462)
 60 PF13401 AAA_22:  AAA domain; P  84.2    0.32 6.9E-06   37.6   0.1   18  173-190     4-21  (131)
 61 COG1484 DnaC DNA replication p  84.2    0.45 9.7E-06   42.3   1.0   49  139-190    74-122 (254)
 62 PF13245 AAA_19:  Part of AAA d  83.9    0.42   9E-06   34.4   0.6   25  166-191     4-28  (76)
 63 COG0593 DnaA ATPase involved i  83.9     0.4 8.7E-06   45.5   0.6   49  137-191    80-131 (408)
 64 PF00437 T2SE:  Type II/IV secr  83.7    0.34 7.3E-06   42.9   0.0   18  173-190   127-144 (270)
 65 COG1474 CDC6 Cdc6-related prot  83.6    0.47   1E-05   44.5   0.9   26  165-190    33-59  (366)
 66 PF12846 AAA_10:  AAA-like doma  82.9    0.41 8.8E-06   42.2   0.2   19  173-191     1-19  (304)
 67 TIGR01420 pilT_fam pilus retra  82.6    0.52 1.1E-05   43.6   0.8   28  164-191   113-140 (343)
 68 PRK06835 DNA replication prote  82.6    0.54 1.2E-05   43.4   0.9   30  161-191   172-201 (329)
 69 PF01695 IstB_IS21:  IstB-like   82.5    0.64 1.4E-05   38.9   1.2   17  175-191    49-65  (178)
 70 PRK08727 hypothetical protein;  82.1     0.5 1.1E-05   41.2   0.5   18  174-191    42-59  (233)
 71 PRK08939 primosomal protein Dn  82.1    0.52 1.1E-05   43.1   0.6   50  141-191   124-174 (306)
 72 cd01129 PulE-GspE PulE/GspE Th  81.9    0.57 1.2E-05   41.8   0.8   28  164-191    71-98  (264)
 73 PF06309 Torsin:  Torsin;  Inte  81.7    0.34 7.3E-06   38.6  -0.7   18  173-190    52-70  (127)
 74 TIGR02524 dot_icm_DotB Dot/Icm  80.8    0.68 1.5E-05   43.3   0.9   23  169-191   130-152 (358)
 75 TIGR02525 plasmid_TraJ plasmid  80.7    0.67 1.5E-05   43.5   0.8   19  172-190   148-166 (372)
 76 PRK13894 conjugal transfer ATP  80.6    0.62 1.3E-05   42.9   0.5   27  163-190   139-165 (319)
 77 cd01131 PilT Pilus retraction   80.6    0.57 1.2E-05   39.7   0.3   18  174-191     2-19  (198)
 78 TIGR03015 pepcterm_ATPase puta  79.9    0.91   2E-05   39.8   1.3   45  146-190    12-60  (269)
 79 PTZ00454 26S protease regulato  79.4    0.58 1.3E-05   44.3  -0.1   92   99-190    88-196 (398)
 80 smart00382 AAA ATPases associa  79.0    0.68 1.5E-05   34.9   0.2   16  175-190     4-19  (148)
 81 TIGR00631 uvrb excinuclease AB  78.5     1.2 2.6E-05   45.0   1.9   81  141-226     2-93  (655)
 82 PTZ00112 origin recognition co  78.3    0.99 2.1E-05   47.1   1.2   28  163-190   769-798 (1164)
 83 PRK12422 chromosomal replicati  78.3    0.88 1.9E-05   43.8   0.8   52  137-191   104-159 (445)
 84 PRK09183 transposase/IS protei  78.2     1.1 2.4E-05   39.8   1.4   20  170-191   101-120 (259)
 85 PF13604 AAA_30:  AAA domain; P  78.1    0.87 1.9E-05   38.6   0.6   27  164-190     9-35  (196)
 86 PRK13833 conjugal transfer pro  77.7    0.85 1.8E-05   42.0   0.5   27  163-190   135-161 (323)
 87 TIGR02782 TrbB_P P-type conjug  77.1    0.89 1.9E-05   41.4   0.4   27  163-190   123-149 (299)
 88 PTZ00361 26 proteosome regulat  76.8     1.5 3.3E-05   42.1   1.9   91  100-190   127-234 (438)
 89 TIGR01242 26Sp45 26S proteasom  76.8     1.2 2.7E-05   41.3   1.3   16  175-190   158-173 (364)
 90 TIGR03420 DnaA_homol_Hda DnaA   76.5     1.3 2.7E-05   37.8   1.2   45  139-190    10-55  (226)
 91 PHA00729 NTP-binding motif con  76.4     1.4 3.1E-05   38.5   1.5   29  162-190     6-34  (226)
 92 cd01130 VirB11-like_ATPase Typ  76.2     1.1 2.3E-05   37.6   0.6   28  162-190    15-42  (186)
 93 COG5008 PilU Tfp pilus assembl  76.1     1.6 3.5E-05   39.4   1.8   28  163-190   117-144 (375)
 94 PF13479 AAA_24:  AAA domain     75.8     1.2 2.5E-05   38.3   0.8   20  173-192     3-22  (213)
 95 PF13191 AAA_16:  AAA ATPase do  75.5    0.99 2.1E-05   36.8   0.2   27  164-190    15-41  (185)
 96 PF05970 PIF1:  PIF1-like helic  75.3       1 2.2E-05   42.1   0.3   37  150-190     3-39  (364)
 97 PF01637 Arch_ATPase:  Archaeal  74.8    0.86 1.9E-05   38.3  -0.3   27  164-190    11-37  (234)
 98 COG5059 KIP1 Kinesin-like prot  74.8    0.19 4.1E-06   49.8  -4.9  104   98-209   305-416 (568)
 99 PF00448 SRP54:  SRP54-type pro  74.5     1.1 2.4E-05   38.1   0.3   15  176-190     4-18  (196)
100 KOG0989|consensus               74.0     1.3 2.9E-05   40.5   0.7   30  161-190    44-74  (346)
101 PRK13900 type IV secretion sys  74.0     1.3 2.8E-05   41.0   0.6   27  163-190   151-177 (332)
102 COG1201 Lhr Lhr-like helicases  73.1     2.1 4.7E-05   44.1   2.0   36  164-210    30-65  (814)
103 smart00487 DEXDc DEAD-like hel  73.1     1.8 3.8E-05   34.9   1.2   27  164-191    16-42  (201)
104 PF01580 FtsK_SpoIIIE:  FtsK/Sp  72.3     1.2 2.5E-05   37.7  -0.1   46  175-237    40-85  (205)
105 PF02562 PhoH:  PhoH-like prote  71.6     2.1 4.4E-05   36.9   1.3   19  172-190    18-36  (205)
106 PF13086 AAA_11:  AAA domain; P  71.4     1.7 3.6E-05   36.5   0.7   26  165-191    10-35  (236)
107 PF13207 AAA_17:  AAA domain; P  71.4     1.8 3.8E-05   32.9   0.8   16  175-190     1-16  (121)
108 PRK06921 hypothetical protein;  71.2     1.8 3.9E-05   38.7   0.9   19  173-191   117-135 (266)
109 PRK12402 replication factor C   70.5     1.8   4E-05   39.1   0.8   20  171-190    34-53  (337)
110 PF00910 RNA_helicase:  RNA hel  70.3     1.3 2.7E-05   33.7  -0.3   15  176-190     1-15  (107)
111 PRK03992 proteasome-activating  70.1       2 4.4E-05   40.4   1.0   51  140-190   127-182 (389)
112 PHA02544 44 clamp loader, smal  69.7     1.8   4E-05   39.0   0.6   21  170-190    39-60  (316)
113 PF07693 KAP_NTPase:  KAP famil  69.5     2.2 4.8E-05   38.4   1.1   20  171-190    18-37  (325)
114 PF00004 AAA:  ATPase family as  69.3     1.8   4E-05   33.0   0.4   15  176-190     1-15  (132)
115 COG1222 RPT1 ATP-dependent 26S  69.2     4.1 8.9E-05   38.2   2.8  118   97-214    92-243 (406)
116 cd00268 DEADc DEAD-box helicas  69.0     2.5 5.4E-05   35.2   1.2   24  164-189    29-52  (203)
117 PTZ00424 helicase 45; Provisio  68.8     2.2 4.9E-05   39.7   1.0   26  163-190    57-82  (401)
118 PF00063 Myosin_head:  Myosin h  68.7     1.9   4E-05   43.7   0.5   21  170-190    82-102 (689)
119 PF13671 AAA_33:  AAA domain; P  68.6     2.2 4.7E-05   33.3   0.8   15  176-190     2-16  (143)
120 KOG0354|consensus               68.4     3.3 7.1E-05   42.2   2.1   24  163-189    69-92  (746)
121 PRK11776 ATP-dependent RNA hel  67.7       3 6.5E-05   39.9   1.6   24  164-189    34-57  (460)
122 KOG2373|consensus               67.6     4.1   9E-05   38.2   2.4   27  163-190   261-290 (514)
123 PRK11192 ATP-dependent RNA hel  67.5     2.5 5.4E-05   40.0   1.0   25  163-189    30-54  (434)
124 PRK04837 ATP-dependent RNA hel  67.4     2.5 5.4E-05   40.0   1.0   24  164-189    38-61  (423)
125 PF07724 AAA_2:  AAA domain (Cd  66.8     2.1 4.6E-05   35.6   0.4   17  174-190     4-20  (171)
126 TIGR03499 FlhF flagellar biosy  66.2     2.2 4.7E-05   38.4   0.4   17  175-191   196-212 (282)
127 TIGR00614 recQ_fam ATP-depende  66.0     3.2 6.9E-05   40.0   1.4   26  163-190    18-43  (470)
128 PRK13342 recombination factor   66.0     2.6 5.6E-05   40.0   0.8   41  149-190    13-53  (413)
129 PRK04328 hypothetical protein;  65.9     4.9 0.00011   35.3   2.5   26  163-188    10-38  (249)
130 TIGR00635 ruvB Holliday juncti  65.2     2.1 4.6E-05   38.4   0.0   43  147-190     3-47  (305)
131 PF00580 UvrD-helicase:  UvrD/R  65.1     2.2 4.7E-05   37.8   0.1   20  172-191    12-31  (315)
132 PRK10590 ATP-dependent RNA hel  64.8     3.3 7.1E-05   39.7   1.3   25  163-189    30-54  (456)
133 KOG0926|consensus               64.6     4.3 9.4E-05   41.8   2.1   18  173-190   271-288 (1172)
134 PRK13851 type IV secretion sys  64.3     2.4 5.2E-05   39.4   0.2   26  163-190   153-179 (344)
135 PRK12723 flagellar biosynthesi  63.9     2.8 6.1E-05   39.7   0.6   18  173-190   174-191 (388)
136 TIGR02237 recomb_radB DNA repa  63.6     4.1 8.9E-05   34.3   1.5   25  166-190     2-29  (209)
137 PLN00020 ribulose bisphosphate  63.4     3.2 6.9E-05   39.3   0.9   52  138-189   109-164 (413)
138 PF13238 AAA_18:  AAA domain; P  63.4       3 6.5E-05   31.6   0.6   15  176-190     1-15  (129)
139 KOG2543|consensus               63.1     2.7 5.8E-05   39.7   0.3   35  176-226    33-67  (438)
140 COG1223 Predicted ATPase (AAA+  62.7     2.9 6.2E-05   37.8   0.4   40  174-213   152-208 (368)
141 PF07728 AAA_5:  AAA domain (dy  62.5     2.7 5.8E-05   32.9   0.2   15  176-190     2-16  (139)
142 PRK13764 ATPase; Provisional    62.2       3 6.5E-05   41.7   0.5   18  174-191   258-275 (602)
143 PRK11331 5-methylcytosine-spec  62.1     3.8 8.2E-05   39.6   1.2   28  161-190   184-211 (459)
144 TIGR00348 hsdR type I site-spe  62.1     4.1 8.8E-05   41.3   1.4   28  163-191   249-281 (667)
145 PRK10536 hypothetical protein;  62.0     4.4 9.6E-05   36.2   1.5   40  141-190    52-91  (262)
146 PLN03025 replication factor C   61.2     3.5 7.6E-05   37.5   0.8   16  175-190    36-51  (319)
147 TIGR02788 VirB11 P-type DNA tr  61.2     3.8 8.2E-05   37.3   0.9   27  163-190   135-161 (308)
148 PF06414 Zeta_toxin:  Zeta toxi  61.1     3.3 7.2E-05   34.9   0.5   18  173-190    15-32  (199)
149 smart00242 MYSc Myosin. Large   60.6     4.3 9.3E-05   41.2   1.3   21  170-190    89-109 (677)
150 PRK14722 flhF flagellar biosyn  60.2     3.5 7.7E-05   38.8   0.6   17  174-190   138-154 (374)
151 PRK11448 hsdR type I restricti  59.9     2.8   6E-05   45.0  -0.2   26  166-192   427-452 (1123)
152 PHA02653 RNA helicase NPH-II;   59.8     5.6 0.00012   40.4   1.9   25  163-189   171-195 (675)
153 PRK06547 hypothetical protein;  59.4     5.6 0.00012   33.0   1.6   25  166-190     8-32  (172)
154 TIGR01389 recQ ATP-dependent D  59.0     4.9 0.00011   39.9   1.4   26  163-190    20-45  (591)
155 TIGR03877 thermo_KaiC_1 KaiC d  59.0     7.9 0.00017   33.6   2.5   26  163-188     8-36  (237)
156 PLN00206 DEAD-box ATP-dependen  59.0     6.9 0.00015   38.3   2.4   24  164-189   151-174 (518)
157 PF02456 Adeno_IVa2:  Adenoviru  58.1     3.3 7.2E-05   38.1  -0.0   15  176-190    90-104 (369)
158 PRK01297 ATP-dependent RNA hel  57.6     5.6 0.00012   38.3   1.5   26  163-190   116-141 (475)
159 cd01384 MYSc_type_XI Myosin mo  57.4     5.4 0.00012   40.5   1.3   21  170-190    85-105 (674)
160 TIGR02881 spore_V_K stage V sp  57.0       4 8.7E-05   36.0   0.3   17  174-190    43-59  (261)
161 PF06048 DUF927:  Domain of unk  56.9     5.3 0.00012   35.9   1.1   34  161-195   182-221 (286)
162 PHA02244 ATPase-like protein    56.8     6.4 0.00014   37.1   1.7   20  169-190   117-136 (383)
163 PF03215 Rad17:  Rad17 cell cyc  56.6       5 0.00011   39.5   0.9   29  162-190    32-62  (519)
164 PRK04537 ATP-dependent RNA hel  56.3     5.4 0.00012   39.6   1.2   25  164-190    39-63  (572)
165 COG1219 ClpX ATP-dependent pro  56.3     4.7  0.0001   37.4   0.7   15  174-188    98-112 (408)
166 PF05496 RuvB_N:  Holliday junc  56.3     7.6 0.00016   34.1   1.9   41  147-188    23-65  (233)
167 PRK06067 flagellar accessory p  56.1     7.1 0.00015   33.6   1.8   27  163-189    12-41  (234)
168 cd01385 MYSc_type_IX Myosin mo  55.9     6.1 0.00013   40.2   1.5   21  170-190    91-111 (692)
169 PRK13341 recombination factor   55.8     4.6  0.0001   41.3   0.6   21  170-190    49-69  (725)
170 PRK11634 ATP-dependent RNA hel  55.8     6.4 0.00014   39.6   1.6   25  164-190    36-60  (629)
171 PF04466 Terminase_3:  Phage te  55.5     3.9 8.4E-05   38.5   0.0   18  176-193     5-22  (387)
172 cd01382 MYSc_type_VI Myosin mo  55.5     5.6 0.00012   40.7   1.1   21  170-190    88-108 (717)
173 PRK13767 ATP-dependent helicas  55.2     5.8 0.00013   41.5   1.2   24  165-190    41-64  (876)
174 cd00124 MYSc Myosin motor doma  55.2     6.3 0.00014   40.0   1.5   21  170-190    83-103 (679)
175 cd01378 MYSc_type_I Myosin mot  55.1     6.3 0.00014   40.0   1.4   21  170-190    83-103 (674)
176 cd01383 MYSc_type_VIII Myosin   55.0     6.9 0.00015   39.8   1.7   21  170-190    89-109 (677)
177 KOG0727|consensus               54.7       5 0.00011   36.1   0.6  116   98-213    97-246 (408)
178 cd01377 MYSc_type_II Myosin mo  54.7     6.5 0.00014   40.1   1.4   21  170-190    88-108 (693)
179 cd01387 MYSc_type_XV Myosin mo  54.5     6.7 0.00014   39.9   1.5   21  170-190    84-104 (677)
180 COG2256 MGS1 ATPase related to  54.4     6.6 0.00014   37.3   1.3   37  151-188    27-63  (436)
181 smart00488 DEXDc2 DEAD-like he  54.3     5.1 0.00011   36.2   0.6   37  149-191     9-45  (289)
182 smart00489 DEXDc3 DEAD-like he  54.3     5.1 0.00011   36.2   0.6   37  149-191     9-45  (289)
183 TIGR02640 gas_vesic_GvpN gas v  54.0     6.7 0.00015   34.7   1.3   25  164-190    14-38  (262)
184 KOG0330|consensus               53.9     8.1 0.00018   36.6   1.8   25  164-190    91-115 (476)
185 PRK09361 radB DNA repair and r  53.9     8.7 0.00019   32.8   1.9   28  163-190    10-40  (225)
186 COG4096 HsdR Type I site-speci  53.6     9.6 0.00021   39.3   2.4   30  161-191   174-203 (875)
187 cd01381 MYSc_type_VII Myosin m  53.6     7.3 0.00016   39.5   1.6   21  170-190    83-103 (671)
188 PRK11057 ATP-dependent DNA hel  52.9       8 0.00017   38.7   1.7   25  163-189    32-56  (607)
189 TIGR01618 phage_P_loop phage n  52.8     5.7 0.00012   34.6   0.6   19  173-191    12-30  (220)
190 TIGR02655 circ_KaiC circadian   52.8      10 0.00022   36.8   2.4   26  163-188     8-36  (484)
191 PF06745 KaiC:  KaiC;  InterPro  52.7     9.2  0.0002   32.7   1.9   26  163-188     6-34  (226)
192 KOG0953|consensus               52.7     6.2 0.00013   39.0   0.9   39  175-213   193-237 (700)
193 KOG0335|consensus               52.6     6.3 0.00014   38.2   0.9   57  168-226   108-187 (482)
194 PRK00440 rfc replication facto  52.4       6 0.00013   35.3   0.7   21  170-190    35-55  (319)
195 cd01380 MYSc_type_V Myosin mot  52.2     7.5 0.00016   39.6   1.4   21  170-190    83-103 (691)
196 cd03274 ABC_SMC4_euk Eukaryoti  52.1     5.3 0.00011   34.3   0.3   13  178-190    30-42  (212)
197 PF10236 DAP3:  Mitochondrial r  52.1     6.6 0.00014   35.8   0.9   22  170-191    20-41  (309)
198 COG4962 CpaF Flp pilus assembl  51.3     6.1 0.00013   36.7   0.6   26  164-190   165-190 (355)
199 PRK05580 primosome assembly pr  51.0       5 0.00011   40.7  -0.1   17  174-190   163-179 (679)
200 PF12775 AAA_7:  P-loop contain  51.0     6.2 0.00013   35.3   0.6   27  163-190    24-50  (272)
201 TIGR03817 DECH_helic helicase/  50.9     8.3 0.00018   39.6   1.5   26  163-190    43-68  (742)
202 PRK00131 aroK shikimate kinase  50.8     6.8 0.00015   31.5   0.7   16  175-190     6-21  (175)
203 TIGR03158 cas3_cyano CRISPR-as  50.7       9  0.0002   35.6   1.6   26  165-190     6-31  (357)
204 cd01394 radB RadB. The archaea  50.4      11 0.00024   32.0   2.0   28  163-190     6-36  (218)
205 cd01126 TraG_VirD4 The TraG/Tr  50.3     7.8 0.00017   36.2   1.2   16  176-191     2-17  (384)
206 COG1125 OpuBA ABC-type proline  50.2     4.6 9.9E-05   36.4  -0.4   12  179-190    33-44  (309)
207 PRK05703 flhF flagellar biosyn  50.1       6 0.00013   37.8   0.4   17  175-191   223-239 (424)
208 cd02021 GntK Gluconate kinase   50.0     6.5 0.00014   31.1   0.5   15  176-190     2-16  (150)
209 PF00735 Septin:  Septin;  Inte  49.8     6.6 0.00014   35.4   0.5   19  171-189     2-20  (281)
210 cd01127 TrwB Bacterial conjuga  49.6     5.9 0.00013   37.6   0.2   17  174-190    43-59  (410)
211 PTZ00110 helicase; Provisional  49.6       8 0.00017   38.1   1.2   23  165-189   161-183 (545)
212 cd01120 RecA-like_NTPases RecA  49.5     6.8 0.00015   30.6   0.5   15  176-190     2-16  (165)
213 PRK04195 replication factor C   49.5     7.5 0.00016   37.6   0.9   28  163-190    28-56  (482)
214 PF05729 NACHT:  NACHT domain    49.3     6.9 0.00015   30.9   0.5   15  176-190     3-17  (166)
215 cd01123 Rad51_DMC1_radA Rad51_  49.2      11 0.00024   32.1   1.9   28  163-190     6-36  (235)
216 PF00931 NB-ARC:  NB-ARC domain  49.2      11 0.00023   33.2   1.8   29  162-190     6-36  (287)
217 PF10923 DUF2791:  P-loop Domai  49.2     8.3 0.00018   36.9   1.1   27  164-190    40-66  (416)
218 COG1419 FlhF Flagellar GTP-bin  48.7     7.6 0.00016   36.9   0.8   17  174-190   204-220 (407)
219 TIGR00376 DNA helicase, putati  48.7     8.3 0.00018   38.9   1.1   26  165-191   166-191 (637)
220 TIGR02902 spore_lonB ATP-depen  48.4     7.9 0.00017   38.1   0.9   42  141-190    62-103 (531)
221 KOG0348|consensus               48.3      11 0.00024   37.2   1.8   23  164-188   167-189 (708)
222 PRK00080 ruvB Holliday junctio  48.2     7.6 0.00017   35.4   0.7   43  147-190    24-68  (328)
223 TIGR03744 traC_PFL_4706 conjug  47.5     5.3 0.00012   41.9  -0.5   19  172-190   474-492 (893)
224 PRK07261 topology modulation p  47.5     7.7 0.00017   32.0   0.6   15  176-190     3-17  (171)
225 TIGR02746 TraC-F-type type-IV   47.2     6.6 0.00014   40.3   0.1   18  173-190   430-447 (797)
226 PRK10416 signal recognition pa  47.1     8.6 0.00019   35.3   0.9   17  174-190   115-131 (318)
227 COG0467 RAD55 RecA-superfamily  46.6      15 0.00032   32.3   2.2   25  164-188    11-38  (260)
228 KOG0651|consensus               46.5      11 0.00024   34.8   1.5   52  137-188   125-181 (388)
229 PRK15483 type III restriction-  46.4     5.9 0.00013   41.7  -0.3   13  181-193    67-79  (986)
230 PRK06995 flhF flagellar biosyn  46.2     7.4 0.00016   37.9   0.3   17  174-190   257-273 (484)
231 PF13476 AAA_23:  AAA domain; P  46.1     8.3 0.00018   31.5   0.6   17  174-190    20-36  (202)
232 PRK01172 ski2-like helicase; P  45.9      11 0.00024   38.0   1.5   24  164-189    30-53  (674)
233 TIGR01359 UMP_CMP_kin_fam UMP-  45.8     8.4 0.00018   31.5   0.6   14  176-189     2-15  (183)
234 cd01386 MYSc_type_XVIII Myosin  45.6     9.9 0.00021   39.2   1.1   21  170-190    83-103 (767)
235 cd01379 MYSc_type_III Myosin m  45.3     9.6 0.00021   38.6   1.0   21  170-190    83-103 (653)
236 cd00464 SK Shikimate kinase (S  45.3     8.6 0.00019   30.3   0.5   16  175-190     1-16  (154)
237 KOG3859|consensus               45.3      11 0.00024   34.3   1.2   29  162-190    30-59  (406)
238 TIGR03819 heli_sec_ATPase heli  45.0     8.6 0.00019   35.7   0.5   29  161-190   167-195 (340)
239 PF13555 AAA_29:  P-loop contai  44.6      10 0.00022   26.3   0.7   14  177-190    27-40  (62)
240 PRK11131 ATP-dependent RNA hel  44.5      12 0.00026   40.7   1.6   23  167-190    84-106 (1294)
241 TIGR01313 therm_gnt_kin carboh  44.4     7.5 0.00016   31.3   0.0   13  177-189     2-14  (163)
242 PF13173 AAA_14:  AAA domain     44.4     8.8 0.00019   29.8   0.4   16  175-190     4-19  (128)
243 PRK08118 topology modulation p  44.1     9.4  0.0002   31.4   0.6   13  176-188     4-16  (167)
244 TIGR02903 spore_lon_C ATP-depe  44.0      11 0.00024   37.8   1.2   42  141-190   151-192 (615)
245 PF03193 DUF258:  Protein of un  43.7      15 0.00032   30.4   1.7   26  163-190    27-52  (161)
246 COG0419 SbcC ATPase involved i  43.7      20 0.00043   37.7   3.0   32  177-210    29-67  (908)
247 cd01428 ADK Adenylate kinase (  43.4     9.7 0.00021   31.3   0.6   15  176-190     2-16  (194)
248 KOG0780|consensus               43.1      13 0.00029   35.3   1.5   73  153-226    76-167 (483)
249 TIGR03881 KaiC_arch_4 KaiC dom  43.1      15 0.00032   31.4   1.7   28  163-190     7-37  (229)
250 PRK06696 uridine kinase; Valid  43.1      14  0.0003   31.7   1.5   28  162-189     8-38  (223)
251 cd01850 CDC_Septin CDC/Septin.  43.0      11 0.00023   33.8   0.8   21  170-190     1-21  (276)
252 PRK10917 ATP-dependent DNA hel  42.8      11 0.00023   38.3   0.9   39  148-190   261-299 (681)
253 PRK06217 hypothetical protein;  42.6     9.8 0.00021   31.5   0.5   14  176-189     4-17  (183)
254 PF02534 T4SS-DNA_transf:  Type  42.4      17 0.00036   34.8   2.1   17  174-190    45-61  (469)
255 COG0630 VirB11 Type IV secreto  42.4     8.4 0.00018   35.3   0.0   17  175-191   145-161 (312)
256 PF08477 Miro:  Miro-like prote  42.1      11 0.00024   28.1   0.7   15  176-190     2-16  (119)
257 CHL00181 cbbX CbbX; Provisiona  42.1     9.9 0.00021   34.3   0.5   15  176-190    62-76  (287)
258 PLN03137 ATP-dependent DNA hel  42.1      15 0.00031   39.6   1.7   25  163-189   467-491 (1195)
259 cd01393 recA_like RecA is a  b  42.0      19 0.00041   30.5   2.2   28  163-190     6-36  (226)
260 PRK08233 hypothetical protein;  41.7      10 0.00022   30.7   0.5   15  176-190     6-20  (182)
261 TIGR01241 FtsH_fam ATP-depende  41.7       9  0.0002   37.2   0.1   16  175-190    90-105 (495)
262 PF10412 TrwB_AAD_bind:  Type I  41.6     8.9 0.00019   36.1   0.1   15  176-190    18-32  (386)
263 KOG0340|consensus               41.5      14  0.0003   34.7   1.3   41  163-205    36-82  (442)
264 TIGR01650 PD_CobS cobaltochela  41.5      15 0.00032   34.0   1.5   43  146-190    38-81  (327)
265 COG3829 RocR Transcriptional r  41.3      11 0.00024   37.2   0.6   44  137-186   238-281 (560)
266 cd02025 PanK Pantothenate kina  41.2       7 0.00015   33.7  -0.6   11  180-190     6-16  (220)
267 cd01124 KaiC KaiC is a circadi  41.1      12 0.00026   30.5   0.7   15  176-190     2-16  (187)
268 cd02020 CMPK Cytidine monophos  40.9      12 0.00027   29.0   0.8   14  176-189     2-15  (147)
269 PF00025 Arf:  ADP-ribosylation  40.9      19 0.00042   29.5   2.0   28  163-190     3-31  (175)
270 COG1131 CcmA ABC-type multidru  40.9     9.4  0.0002   34.5   0.1   12  179-190    37-48  (293)
271 TIGR02880 cbbX_cfxQ probable R  40.9      11 0.00023   33.9   0.5   16  175-190    60-75  (284)
272 TIGR02621 cas3_GSU0051 CRISPR-  40.8      15 0.00032   38.4   1.5   27  163-190    22-48  (844)
273 KOG1803|consensus               40.6      11 0.00024   37.5   0.6   17  175-191   203-219 (649)
274 TIGR00929 VirB4_CagE type IV s  40.5     8.6 0.00019   39.3  -0.2   18  173-190   434-451 (785)
275 PHA01747 putative ATP-dependen  40.2      14 0.00031   34.9   1.1   30  161-190   178-207 (425)
276 CHL00081 chlI Mg-protoporyphyr  39.9     5.8 0.00012   37.0  -1.5   44  139-190    12-55  (350)
277 PRK00771 signal recognition pa  39.9      13 0.00027   35.9   0.8   18  173-190    95-112 (437)
278 cd01983 Fer4_NifH The Fer4_Nif  39.9      11 0.00024   26.5   0.3   15  176-190     2-16  (99)
279 PRK04040 adenylate kinase; Pro  39.8      12 0.00027   31.4   0.7   16  175-190     4-19  (188)
280 TIGR02236 recomb_radA DNA repa  39.7      20 0.00043   32.4   2.0   27  163-189    82-111 (310)
281 PRK12726 flagellar biosynthesi  39.7      10 0.00023   36.0   0.2   17  175-191   208-224 (407)
282 TIGR00064 ftsY signal recognit  39.6      13 0.00028   33.3   0.7   17  174-190    73-89  (272)
283 PF14532 Sigma54_activ_2:  Sigm  39.3      11 0.00024   29.6   0.3   20  171-190    19-38  (138)
284 TIGR02173 cyt_kin_arch cytidyl  39.3      12 0.00026   30.0   0.5   15  176-190     3-17  (171)
285 PRK11889 flhF flagellar biosyn  39.2      11 0.00023   36.2   0.2   17  174-190   242-258 (436)
286 TIGR02322 phosphon_PhnN phosph  38.7      11 0.00024   30.8   0.2   16  175-190     3-18  (179)
287 PRK14723 flhF flagellar biosyn  38.7      12 0.00027   38.5   0.6   17  174-190   186-202 (767)
288 PRK14974 cell division protein  38.6      14 0.00031   34.2   0.9   18  173-190   140-157 (336)
289 COG1196 Smc Chromosome segrega  38.4      18  0.0004   39.0   1.9   53  158-213    12-70  (1163)
290 PRK14721 flhF flagellar biosyn  38.1      13 0.00028   35.6   0.6   17  174-190   192-208 (420)
291 COG5019 CDC3 Septin family pro  38.1      19 0.00042   33.7   1.7   24  170-193    20-46  (373)
292 PHA02624 large T antigen; Prov  38.0      16 0.00034   36.8   1.1   26  165-190   421-448 (647)
293 TIGR02767 TraG-Ti Ti-type conj  38.0      19 0.00041   36.3   1.7   25  174-206   212-236 (623)
294 PRK04301 radA DNA repair and r  37.9      21 0.00046   32.4   2.0   28  163-190    89-119 (317)
295 TIGR01360 aden_kin_iso1 adenyl  37.9      14 0.00029   30.2   0.6   16  175-190     5-20  (188)
296 COG1126 GlnQ ABC-type polar am  37.8      16 0.00034   32.1   1.0   13  178-190    33-45  (240)
297 COG0396 sufC Cysteine desulfur  37.8      17 0.00037   32.1   1.3   28  167-194    18-54  (251)
298 PF04548 AIG1:  AIG1 family;  I  37.8      13 0.00027   31.8   0.4   16  175-190     2-17  (212)
299 PF00158 Sigma54_activat:  Sigm  37.7      15 0.00033   30.3   0.8   20  170-189    19-38  (168)
300 PF02367 UPF0079:  Uncharacteri  37.5      16 0.00035   28.8   1.0   24  167-191    10-33  (123)
301 PRK14729 miaA tRNA delta(2)-is  37.2      16 0.00034   33.4   0.9   14  175-188     6-19  (300)
302 PRK09270 nucleoside triphospha  37.1      16 0.00035   31.4   1.0   20  171-190    31-50  (229)
303 PTZ00014 myosin-A; Provisional  36.9      17 0.00037   37.8   1.2   21  170-190   180-200 (821)
304 cd02023 UMPK Uridine monophosp  36.9      12 0.00025   31.3   0.0   14  177-190     3-16  (198)
305 PF00485 PRK:  Phosphoribulokin  36.7      14 0.00031   30.8   0.6   15  176-190     2-16  (194)
306 PRK14531 adenylate kinase; Pro  36.6      14 0.00031   30.5   0.6   15  175-189     4-18  (183)
307 PRK13873 conjugal transfer ATP  36.6      12 0.00026   38.8   0.1   16  175-190   443-458 (811)
308 PRK13531 regulatory ATPase Rav  36.3      15 0.00033   35.8   0.8   26  163-190    31-56  (498)
309 PRK05342 clpX ATP-dependent pr  36.3      15 0.00032   35.1   0.6   17  174-190   109-125 (412)
310 PRK09401 reverse gyrase; Revie  36.2      21 0.00045   38.7   1.8   24  163-188    87-110 (1176)
311 KOG0745|consensus               36.1      16 0.00035   35.3   0.9   18  169-188   224-241 (564)
312 cd00820 PEPCK_HprK Phosphoenol  36.1      14 0.00031   28.4   0.5   15  176-190    18-32  (107)
313 PRK06762 hypothetical protein;  35.6      16 0.00034   29.4   0.7   14  175-188     4-17  (166)
314 COG1618 Predicted nucleotide k  35.4      52  0.0011   27.6   3.6   16  175-190     7-22  (179)
315 TIGR01967 DEAH_box_HrpA ATP-de  34.9      21 0.00047   38.9   1.7   23  167-190    77-99  (1283)
316 PRK10865 protein disaggregatio  34.7      16 0.00035   38.2   0.7   17  174-190   599-615 (857)
317 PF05673 DUF815:  Protein of un  34.6      19  0.0004   32.1   1.0   26  166-191    44-70  (249)
318 PRK13822 conjugal transfer cou  34.6      23 0.00051   35.8   1.8   17  174-190   225-241 (641)
319 PRK02362 ski2-like helicase; P  34.5      20 0.00044   36.6   1.4   21  168-190    36-56  (737)
320 COG1122 CbiO ABC-type cobalt t  34.5      18 0.00039   31.7   0.9   16  175-190    32-47  (235)
321 PRK14532 adenylate kinase; Pro  34.4      17 0.00036   30.0   0.6   14  176-189     3-16  (188)
322 PF02463 SMC_N:  RecF/RecN/SMC   34.4      18  0.0004   30.5   0.9   15  175-189    26-40  (220)
323 KOG0987|consensus               34.0      25 0.00055   34.7   1.9   36  150-190   119-154 (540)
324 TIGR00231 small_GTP small GTP-  34.0      14  0.0003   28.1   0.0   15  176-190     4-18  (161)
325 TIGR01587 cas3_core CRISPR-ass  33.9      19 0.00041   32.9   0.9   14  176-189     2-15  (358)
326 KOG0635|consensus               33.9      40 0.00086   28.1   2.7   29  166-194    24-69  (207)
327 PF12774 AAA_6:  Hydrolytic ATP  33.8      14 0.00031   32.3   0.1   14  177-190    36-49  (231)
328 TIGR03878 thermo_KaiC_2 KaiC d  33.8      24 0.00052   31.2   1.6   16  173-188    36-51  (259)
329 PRK03839 putative kinase; Prov  33.7      16 0.00035   29.9   0.5   14  176-189     3-16  (180)
330 TIGR00643 recG ATP-dependent D  33.7      21 0.00045   35.9   1.2   40  147-190   234-273 (630)
331 COG4185 Uncharacterized protei  33.6      23 0.00051   29.7   1.3   15  175-190     5-19  (187)
332 PRK13721 conjugal transfer ATP  33.6      15 0.00032   38.3   0.2   18  173-190   449-466 (844)
333 TIGR03263 guanyl_kin guanylate  33.6      20 0.00042   29.2   0.9   16  175-190     3-18  (180)
334 cd00983 recA RecA is a  bacter  33.6      33 0.00071   31.7   2.4   30  161-190    39-72  (325)
335 PRK13853 type IV secretion sys  33.5      14 0.00031   38.1   0.1   18  173-190   426-443 (789)
336 KOG1547|consensus               33.5      28  0.0006   31.2   1.9   30  159-188    31-61  (336)
337 PRK12724 flagellar biosynthesi  33.4      16 0.00034   35.1   0.3   17  174-190   224-240 (432)
338 cd02027 APSK Adenosine 5'-phos  33.4      17 0.00036   29.2   0.4   13  176-188     2-14  (149)
339 PRK11664 ATP-dependent RNA hel  33.4      21 0.00046   37.1   1.3   26  163-190    12-37  (812)
340 TIGR03689 pup_AAA proteasome A  33.4      17 0.00036   35.8   0.5   16  175-190   218-233 (512)
341 KOG1532|consensus               33.3      20 0.00044   32.7   1.0   19  172-190    18-36  (366)
342 CHL00195 ycf46 Ycf46; Provisio  33.3      15 0.00033   35.8   0.2   17  174-190   260-276 (489)
343 KOG0729|consensus               33.0      21 0.00046   32.5   1.0   40  175-214   213-269 (435)
344 COG0552 FtsY Signal recognitio  32.8      24 0.00053   32.7   1.4   20  171-190   137-156 (340)
345 PRK15429 formate hydrogenlyase  32.6      14 0.00031   37.4  -0.1   21  170-190   396-416 (686)
346 cd03240 ABC_Rad50 The catalyti  32.5      21 0.00046   30.3   0.9   16  175-190    24-39  (204)
347 TIGR00602 rad24 checkpoint pro  32.5      14 0.00031   37.3  -0.2   16  175-190   112-127 (637)
348 PRK09302 circadian clock prote  32.4      27 0.00059   33.9   1.8   27  163-189    18-47  (509)
349 PTZ00301 uridine kinase; Provi  32.3      14  0.0003   31.8  -0.3   11  179-189     9-19  (210)
350 COG3842 PotA ABC-type spermidi  32.2      16 0.00034   34.2   0.1   20  169-190    29-48  (352)
351 PRK13891 conjugal transfer pro  32.1      17 0.00038   37.9   0.4   18  173-190   488-505 (852)
352 PRK11545 gntK gluconate kinase  31.9      12 0.00025   30.6  -0.7   12  179-190     1-12  (163)
353 TIGR00382 clpX endopeptidase C  31.9      19 0.00041   34.4   0.6   17  174-190   117-133 (413)
354 KOG0652|consensus               31.8      21 0.00044   32.4   0.8   14  175-188   207-220 (424)
355 PF01745 IPT:  Isopentenyl tran  31.7      18  0.0004   31.6   0.5   15  176-190     4-18  (233)
356 PRK14961 DNA polymerase III su  31.7      17 0.00037   33.8   0.3   18  173-190    38-55  (363)
357 TIGR00235 udk uridine kinase.   31.7      19  0.0004   30.5   0.5   16  175-190     8-23  (207)
358 PRK14970 DNA polymerase III su  31.4      21 0.00046   33.0   0.8   25  166-190    31-56  (367)
359 PRK14962 DNA polymerase III su  31.3      22 0.00047   34.5   0.9   17  174-190    37-53  (472)
360 TIGR03238 dnd_assoc_3 dnd syst  31.3      23 0.00049   34.7   1.0   17  175-191    34-50  (504)
361 TIGR02238 recomb_DMC1 meiotic   31.2      39 0.00085   30.9   2.5   28  163-190    83-113 (313)
362 PTZ00035 Rad51 protein; Provis  31.2      36 0.00079   31.5   2.3   30  161-190   103-135 (337)
363 TIGR01817 nifA Nif-specific re  31.1      16 0.00035   35.7   0.0   45  140-190   192-236 (534)
364 cd00071 GMPK Guanosine monopho  31.1      21 0.00046   28.2   0.7   13  177-189     3-15  (137)
365 PRK11034 clpA ATP-dependent Cl  31.0      25 0.00054   36.3   1.4   18  173-190   488-505 (758)
366 COG0324 MiaA tRNA delta(2)-iso  30.8      24 0.00051   32.4   1.0   16  175-190     5-20  (308)
367 cd03279 ABC_sbcCD SbcCD and ot  30.8      19 0.00041   30.6   0.4   16  175-190    30-45  (213)
368 PRK14701 reverse gyrase; Provi  30.7      30 0.00064   38.9   1.9   24  163-188    86-109 (1638)
369 PRK12727 flagellar biosynthesi  30.7      18  0.0004   35.8   0.3   16  175-190   352-367 (559)
370 KOG2035|consensus               30.6      31 0.00067   31.5   1.7   28  163-190    23-51  (351)
371 TIGR01074 rep ATP-dependent DN  30.6      20 0.00044   36.0   0.6   19  174-192    15-33  (664)
372 TIGR01054 rgy reverse gyrase.   30.6      29 0.00062   37.7   1.8   25  163-189    85-109 (1171)
373 COG1117 PstB ABC-type phosphat  30.5      38 0.00083   29.8   2.2   39  175-224    34-73  (253)
374 PRK09354 recA recombinase A; P  30.5      35 0.00075   31.9   2.1   30  161-190    44-77  (349)
375 TIGR01547 phage_term_2 phage t  30.5      19 0.00041   33.7   0.3   16  176-191     4-19  (396)
376 PRK10820 DNA-binding transcrip  30.5      17 0.00037   35.6   0.0   47  138-190   198-244 (520)
377 TIGR02397 dnaX_nterm DNA polym  30.4      23 0.00049   32.3   0.8   22  169-190    31-53  (355)
378 PRK13889 conjugal transfer rel  30.4      25 0.00054   37.4   1.2   26  164-190   354-379 (988)
379 TIGR02639 ClpA ATP-dependent C  30.4      24 0.00051   36.2   1.1   17  174-190   485-501 (731)
380 PRK00300 gmk guanylate kinase;  30.3      24 0.00053   29.4   1.0   16  175-190     7-22  (205)
381 TIGR03880 KaiC_arch_3 KaiC dom  30.1      33 0.00072   29.2   1.8   25  165-189     5-32  (224)
382 cd02019 NK Nucleoside/nucleoti  30.1      24 0.00051   24.3   0.7   14  177-190     3-16  (69)
383 KOG0924|consensus               30.1      27 0.00059   35.7   1.4   20  171-190   369-388 (1042)
384 TIGR02655 circ_KaiC circadian   30.0      39 0.00084   32.8   2.4   27  163-189   250-279 (484)
385 KOG1970|consensus               29.9      25 0.00055   34.9   1.1   19  171-190   109-127 (634)
386 TIGR03117 cas_csf4 CRISPR-asso  29.8      19  0.0004   36.4   0.2   17  174-190    17-33  (636)
387 COG0513 SrmB Superfamily II DN  29.8      27 0.00058   34.2   1.3   26  163-190    58-83  (513)
388 PRK14530 adenylate kinase; Pro  29.7      23 0.00049   30.1   0.7   14  176-189     6-19  (215)
389 TIGR01351 adk adenylate kinase  29.7      22 0.00047   30.1   0.6   13  176-188     2-14  (210)
390 cd03242 ABC_RecF RecF is a rec  29.6      19 0.00042   31.9   0.2   14  177-190    25-38  (270)
391 COG1204 Superfamily II helicas  29.6      26 0.00056   36.2   1.1   20  168-189    44-63  (766)
392 COG1136 SalX ABC-type antimicr  29.5      23  0.0005   31.0   0.7   14  177-190    35-48  (226)
393 KOG0739|consensus               29.4      23 0.00049   32.8   0.6   44  146-189   135-182 (439)
394 PRK13850 type IV secretion sys  29.3      40 0.00087   34.3   2.5   28  171-206   137-164 (670)
395 PRK14527 adenylate kinase; Pro  29.3      26 0.00056   29.1   1.0   16  174-189     7-22  (191)
396 TIGR00595 priA primosomal prot  29.3      18 0.00039   35.4  -0.0   14  178-191     2-15  (505)
397 TIGR01243 CDC48 AAA family ATP  29.2      23  0.0005   36.2   0.8   16  175-190   214-229 (733)
398 PRK00091 miaA tRNA delta(2)-is  29.2      24 0.00052   32.3   0.8   15  175-189     6-20  (307)
399 PF01926 MMR_HSR1:  50S ribosom  29.1      26 0.00055   26.3   0.8   15  176-190     2-16  (116)
400 PRK13880 conjugal transfer cou  29.0      31 0.00066   34.9   1.6   17  174-190   176-192 (636)
401 TIGR03783 Bac_Flav_CT_G Bacter  28.9      19  0.0004   37.6   0.0   18  173-190   438-455 (829)
402 PRK13830 conjugal transfer pro  28.8      18 0.00039   37.6  -0.1   19  172-190   455-473 (818)
403 TIGR02759 TraD_Ftype type IV c  28.8      19 0.00042   35.7   0.1   15  176-190   179-193 (566)
404 TIGR00390 hslU ATP-dependent p  28.7      23  0.0005   34.1   0.6   17  174-190    48-64  (441)
405 PRK10689 transcription-repair   28.7      24 0.00052   38.1   0.8   38  148-189   600-637 (1147)
406 KOG0925|consensus               28.6      33 0.00071   33.7   1.6   20  171-190    60-79  (699)
407 PRK10867 signal recognition pa  28.6      27 0.00059   33.6   1.1   18  173-190   100-117 (433)
408 PLN03187 meiotic recombination  28.6      42 0.00091   31.2   2.3   28  161-188   111-141 (344)
409 PF14553 YqbF:  YqbF, hypotheti  28.4      25 0.00055   22.5   0.6    9  185-193     3-11  (43)
410 TIGR02688 conserved hypothetic  28.4      22 0.00048   34.2   0.4   20  170-191   208-227 (449)
411 COG1162 Predicted GTPases [Gen  28.4      33 0.00072   31.3   1.5   26  163-190   156-181 (301)
412 TIGR00174 miaA tRNA isopenteny  28.4      25 0.00055   31.8   0.8   15  176-190     2-16  (287)
413 PRK05057 aroK shikimate kinase  28.3      28  0.0006   28.7   0.9   16  175-190     6-21  (172)
414 cd02028 UMPK_like Uridine mono  28.2      23  0.0005   29.4   0.5   15  176-190     2-16  (179)
415 COG0610 Type I site-specific r  28.1      15 0.00033   38.9  -0.8   13  179-191   279-291 (962)
416 TIGR00554 panK_bact pantothena  28.0      16 0.00034   33.2  -0.7   16  175-190    64-79  (290)
417 PF05872 DUF853:  Bacterial pro  28.0      22 0.00048   34.5   0.4   12  179-190    25-36  (502)
418 COG3839 MalK ABC-type sugar tr  28.0      21 0.00045   33.2   0.1   13  178-190    34-46  (338)
419 COG1198 PriA Primosomal protei  28.0      23  0.0005   36.4   0.5   37  171-207   215-265 (730)
420 PRK14950 DNA polymerase III su  27.9      22 0.00047   35.4   0.3   28  163-190    26-55  (585)
421 COG0606 Predicted ATPase with   27.8      26 0.00057   34.1   0.8   28  170-202   197-224 (490)
422 TIGR02239 recomb_RAD51 DNA rep  27.8      46   0.001   30.4   2.4   28  163-190    83-113 (316)
423 KOG0344|consensus               27.7      28 0.00061   34.5   1.0   26  163-190   165-190 (593)
424 PF05707 Zot:  Zonular occluden  27.7      23  0.0005   29.6   0.4   14  177-190     4-17  (193)
425 PHA02530 pseT polynucleotide k  27.6      26 0.00055   31.2   0.7   15  175-189     4-18  (300)
426 KOG0742|consensus               27.6      28 0.00061   33.5   0.9   13  175-187   386-398 (630)
427 COG3587 Restriction endonuclea  27.5      36 0.00077   35.5   1.7   18  171-190    74-91  (985)
428 cd03272 ABC_SMC3_euk Eukaryoti  27.4      24 0.00053   30.3   0.5   13  178-190    28-40  (243)
429 PRK06851 hypothetical protein;  27.4      42 0.00091   31.6   2.1   28  163-190    20-47  (367)
430 COG3598 RepA RecA-family ATPas  27.3      42  0.0009   31.4   1.9   31  159-191    76-107 (402)
431 PRK06645 DNA polymerase III su  27.3      23 0.00051   34.7   0.4   22  169-190    38-60  (507)
432 PHA02774 E1; Provisional        27.3      33 0.00072   34.3   1.4   25  165-189   424-450 (613)
433 PRK00279 adk adenylate kinase;  27.3      28  0.0006   29.6   0.8   13  176-188     3-15  (215)
434 cd03115 SRP The signal recogni  27.2      24 0.00051   28.7   0.3   15  176-190     3-17  (173)
435 PRK10078 ribose 1,5-bisphospho  27.2      29 0.00062   28.7   0.9   15  176-190     5-19  (186)
436 TIGR00959 ffh signal recogniti  27.1      29 0.00063   33.3   1.0   18  173-190    99-116 (428)
437 PRK05416 glmZ(sRNA)-inactivati  27.0      21 0.00046   32.3   0.0   16  175-190     8-23  (288)
438 PF13304 AAA_21:  AAA domain; P  27.0      21 0.00045   29.4   0.0   12  179-190     5-16  (303)
439 PRK13946 shikimate kinase; Pro  26.9      26 0.00057   29.0   0.6   16  175-190    12-27  (184)
440 cd00544 CobU Adenosylcobinamid  26.8      29 0.00062   28.7   0.8   13  176-188     2-14  (169)
441 KOG0735|consensus               26.8      26 0.00057   36.0   0.6   17  174-190   702-718 (952)
442 TIGR01243 CDC48 AAA family ATP  26.7      27 0.00059   35.7   0.7   16  175-190   489-504 (733)
443 PRK06731 flhF flagellar biosyn  26.7      20 0.00043   32.2  -0.2   17  174-190    76-92  (270)
444 PF00005 ABC_tran:  ABC transpo  26.7      32 0.00069   26.4   1.0   15  176-190    14-28  (137)
445 TIGR01425 SRP54_euk signal rec  26.6      28 0.00061   33.4   0.8   18  173-190   100-117 (429)
446 TIGR03574 selen_PSTK L-seryl-t  26.6      26 0.00055   30.5   0.5   15  176-190     2-16  (249)
447 PLN02165 adenylate isopentenyl  26.5      27 0.00059   32.4   0.6   16  175-190    45-60  (334)
448 PRK03731 aroL shikimate kinase  26.4      27 0.00059   28.2   0.6   16  175-190     4-19  (171)
449 TIGR00176 mobB molybdopterin-g  26.4      22 0.00048   28.9   0.1   13  178-190     4-16  (155)
450 cd01853 Toc34_like Toc34-like   26.1      27 0.00058   30.9   0.5   19  172-190    30-48  (249)
451 KOG0922|consensus               26.1      37  0.0008   34.3   1.5   18  173-190    66-83  (674)
452 PRK00254 ski2-like helicase; P  26.0      30 0.00065   35.3   0.9   21  168-190    36-56  (720)
453 TIGR03345 VI_ClpV1 type VI sec  26.0      36 0.00078   35.6   1.5   17  174-190   597-613 (852)
454 TIGR00618 sbcc exonuclease Sbc  25.9      61  0.0013   34.6   3.2   21  174-194    27-54  (1042)
455 PRK15424 propionate catabolism  25.9      24 0.00053   34.8   0.2   21  169-189   238-258 (538)
456 PHA02558 uvsW UvsW helicase; P  25.8      40 0.00086   32.8   1.7   25  164-190   122-146 (501)
457 TIGR01970 DEAH_box_HrpB ATP-de  25.8      30 0.00064   36.1   0.8   17  174-190    18-34  (819)
458 PRK02496 adk adenylate kinase;  25.8      31 0.00067   28.3   0.8   14  176-189     4-17  (184)
459 TIGR02768 TraA_Ti Ti-type conj  25.7      33 0.00072   35.3   1.2   26  165-191   361-386 (744)
460 TIGR02329 propionate_PrpR prop  25.7      23 0.00049   34.9  -0.0   22  169-190   231-252 (526)
461 PRK09825 idnK D-gluconate kina  25.6      29 0.00064   28.7   0.6   16  175-190     5-20  (176)
462 PRK05480 uridine/cytidine kina  25.6      36 0.00078   28.6   1.2   16  175-190     8-23  (209)
463 TIGR01613 primase_Cterm phage/  25.5      21 0.00046   32.2  -0.3   27  164-190    64-93  (304)
464 PRK05800 cobU adenosylcobinami  25.5      31 0.00066   28.5   0.7   14  175-188     3-16  (170)
465 PRK05541 adenylylsulfate kinas  25.5      32  0.0007   28.0   0.9   16  175-190     9-24  (176)
466 cd03239 ABC_SMC_head The struc  25.4      30 0.00064   28.7   0.6   14  177-190    26-39  (178)
467 PRK08533 flagellar accessory p  25.1      32 0.00069   29.8   0.8   16  174-189    25-40  (230)
468 PF13481 AAA_25:  AAA domain; P  25.1      30 0.00065   28.4   0.6   16  175-190    34-49  (193)
469 PRK14528 adenylate kinase; Pro  25.1      30 0.00064   28.8   0.6   15  176-190     4-18  (186)
470 PLN02200 adenylate kinase fami  25.1      31 0.00068   30.0   0.8   16  174-189    44-59  (234)
471 PRK14955 DNA polymerase III su  24.9      36 0.00078   32.1   1.1   26  164-189    27-54  (397)
472 TIGR00763 lon ATP-dependent pr  24.9      22 0.00048   36.7  -0.3   16  175-190   349-364 (775)
473 PRK14951 DNA polymerase III su  24.8      28  0.0006   35.1   0.4   17  174-190    39-55  (618)
474 TIGR00580 mfd transcription-re  24.7      34 0.00073   36.2   1.0   20  171-190   470-489 (926)
475 PRK13949 shikimate kinase; Pro  24.7      33 0.00072   28.1   0.8   16  175-190     3-18  (169)
476 COG0563 Adk Adenylate kinase a  24.7      32 0.00069   28.8   0.7   13  176-188     3-15  (178)
477 PRK11823 DNA repair protein Ra  24.6      46   0.001   32.0   1.8   28  163-190    67-97  (446)
478 COG1643 HrpA HrpA-like helicas  24.5      39 0.00085   35.3   1.4   25  165-190    58-82  (845)
479 PRK04182 cytidylate kinase; Pr  24.5      32  0.0007   27.6   0.7   13  176-188     3-15  (180)
480 smart00763 AAA_PrkA PrkA AAA d  24.4      48   0.001   31.1   1.9   46  138-188    43-93  (361)
481 cd00227 CPT Chloramphenicol (C  24.4      33 0.00071   28.0   0.7   15  175-189     4-18  (175)
482 PRK07667 uridine kinase; Provi  24.2      40 0.00087   28.2   1.2   18  171-188    15-32  (193)
483 KOG0328|consensus               24.1      55  0.0012   30.0   2.1   25  164-190    57-81  (400)
484 PRK13909 putative recombinatio  23.9      22 0.00049   37.3  -0.5   11  181-191     6-16  (910)
485 CHL00176 ftsH cell division pr  23.9      31 0.00067   34.9   0.5   16  175-190   218-233 (638)
486 PF09439 SRPRB:  Signal recogni  23.9      36 0.00078   28.7   0.9   14  175-188     5-18  (181)
487 PRK05201 hslU ATP-dependent pr  23.9      30 0.00066   33.3   0.4   15  174-188    51-65  (443)
488 cd04139 RalA_RalB RalA/RalB su  23.9      34 0.00073   26.7   0.7   15  176-190     3-17  (164)
489 PRK14964 DNA polymerase III su  23.9      32 0.00069   33.7   0.6   27  164-190    24-52  (491)
490 TIGR02012 tigrfam_recA protein  23.9      52  0.0011   30.3   2.0   29  162-190    40-72  (321)
491 PRK14956 DNA polymerase III su  23.7      31 0.00068   33.6   0.5   16  175-190    42-57  (484)
492 PF13166 AAA_13:  AAA domain     23.7      40 0.00087   34.1   1.3   13  176-188    19-31  (712)
493 cd01860 Rab5_related Rab5-rela  23.7      40 0.00086   26.4   1.0   16  175-190     3-18  (163)
494 COG1118 CysA ABC-type sulfate/  23.6      24 0.00052   32.6  -0.3   13  178-190    33-45  (345)
495 PLN03186 DNA repair protein RA  23.6      63  0.0014   30.0   2.5   29  162-190   109-140 (342)
496 PF03969 AFG1_ATPase:  AFG1-lik  23.6      31 0.00067   32.3   0.4   16  175-190    64-79  (362)
497 cd01121 Sms Sms (bacterial rad  23.6      41 0.00088   31.6   1.2   28  163-190    69-99  (372)
498 TIGR01447 recD exodeoxyribonuc  23.5      28 0.00062   34.8   0.2   24  165-190   154-177 (586)
499 TIGR02639 ClpA ATP-dependent C  23.4      35 0.00076   34.9   0.8   40  148-191   182-221 (731)
500 cd02022 DPCK Dephospho-coenzym  23.4      32 0.00069   28.3   0.5   15  176-190     2-16  (179)

No 1  
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=100.00  E-value=9.8e-42  Score=313.65  Aligned_cols=164  Identities=23%  Similarity=0.298  Sum_probs=148.2

Q ss_pred             CeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC------------CCceeeeeceeeCCCCCcchhhcccchhhH
Q psy17370         99 RMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN------------AKSYTFKLDHCLGQDTDQTSVFTIIAQPLL  165 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~------------~~~~~f~FD~vf~~~~~q~~vy~~~~~plv  165 (262)
                      +|+|+|||||++..|.. +...+|.+.++...+..+..            ...+.|.||+||+++++|++||+.+++|+|
T Consensus         1 ~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vf~~~~~plv   80 (338)
T cd01370           1 SLTVAVRVRPFNEKEKQEGTRRVVKVVDDRMLVFDPKDEEDAFRNLRARRNKELKYSFDRVFDETSTQEEVYENTTKPLV   80 (338)
T ss_pred             CeEEEEEcCCCChhhhhcCCceEEEEcCCCEEEEcCCcccccccchhcccCCceEEEeccccCCCCCHHHHHHHHHHHHH
Confidence            59999999999999876 67788888877655544432            146899999999999999999999999999


Q ss_pred             hhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCC---CCc
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGC---GSW  235 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~---~~l  235 (262)
                      +.+++|+|+||||||||||||||||+|+..++|||||++++||..++.    ..+.|+|||+|||   ++|||.   ..|
T Consensus        81 ~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Giipr~~~~LF~~i~~~~~~~~~~v~vS~~EIyne~v~DLL~~~~~~l  160 (338)
T cd01370          81 DGVLNGYNATVFAYGATGAGKTHTMLGTDSDPGLMVLTMKDLFDKIEERKDDKEFEVSLSYLEIYNETIRDLLSPSSGPL  160 (338)
T ss_pred             HHHHCCCCceEEeeCCCCCCCeEEEcCCCCCCchHHHHHHHHHHhhhhcccCceEEEEEEEEEEECCEEEECCCCCCCCc
Confidence            999999999999999999999999999999999999999999998864    4689999999999   999995   579


Q ss_pred             eeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        236 RFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       236 ~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      +|++|.++++++.|++++.|.+.+|++
T Consensus       161 ~i~ed~~~~~~v~gl~~~~v~s~~e~~  187 (338)
T cd01370         161 ELREDPNQGIVVAGLTEHQPKSAEEIL  187 (338)
T ss_pred             eEEEcCCCCEEeCCcEEEEeCCHHHHH
Confidence            999999999999999999999999975


No 2  
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=100.00  E-value=2.1e-41  Score=312.15  Aligned_cols=162  Identities=26%  Similarity=0.326  Sum_probs=146.0

Q ss_pred             CeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC------------CCceeeeeceeeCCCCCcchhhcccchhhH
Q psy17370         99 RMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN------------AKSYTFKLDHCLGQDTDQTSVFTIIAQPLL  165 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~------------~~~~~f~FD~vf~~~~~q~~vy~~~~~plv  165 (262)
                      +|+|+||+||++..|.. .+..+|.+.++...+...+.            ...+.|.||+||+++++|++||+.++.|+|
T Consensus         2 ~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~tq~~vy~~~~~p~v   81 (345)
T cd01368           2 PVKVYLRVRPLSKDELESEDEGCIEVINSTTIQLHPPKGSAARKSERNGGQKETKFSFSKVFGPNTTQKEFFEGTALPLV   81 (345)
T ss_pred             CEEEEEEeCcCCchhhccCCCceEEEcCCCEEEEeCCccccccccccccCCCceEeecCeEECCCCCHHHHHHHHHHHHH
Confidence            79999999999999877 66777777766554433321            257899999999999999999999999999


Q ss_pred             hhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCccceEEEEEEEEEE---EEecCCC---------
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVI---AVDFGCG---------  233 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~~~~~~~vS~~EIy---l~Dll~~---------  233 (262)
                      +.+++|+|+||||||||||||||||+|+..++|||||++++||..+.+  +.|+|||+|||   |+|||..         
T Consensus        82 ~~~l~G~n~ti~aYGqtGSGKTyTm~G~~~~~Gli~r~~~~lF~~~~~--~~v~~S~~EIyne~v~DLL~~~~~~~~~~~  159 (345)
T cd01368          82 QDLLKGKNSLLFTYGVTNSGKTYTMQGSPGDGGILPRSLDVIFNSIGG--YSVFVSYVEIYNNYIYDLLEDSPSSTKKRQ  159 (345)
T ss_pred             HHHhCCCceEEEEeCCCCCCCeEEecCCCCCCchHHHHHHHHHHHHHh--eeEEEEEEEEeCCEeEeCCCCccccccCCC
Confidence            999999999999999999999999999999999999999999999877  99999999999   9999953         


Q ss_pred             CceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        234 SWRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       234 ~l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      .|.|++|.+++++|.|++++.|.+.+|++
T Consensus       160 ~l~i~ed~~~~~~i~gl~~~~v~s~~e~~  188 (345)
T cd01368         160 SLRLREDHNGNMYVAGLTEVEVSSTEEAR  188 (345)
T ss_pred             ceEEEECCCCCEEecCCEEEEeCCHHHHH
Confidence            58999999999999999999999999974


No 3  
>KOG4280|consensus
Probab=100.00  E-value=3e-42  Score=328.84  Aligned_cols=166  Identities=24%  Similarity=0.364  Sum_probs=148.6

Q ss_pred             CCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCC-----CceeeeeceeeCCCCCcchhhcccchhhHhhhhC
Q psy17370         97 CSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNA-----KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN  170 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~-----~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~  170 (262)
                      ..+|+|++|+||++..+.. ....++.++.....+.+.+..     ..+.|+||+||+++++|++||+.++.|+|+.+|+
T Consensus         4 ~~~v~vvvr~rPl~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~   83 (574)
T KOG4280|consen    4 ACKVKVVVRVRPLSAAERSELLKSILSVDPAHGRVSLKNPVAGIEGKPKSFTFDAVFDSDSTQDDVYQETVAPLVESVLE   83 (574)
T ss_pred             ccceeEEEeecCCCchhhhhhhccccccccccceeeecCCcccccCCCCCceeeeeecCCCCHHHHHHHHhHHHHHHHhc
Confidence            5689999999999998776 556666676666666554433     6788999999999999999999999999999999


Q ss_pred             CCceeEeeeeccCCCCceecCCC-CCCCchHhhhhhccccccCcc----ceEEEEEEEEEE---EEecCCC----Cceee
Q psy17370        171 GYNVCLFAYGQTGSGKSYRGDST-LNSSVLRPRVLFYPGFSWSHS----GWTGWVSCVVVI---AVDFGCG----SWRFE  238 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm~G~-~~~~Giipr~~~~lf~~~~~~----~~~~~vS~~EIy---l~Dll~~----~l~i~  238 (262)
                      |||+||||||||||||||||+|. +...|||||++.+||..+++.    .|.|+|||+|||   |+|||+.    .|.|+
T Consensus        84 GyNgtvFaYGQTGsGKTyTM~G~~~~~~GiiPraf~~LF~~I~~~~~~~~f~vrvS~lEiYnE~i~DLL~~~~~~~l~lr  163 (574)
T KOG4280|consen   84 GYNGTVFAYGQTGSGKTYTMIGPDPELRGLIPRAFEHLFRHIDERKEKTRFLVRVSYLEIYNESIRDLLSPVNPKGLELR  163 (574)
T ss_pred             ccCceEEEeccCCCCCceEeeCCChhhCCchhHHHHHHHHHHHhccccceEEEEeehHHHHhHHHHHHhCccCcCCceee
Confidence            99999999999999999999999 688999999999999999865    399999999999   9998864    89999


Q ss_pred             ecCCCcEEEcCceEEecCChhhhC
Q psy17370        239 SKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       239 ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      |+++.||||+|++++.|.++++++
T Consensus       164 e~p~~Gv~V~nlse~~v~s~~d~~  187 (574)
T KOG4280|consen  164 EDPKCGVYVENLSEMDVESAEDAQ  187 (574)
T ss_pred             EcCCCceEecCcceeecCCHHHHH
Confidence            999999999999999999999874


No 4  
>KOG0243|consensus
Probab=100.00  E-value=2.3e-41  Score=335.96  Aligned_cols=167  Identities=23%  Similarity=0.337  Sum_probs=145.8

Q ss_pred             CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC--C--CceeeeeceeeCCCCCcchhhcccchhhHhhhhC
Q psy17370         96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN--A--KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN  170 (262)
Q Consensus        96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~--~--~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~  170 (262)
                      ...||+|+|||||++++|.. ....+|.+++....|.+...  .  ..+.|+||+||++.+.|.+||+.++.|+|+.||.
T Consensus        47 ~~~NIqVivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~  126 (1041)
T KOG0243|consen   47 KEVNIQVIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLE  126 (1041)
T ss_pred             CCCceEEEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHHhc
Confidence            46799999999999999987 66667778775555544333  2  4789999999999999999999999999999999


Q ss_pred             CCceeEeeeeccCCCCceecCC--------CCCCCchHhhhhhccccccCc--cceEEEEEEEEEE---EEecCC-----
Q psy17370        171 GYNVCLFAYGQTGSGKSYRGDS--------TLNSSVLRPRVLFYPGFSWSH--SGWTGWVSCVVVI---AVDFGC-----  232 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm~G--------~~~~~Giipr~~~~lf~~~~~--~~~~~~vS~~EIy---l~Dll~-----  232 (262)
                      |||||||||||||+||||||.|        .+.++|||||++.+||..++.  .+|.++|||+|+|   |.|||.     
T Consensus       127 GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~~EYsvKVSfLELYNEEl~DLLa~~~~~  206 (1041)
T KOG0243|consen  127 GYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQGAEYSVKVSFLELYNEELTDLLASEDTS  206 (1041)
T ss_pred             cCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcCCeEEEEEEehhhhhHHHHHhcCCcccc
Confidence            9999999999999999999999        458999999999999999874  5899999999999   999985     


Q ss_pred             -CCceeeecC-----CCcEEEcCceEEecCChhhhC
Q psy17370        233 -GSWRFESKP-----SHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       233 -~~l~i~ed~-----~~~v~v~gl~~~~V~s~~e~l  262 (262)
                       ..+.++++.     ++||+|.|+.+..|.+..|+|
T Consensus       207 ~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~  242 (1041)
T KOG0243|consen  207 DKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIY  242 (1041)
T ss_pred             ccccccccCCcccCCcCcEEEecceeeeecchhHHH
Confidence             334566665     589999999999999999874


No 5  
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=100.00  E-value=1.3e-40  Score=306.02  Aligned_cols=163  Identities=23%  Similarity=0.331  Sum_probs=142.1

Q ss_pred             CCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeE
Q psy17370         98 SRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCL  176 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~i  176 (262)
                      .+|+|+||+||+...|.. ....++...+++..+....  ..+.|.||+||+++++|++||+.+++|+|+.+++|+|+||
T Consensus         1 ~~i~V~vRvRP~~~~e~~~~~~~~v~~~~~~~~~~~~~--~~~~f~FD~vf~~~~~q~~vy~~~~~p~v~~~~~G~n~ti   78 (337)
T cd01373           1 PAVKVVVRIRPPNEIEADGGQGQCLKKLSSDTLVWHSH--PPRMFTFDHVADSNTNQEDVFQSVGKPLVEDCLSGYNGSI   78 (337)
T ss_pred             CCeEEEEEcCcCChhhcccCCCeEEEEcCCCcEEeeCC--CCcEEeCCeEeCCCCCHHHHHHHHHHHHHHHHhCCCceeE
Confidence            379999999999998876 4455666655554444332  3689999999999999999999999999999999999999


Q ss_pred             eeeeccCCCCceecCCCC--------CCCchHhhhhhccccccCc--------cceEEEEEEEEEE---EEecCC---CC
Q psy17370        177 FAYGQTGSGKSYRGDSTL--------NSSVLRPRVLFYPGFSWSH--------SGWTGWVSCVVVI---AVDFGC---GS  234 (262)
Q Consensus       177 faYG~tgSGKTyTm~G~~--------~~~Giipr~~~~lf~~~~~--------~~~~~~vS~~EIy---l~Dll~---~~  234 (262)
                      ||||||||||||||+|+.        .++|||||++++||..++.        ..|.++|||+|||   ++|||.   ..
T Consensus        79 ~aYGqTGSGKTyTm~G~~~~~~~~~~~~~Giipr~~~~Lf~~i~~~~~~~~~~~~~~v~~S~~EIyne~v~DLL~~~~~~  158 (337)
T cd01373          79 FAYGQTGSGKTYTMMGPSSSDDESPHGLQGVIPRIFEYLFSLIQREEEKRGDGLKFLCKCSFLEIYNEQITDLLDPTSRN  158 (337)
T ss_pred             EEeCCCCCCceEEecCCCCccccccccCCCHHHHHHHHHHHHHHhhhhhcccCceEEEEEEEEeecCCEeeeCCCCCCCC
Confidence            999999999999999976        3689999999999987643        3789999999999   999985   56


Q ss_pred             ceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        235 WRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       235 l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      ++++++..+++++.|++++.|.+.+|++
T Consensus       159 l~i~e~~~~~~~v~gl~~~~v~s~~e~~  186 (337)
T cd01373         159 LKIREDIKKGVYVENLTEEYVSSYEDVY  186 (337)
T ss_pred             ceEEECCCCCEEeCCCEEEEeCCHHHHH
Confidence            9999999999999999999999999974


No 6  
>PLN03188 kinesin-12 family protein; Provisional
Probab=100.00  E-value=2.9e-40  Score=331.51  Aligned_cols=160  Identities=23%  Similarity=0.348  Sum_probs=138.1

Q ss_pred             CCCCeEEEEEeCCCCccccCCCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCcee
Q psy17370         96 ECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVC  175 (262)
Q Consensus        96 ~~~~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~  175 (262)
                      .+++|+|+|||||++..|. +...++.+.++.  +.+    ..+.|.||+||+++++|++||+.++.|||+.+|+|||+|
T Consensus        96 ~ds~VkV~VRVRPl~~~E~-g~~iV~~~s~ds--l~I----~~qtFtFD~VFdp~aTQedVFe~vv~PLV~svLdGyNaT  168 (1320)
T PLN03188         96 SDSGVKVIVRMKPLNKGEE-GEMIVQKMSNDS--LTI----NGQTFTFDSIADPESTQEDIFQLVGAPLVENCLAGFNSS  168 (1320)
T ss_pred             CCCCeEEEEEcCCCCCccC-CCeeEEEcCCCe--EEE----eCcEEeCCeeeCCCCCHHHHHHHHHHHHHHHHhcCCcce
Confidence            3679999999999998863 233344444333  333    357899999999999999999999999999999999999


Q ss_pred             EeeeeccCCCCceecCCCC----------CCCchHhhhhhccccccCc---------cceEEEEEEEEEE---EEecCC-
Q psy17370        176 LFAYGQTGSGKSYRGDSTL----------NSSVLRPRVLFYPGFSWSH---------SGWTGWVSCVVVI---AVDFGC-  232 (262)
Q Consensus       176 ifaYG~tgSGKTyTm~G~~----------~~~Giipr~~~~lf~~~~~---------~~~~~~vS~~EIy---l~Dll~-  232 (262)
                      |||||||||||||||+|+.          .++|||||++++||..+..         ..|.|+|||+|||   |+|||. 
T Consensus       169 IFAYGQTGSGKTYTM~G~~~~~~de~~s~~e~GIIPRaledLF~~I~e~q~k~~d~~~~y~V~vSyLEIYNEkI~DLLsp  248 (1320)
T PLN03188        169 VFAYGQTGSGKTYTMWGPANGLLEEHLSGDQQGLTPRVFERLFARINEEQIKHADRQLKYQCRCSFLEIYNEQITDLLDP  248 (1320)
T ss_pred             eecCCCCCCCCCEeeCCCCCcccccccccccCCchHHHHHHHHHHHHhhhhhccccccceEEEEEEEeeecCcceecccc
Confidence            9999999999999999963          5789999999999988752         3688999999999   999985 


Q ss_pred             --CCceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        233 --GSWRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       233 --~~l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                        .+|+|++|..+|+||.|++++.|.+.+|++
T Consensus       249 ~~k~L~IRED~kgGv~VeGLTEv~V~S~ED~l  280 (1320)
T PLN03188        249 SQKNLQIREDVKSGVYVENLTEEYVKTMKDVT  280 (1320)
T ss_pred             ccCCceEEEcCCCCeEeCCCeEEeCCCHHHHH
Confidence              569999999999999999999999999874


No 7  
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=100.00  E-value=3.9e-40  Score=305.02  Aligned_cols=165  Identities=28%  Similarity=0.398  Sum_probs=148.8

Q ss_pred             CCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcC-----CCCceeeeeceeeCCC-------CCcchhhcccchhh
Q psy17370         98 SRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVND-----NAKSYTFKLDHCLGQD-------TDQTSVFTIIAQPL  164 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~-----~~~~~~f~FD~vf~~~-------~~q~~vy~~~~~pl  164 (262)
                      ++|+|+||+||++..|.. ++..++.+.++...+..+.     ....+.|.||+||+++       ++|++||+.++.|+
T Consensus         1 ~~i~V~vRvRP~~~~E~~~~~~~~~~~~~~~v~v~~~~~~~~~~~~~~~f~FD~vf~~~~~~~~~~~tq~~vf~~~~~p~   80 (356)
T cd01365           1 ANVKVAVRVRPFNSREKNRGSKCIVQMPGKVTTLKNPKAADATRKKPKSFSFDHSYWSHDSEDPHYASQEDVFEDLGREL   80 (356)
T ss_pred             CCEEEEEEeCcCChhhhccCCceEEEECCCEEEEEcCCcccccccCceEEECCeEecccCCCCCCCCCHHHHHHHHHHHH
Confidence            479999999999999877 7777888888665565554     2468899999999998       99999999999999


Q ss_pred             HhhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEecCC----
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVDFGC----  232 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~Dll~----  232 (262)
                      |+.+++|+|+||||||||||||||||+|+..++|||||++++||..+..     ..+.|+|||+|||   ++|||.    
T Consensus        81 v~~~l~G~n~~i~ayGqtGSGKT~Tm~G~~~~~Gli~r~~~~Lf~~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~  160 (356)
T cd01365          81 LDHAFEGYNVCLFAYGQTGSGKSYTMMGYKEEKGIIPRLCEELFQRIESKKEQNLSYEVEVSYMEIYNEKVRDLLNPKKK  160 (356)
T ss_pred             HHHHhCCCceEEEEecCCCCCCeEEecCCCCCCchHHHHHHHHHHHHhhccccCceEEEEEEEEEEECCeeeeCCCCCcc
Confidence            9999999999999999999999999999999999999999999998864     3689999999999   999985    


Q ss_pred             --CCceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        233 --GSWRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       233 --~~l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                        ..|+++++..+++++.|++++.|.+.+|++
T Consensus       161 ~~~~l~i~~~~~~g~~v~gl~~~~v~s~~e~~  192 (356)
T cd01365         161 NKGNLKVREHPVLGPYVEDLSKVAVTSYEDIQ  192 (356)
T ss_pred             CCcCceEEECCCCCEEeCCCEEEEeCCHHHHH
Confidence              358999999999999999999999999974


No 8  
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=100.00  E-value=3.4e-40  Score=301.64  Aligned_cols=165  Identities=22%  Similarity=0.212  Sum_probs=146.1

Q ss_pred             CCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEE-cCCC-------CceeeeeceeeCCCCCcchhhcccchhhHhhh
Q psy17370         98 SRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKV-NDNA-------KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAA  168 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~-~~~~-------~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~  168 (262)
                      .+|+|+|||||++..|.. ++..++.+.+++..... +...       +.+.|+||+||+++++|++||+.+++|+|+.+
T Consensus         1 ~~i~V~vRvRP~~~~e~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vf~~~~~plv~~~   80 (322)
T cd01367           1 MKITVAVRKRPLNDKELSKGETDVVSCESNPTVTVHEPKTKVDLTKYIEKHTFRFDYVFDEAVTNEEVYRSTVKPLIPHV   80 (322)
T ss_pred             CCeEEEEEcCcCChhhhccCCceEEEECCCCEEEEecCccccccccccCCceEecceEECCCCCHHHHHHHHHHHHHHHH
Confidence            379999999999999876 56677777776332222 1111       36899999999999999999999999999999


Q ss_pred             hCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc--cceEEEEEEEEEE---EEecCC--CCceeeecC
Q psy17370        169 FNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH--SGWTGWVSCVVVI---AVDFGC--GSWRFESKP  241 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~--~~~~~~vS~~EIy---l~Dll~--~~l~i~ed~  241 (262)
                      ++|+|+||||||||||||||||+|+..++|||||++++||..+++  ..+.++|||+|||   ++|||.  ..+++++|.
T Consensus        81 ~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Glipr~~~~lf~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~l~i~~~~  160 (322)
T cd01367          81 FEGGVATCFAYGQTGSGKTYTMLGDENQEGLYALAARDIFRLLAQPNDDLGVTVSFFEIYGGKLFDLLNDRKRLSVLEDG  160 (322)
T ss_pred             hCCCceEEEeccCCCCCCceEecCcCCcCccHHHHHHHHHHHHhccccccEEEEEEEeeecCchhhhccCccceeEEEcC
Confidence            999999999999999999999999999999999999999999876  4899999999999   999884  689999999


Q ss_pred             CCcEEEcCceEEecCChhhhC
Q psy17370        242 SHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       242 ~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      .++++|.|++++.|.+.+|++
T Consensus       161 ~~~~~v~~l~~~~v~s~~e~~  181 (322)
T cd01367         161 KGNVQIVGLTEKPVTSVDELL  181 (322)
T ss_pred             CCCEEeCCCEEEEeCCHHHHH
Confidence            999999999999999999874


No 9  
>KOG0242|consensus
Probab=100.00  E-value=6e-40  Score=322.55  Aligned_cols=166  Identities=23%  Similarity=0.313  Sum_probs=149.4

Q ss_pred             CCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCC-----CceeeeeceeeCCCCCcchhhcccchhhHhhhhC
Q psy17370         97 CSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNA-----KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN  170 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~-----~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~  170 (262)
                      ...|.|+||+||++..+.. ++.+.|.+..+...+......     ....|.||+||+++++|++||+..++|+|..+++
T Consensus         5 ~~~i~V~vrvRP~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~y~FD~VF~~~~t~~~VYe~~tkpiv~~~l~   84 (675)
T KOG0242|consen    5 EEKILVSVRVRPLNEREDARGDRSDWHCINDTTLFKRVTKSLPEKSKPEKYEFDRVFGEESTQEDVYERTTKPLLLSVLE   84 (675)
T ss_pred             cceeEEEEEeCCCCccccccCCccceEecCCceeEeeccccccccccccceeeeeecCCCCCHHHHHHhccHHHHHHHhc
Confidence            4689999999999998554 677778887777655543322     2489999999999999999999999999999999


Q ss_pred             CCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc---cceEEEEEEEEEE---EEecCCCC---ceeeecC
Q psy17370        171 GYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH---SGWTGWVSCVVVI---AVDFGCGS---WRFESKP  241 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~---~~~~~~vS~~EIy---l~Dll~~~---l~i~ed~  241 (262)
                      |+|++|||||||||||||||.|...+|||||+++++||..+.+   +.|.+.|||+|||   |+|||+.+   |+|+||.
T Consensus        85 G~N~TVFAYG~TgSGKTyTM~G~~~~PGii~la~~dif~~I~~~~~r~f~v~vSYlEIYNE~I~DLL~~~~~~L~irED~  164 (675)
T KOG0242|consen   85 GFNATVFAYGQTGSGKTYTMSGSEDDPGIIPLAMKDIFEKIDKSGEREFSVRVSYLEIYNERIRDLLNPDGGDLRLREDS  164 (675)
T ss_pred             CcccceeeecCCCCCCceEEeccCCCCCeeehHHHHHHHHHHhcCCceeEEEEEEEEEeccccccccCCCCCCceEeEcC
Confidence            9999999999999999999999999999999999999998876   4799999999999   99999755   9999999


Q ss_pred             CCcEEEcCceEEecCChhhhC
Q psy17370        242 SHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       242 ~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      .+|++|.||++..|.|.+|++
T Consensus       165 ~~gi~V~gL~e~~v~s~e~~~  185 (675)
T KOG0242|consen  165 EGGIVVPGLTEETVSSREELL  185 (675)
T ss_pred             CCCEEecCCeeecCCCHHHHH
Confidence            999999999999999999974


No 10 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=100.00  E-value=4.2e-39  Score=294.05  Aligned_cols=164  Identities=21%  Similarity=0.255  Sum_probs=142.2

Q ss_pred             CeEEEEEeCCCCccccCCCcceEEEcCCc---eEEEEcCC---CCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCC
Q psy17370         99 RMTVAVRIRPLLVKELHMDVSSIEISPDR---REMKVNDN---AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGY  172 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~~~~~~i~~~~~~---~~i~~~~~---~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~  172 (262)
                      +|+|+|||||+...|.....++.....++   ..+.+...   ...+.|.||+||+++++|++||+.++.|+|+.+++|+
T Consensus         1 ~i~V~vRvRP~~~~e~~~~~~v~~~~~~~~~~~~v~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~~~G~   80 (319)
T cd01376           1 NVRVVVRVRPFLDCEEDSSSCVRGIDSDQGQAKSVEIENPRNRGETKKYQFDAFYGTECTQEDIFSREVKPIVPHLLSGQ   80 (319)
T ss_pred             CcEEEEEeCcCCccccCCCceEEEeCCCCCcceEEEEeCCCCCCCccEEecCeEECCCCCHHHHHHHHHHHHHHHHhCCC
Confidence            68999999999988855444433333322   23433322   2678999999999999999999999999999999999


Q ss_pred             ceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCcc--ceEEEEEEEEEE---EEecCC---CCceeeecCCCc
Q psy17370        173 NVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHS--GWTGWVSCVVVI---AVDFGC---GSWRFESKPSHE  244 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~~--~~~~~vS~~EIy---l~Dll~---~~l~i~ed~~~~  244 (262)
                      |+||||||||||||||||+|+..++|||||++++||..+++.  .+.|.|||+|||   ++|||.   ..++|+++++++
T Consensus        81 n~~i~ayG~tgSGKTyTm~G~~~~~Glipr~~~~Lf~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~~l~i~~~~~~~  160 (319)
T cd01376          81 NATVFAYGSTGAGKTHTMLGDPNEPGLIPRTLSDLLRMGRKQAWTGAFSMSYYEIYNEKVYDLLEPAKKELPIREDKDGN  160 (319)
T ss_pred             ceEEEEECCCCCCCcEEEeCCcCccchHHHHHHHHHHHHhhccccceEEEEEEEEECCEeeEccCCCCCCceEEEcCCCC
Confidence            999999999999999999999999999999999999888654  889999999999   999985   579999999999


Q ss_pred             EEEcCceEEecCChhhhC
Q psy17370        245 IYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       245 v~v~gl~~~~V~s~~e~l  262 (262)
                      +++.|++++.|.+.+|++
T Consensus       161 ~~v~gl~~~~v~s~~e~~  178 (319)
T cd01376         161 ILIVGLTSKPIKSMAEFE  178 (319)
T ss_pred             EEeeCCEEEEeCCHHHHH
Confidence            999999999999999874


No 11 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=100.00  E-value=5.3e-39  Score=293.56  Aligned_cols=163  Identities=22%  Similarity=0.345  Sum_probs=147.9

Q ss_pred             CeEEEEEeCCCCccccCCCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEee
Q psy17370         99 RMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFA  178 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifa  178 (262)
                      +|+|+||+||++..|...+.++|.+.++.. +...+....+.|.||+||+++++|++||+.++.|+|+.+++|+|+||||
T Consensus         1 ~V~V~vRvRP~~~~e~~~~~~~~~~~~~~~-v~~~~~~~~~~f~fd~vf~~~~~q~~vy~~~~~p~v~~~l~G~n~~i~a   79 (321)
T cd01374           1 KIKVSVRVRPLNPRESDNEQVAWSIDNDNT-ISLEESTPGQSFTFDRVFGGESTNREVYERIAKPVVRSALEGYNGTIFA   79 (321)
T ss_pred             CeEEEEEcCcCCcccccCCcceEEECCCCE-EEEcCCCCCeEEecCeEECCCCCHHHHHHHHHHHHHHHHHCCCceeEEe
Confidence            599999999999988776778888888744 4444445789999999999999999999999999999999999999999


Q ss_pred             eeccCCCCceecCCCCCCCchHhhhhhccccccCc---cceEEEEEEEEEE---EEecCC---CCceeeecCCCcEEEcC
Q psy17370        179 YGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH---SGWTGWVSCVVVI---AVDFGC---GSWRFESKPSHEIYLSV  249 (262)
Q Consensus       179 YG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~---~~~~~~vS~~EIy---l~Dll~---~~l~i~ed~~~~v~v~g  249 (262)
                      ||+|||||||||+|+..++|||||++++||..+.+   ..|.|+|||+|||   ++|||.   ..+++++|+.+++++.|
T Consensus        80 yG~tgSGKT~T~~G~~~~~Gli~r~~~~lf~~~~~~~~~~~~v~~S~~Eiy~e~v~DLL~~~~~~l~i~~~~~~~~~v~g  159 (321)
T cd01374          80 YGQTSSGKTFTMSGDEQEPGIIPLAVRDIFQRIQDTPDREFLLRVSYLEIYNEKIKDLLSPSPQELRIREDPNKGVVVAG  159 (321)
T ss_pred             ecCCCCCCceeccCCCCCCchHHHHHHHHHHHHhcccCceEEEEEEEEEEEcCEeEEccCCCCCCceEEECCCCCEEeCC
Confidence            99999999999999999999999999999987753   5889999999999   999985   56999999999999999


Q ss_pred             ceEEecCChhhhC
Q psy17370        250 SVLTDITKFIEVY  262 (262)
Q Consensus       250 l~~~~V~s~~e~l  262 (262)
                      ++++.|.+.+|++
T Consensus       160 l~~~~v~s~~e~~  172 (321)
T cd01374         160 LTEEIVTSPEHLL  172 (321)
T ss_pred             ceEEEeCCHHHHH
Confidence            9999999999874


No 12 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=100.00  E-value=4.3e-39  Score=295.58  Aligned_cols=165  Identities=22%  Similarity=0.336  Sum_probs=147.9

Q ss_pred             CCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC-----CCceeeeeceeeCCCCCcchhhcccchhhHhhhhCC
Q psy17370         98 SRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN-----AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNG  171 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~-----~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G  171 (262)
                      ++|+|+||+||++..|.. ++..++.++++...+.+...     ...+.|.||+||+++++|++||+.++.|+|+.+++|
T Consensus         1 ~~i~V~vRvRP~~~~e~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~f~fd~vf~~~~~q~~vy~~~~~plv~~~~~G   80 (333)
T cd01371           1 ENVKVVVRCRPLNKREKSEGAPEIVGVDENRGQVTVHNPKADAKEPPKVFTFDAVYDPNSTQEDVYNETARPLVDSVLEG   80 (333)
T ss_pred             CCeEEEEEcCcCChhhhhcCCCeEEEEcCCCCEEEEeCCcccccCCCceeeeccccCCCccHHHHHHHHHHHHHHHHhCC
Confidence            479999999999998876 66677888776666655432     267899999999999999999999999999999999


Q ss_pred             CceeEeeeeccCCCCceecCCCCC---CCchHhhhhhccccccCc---cceEEEEEEEEEE---EEecCC----CCceee
Q psy17370        172 YNVCLFAYGQTGSGKSYRGDSTLN---SSVLRPRVLFYPGFSWSH---SGWTGWVSCVVVI---AVDFGC----GSWRFE  238 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm~G~~~---~~Giipr~~~~lf~~~~~---~~~~~~vS~~EIy---l~Dll~----~~l~i~  238 (262)
                      +|+||||||+|||||||||+|+..   ++|||||++++||..+..   ..|.|.|||+|||   ++|||.    ..++++
T Consensus        81 ~n~~i~ayG~tgSGKTyTm~G~~~~~~~~Glipr~~~~Lf~~~~~~~~~~~~v~~S~~Eiy~e~v~DLL~~~~~~~l~i~  160 (333)
T cd01371          81 YNGTIFAYGQTGTGKTFTMEGVREPPELRGIIPNSFAHIFGHIAKAENVQFLVRVSYLEIYNEEVRDLLGKDQKKKLELK  160 (333)
T ss_pred             CceeEEecCCCCCCCcEeecCCCCcccccchHHHHHHHHHHHHhhccCccEEEEEEEEEeeCCeeeeCCCCCCCCceeEE
Confidence            999999999999999999999987   999999999999987754   5899999999999   999995    467999


Q ss_pred             ecCCCcEEEcCceEEecCChhhhC
Q psy17370        239 SKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       239 ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      +++.++++|.|++++.|.+.+|++
T Consensus       161 ~~~~~~~~v~~l~~~~v~s~~~~~  184 (333)
T cd01371         161 ERPDRGVYVKDLSMFVVKNAEEMD  184 (333)
T ss_pred             EcCCCCEEeCCCEEEEeCCHHHHH
Confidence            999999999999999999999874


No 13 
>KOG0245|consensus
Probab=100.00  E-value=3.1e-40  Score=323.90  Aligned_cols=165  Identities=27%  Similarity=0.376  Sum_probs=152.0

Q ss_pred             CCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCC-Cceeeeeceee-------CCCCCcchhhcccchhhHhh
Q psy17370         97 CSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNA-KSYTFKLDHCL-------GQDTDQTSVFTIIAQPLLDA  167 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~-~~~~f~FD~vf-------~~~~~q~~vy~~~~~plv~~  167 (262)
                      ..+|+|.||+||++.+|.. ...++|.+.++.+++..+.+. ....|+||+.|       +..++|..||+.++.++|++
T Consensus         3 ~ssv~VAVRVRPfn~rE~s~~~k~Vvqm~gn~ttii~~~~~k~~~~FtfD~SYWS~d~edPhfAsQ~qVYedlg~~mL~~   82 (1221)
T KOG0245|consen    3 GSSVKVAVRVRPFNAREKSRDAKCVVQMQGNTTTIINPKGSKDAPKFTFDYSYWSHDSEDPHFASQKQVYEDLGREMLDH   82 (1221)
T ss_pred             CCceEEEEEeccchhhhhhcccceEEEecCCceeeecCCCcccCCceecceeeecCCCCCCchhhHHHHHHHHhHHHHHH
Confidence            4689999999999999988 788999999999988887744 66779999999       44588999999999999999


Q ss_pred             hhCCCceeEeeeeccCCCCceecCCCC--CCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEecCC-----
Q psy17370        168 AFNGYNVCLFAYGQTGSGKSYRGDSTL--NSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVDFGC-----  232 (262)
Q Consensus       168 ~l~G~n~~ifaYG~tgSGKTyTm~G~~--~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~Dll~-----  232 (262)
                      +++|||+||||||||||||+|||+|..  +++|||||.|++||.++..     ..|.|.|||+|||   +.|||+     
T Consensus        83 AfEGYN~ClFAYGQTGSGKSYTMMG~~~~~e~GIIPrlCEeLF~ri~~nq~~~~sy~VevSymEIYcErVrDLL~~p~~k  162 (1221)
T KOG0245|consen   83 AFEGYNVCLFAYGQTGSGKSYTMMGFQEPDEPGIIPRLCEELFSRIADNQSQQMSYSVEVSYMEIYCERVRDLLNAPKSK  162 (1221)
T ss_pred             HhcccceEEEEeccCCCCcceeeeccCCCCCCCchhHHHHHHHHHHhhcccccceEEEEEeehhHHHHHHHHHhhCCCCC
Confidence            999999999999999999999999998  9999999999999999864     4899999999999   999885     


Q ss_pred             CCceeeecCCCcEEEcCceEEecCChhhh
Q psy17370        233 GSWRFESKPSHEIYLSVSVLTDITKFIEV  261 (262)
Q Consensus       233 ~~l~i~ed~~~~v~v~gl~~~~V~s~~e~  261 (262)
                      ++|++||++..|+||+.|+.+.|+|..|+
T Consensus       163 g~LRVREHP~lGPYVedLS~~aV~Sy~dI  191 (1221)
T KOG0245|consen  163 GGLRVREHPILGPYVEDLSKLAVTSYADI  191 (1221)
T ss_pred             CCceeeccCccChhHhHhhhcccccHHHH
Confidence            89999999999999999999999998774


No 14 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=100.00  E-value=1.2e-38  Score=291.77  Aligned_cols=164  Identities=25%  Similarity=0.349  Sum_probs=147.6

Q ss_pred             CCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeE
Q psy17370         98 SRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCL  176 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~i  176 (262)
                      ++|+|+||+||++..|.. ++..++.+.++ ..+.+......+.|.||+||+++++|++||+.+++|+|+.+++|+|+||
T Consensus         2 ~~i~V~vRvRP~~~~e~~~~~~~~v~~~~~-~~v~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~~~v~~~~~G~n~~i   80 (325)
T cd01369           2 CNIKVVCRFRPLNEKEELRGSKSIVKFPGE-DTVSIAGSDDGKTFSFDRVFPPNTTQEDVYNFVAKPIVDDVLNGYNGTI   80 (325)
T ss_pred             CCeEEEEEcCcCChhhhccCCceEEEEcCC-CEEEecCCCCceEEEcCeEECCCCCHHHHHHHHHHHHHHHHHcCccceE
Confidence            489999999999998865 66777888766 4555555567889999999999999999999999999999999999999


Q ss_pred             eeeeccCCCCceecCCCCC---CCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCC---CCceeeecCCC
Q psy17370        177 FAYGQTGSGKSYRGDSTLN---SSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGC---GSWRFESKPSH  243 (262)
Q Consensus       177 faYG~tgSGKTyTm~G~~~---~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~---~~l~i~ed~~~  243 (262)
                      ||||+|||||||||+|+..   ++|||||++++||..+.+    .+|.|+|||+|||   ++||+.   .+++++++..+
T Consensus        81 ~ayG~tgSGKT~Tm~G~~~~~~~~Giipr~~~~Lf~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~~l~i~~~~~~  160 (325)
T cd01369          81 FAYGQTGSGKTYTMEGPPGDPELKGIIPRIVHDIFEHISSMDENLEFHVKVSYLEIYMEKIRDLLDVSKDNLQVHEDKNR  160 (325)
T ss_pred             EEeCCCCCCceEEecCCCCccccCChHHHHHHHHHHHHhhccCCceEEEEEEEEEEECCChhhcccCccCCceEEEcCCC
Confidence            9999999999999999987   899999999999988754    3789999999999   999884   56999999999


Q ss_pred             cEEEcCceEEecCChhhhC
Q psy17370        244 EIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       244 ~v~v~gl~~~~V~s~~e~l  262 (262)
                      ++++.|++++.|.+.+|++
T Consensus       161 ~~~v~gl~~~~v~s~~e~~  179 (325)
T cd01369         161 GVYVKGLTERFVSSPEEVL  179 (325)
T ss_pred             CEEEcCCEEEEcCCHHHHH
Confidence            9999999999999999974


No 15 
>KOG0240|consensus
Probab=100.00  E-value=2.4e-39  Score=303.25  Aligned_cols=167  Identities=22%  Similarity=0.228  Sum_probs=144.6

Q ss_pred             CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCce
Q psy17370         96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNV  174 (262)
Q Consensus        96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~  174 (262)
                      ..++|+|+||+||++..|.. ++..+....+....+.+......+.|.||+||.++++|++||+.+++|+|++||.|||+
T Consensus         5 ~~~~IkV~cR~rP~n~~E~~~~~~~i~~~~~~~~~v~~~~~~~~~~y~FDrVF~pnatQe~Vy~~~a~~Iv~dVL~GYNG   84 (607)
T KOG0240|consen    5 AECSIKVVCRFRPLNGLENNLGSKFIDCFENGENTVVLETTKETKTYVFDRVFSPNATQEDVYEFAAKPIVDDVLLGYNG   84 (607)
T ss_pred             CCCceEEEEEeecCCchhhhcCCcCccCCCCCcceEEEecccccccceeeeecCCCccHHHHHHHHHHHHHHHHhcccce
Confidence            47899999999999999877 44433333442444555444456999999999999999999999999999999999999


Q ss_pred             eEeeeeccCCCCceecCCCCC---CCchHhhhhhccccccCc----cceEEEEEEEEEE------EEecCCCCceeeecC
Q psy17370        175 CLFAYGQTGSGKSYRGDSTLN---SSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI------AVDFGCGSWRFESKP  241 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~G~~~---~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy------l~Dll~~~l~i~ed~  241 (262)
                      ||||||||||||||||.|...   ..|||||.+++||..+..    -+|.|+|||+|||      |+|+-+.||.++||.
T Consensus        85 TvfaYGqT~sGKTytm~G~~~d~~~~GIipRi~~diF~~Iys~~~n~efhVkVsy~EIYmEKi~DLL~~~k~nlsvheDK  164 (607)
T KOG0240|consen   85 TVFAYGQTGSGKTYTMEGIGHDPEEMGIIPRILNDIFDHIYSMEENLEFHVKVSYFEIYMEKIRDLLDPEKTNLSVHEDK  164 (607)
T ss_pred             eEEEecCCCCCcceeecccCCChhhcCcHHHHHHHHHHHHhcCcccceEEEEEEeehhhhhHHHHHhCcccCCceeeccc
Confidence            999999999999999999874   679999999999998864    4899999999999      555557999999998


Q ss_pred             CCcEEEcCceEEecCChhhhC
Q psy17370        242 SHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       242 ~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      ..++||+|+++..|.+++|||
T Consensus       165 ~~v~~vkG~t~~~v~s~d~v~  185 (607)
T KOG0240|consen  165 NRVPYVKGVTERFVSSPDEVL  185 (607)
T ss_pred             CCCceecCceeEEecCHHHHH
Confidence            899999999999999999985


No 16 
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=100.00  E-value=1.9e-38  Score=293.27  Aligned_cols=165  Identities=25%  Similarity=0.381  Sum_probs=148.0

Q ss_pred             CCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCC----CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCC
Q psy17370         98 SRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNA----KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGY  172 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~----~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~  172 (262)
                      .+|+|+||+||+...|.. +...++.+.++...+......    ..+.|.||+||+++++|++||+.++.|+|+.+++|+
T Consensus         2 ~~i~V~vRvRP~~~~e~~~~~~~~i~~~~~~~~i~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vy~~~~~plv~~~~~G~   81 (352)
T cd01364           2 SNIQVVVRCRPRNSRERKEKSSVVVEVSGSSKEIIVSTGGADKQSTKTYTFDKVFGPEADQIEVYSQVVSPILDEVLMGY   81 (352)
T ss_pred             CCEEEEEEcCcCCccccccCCCeEEEEcCCCcEEEEcCCCcccccceeEeccccCCCCCCHHHHHHHHHHHHHHHHhCCC
Confidence            589999999999999876 677788888876666665542    678999999999999999999999999999999999


Q ss_pred             ceeEeeeeccCCCCceecCCCC-----------CCCchHhhhhhccccccCc--cceEEEEEEEEEE---EEecCCC---
Q psy17370        173 NVCLFAYGQTGSGKSYRGDSTL-----------NSSVLRPRVLFYPGFSWSH--SGWTGWVSCVVVI---AVDFGCG---  233 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~G~~-----------~~~Giipr~~~~lf~~~~~--~~~~~~vS~~EIy---l~Dll~~---  233 (262)
                      |+||||||+|||||||||+|+.           ..+|||||++++||..++.  ..+.++|||+|||   ++|||..   
T Consensus        82 n~~i~ayG~tgSGKTyTl~G~~~~~~~~~~~~~~~~Glipr~~~~Lf~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~  161 (352)
T cd01364          82 NCTIFAYGQTGTGKTYTMEGDRTDNKGSTWELSPHAGIIPRALYQLFEKLESQNTEYSVKVSYLELYNEELFDLLSSESD  161 (352)
T ss_pred             eEEEEECCCCCCCCcEEecCCCcccccccccccccCCchHHHHHHHHHHHHhccceeEEEEEEEEeeCCeeeeCCCCccc
Confidence            9999999999999999999985           3489999999999988875  6899999999999   9999963   


Q ss_pred             ---Cceeeec--CCCcEEEcCceEEecCChhhhC
Q psy17370        234 ---SWRFESK--PSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       234 ---~l~i~ed--~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                         .++++++  ..++++|.|++++.|.+++|++
T Consensus       162 ~~~~l~i~e~~~~~~g~~v~gl~~~~v~s~~e~~  195 (352)
T cd01364         162 LNKPLRIFDDTNNKGGVVIQGLEEITVNNANEGL  195 (352)
T ss_pred             cCccceEEeccCcCCCEEeCCcEEEEeCCHHHHH
Confidence               5899999  5799999999999999999974


No 17 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=100.00  E-value=5.9e-38  Score=288.79  Aligned_cols=161  Identities=27%  Similarity=0.383  Sum_probs=144.1

Q ss_pred             CeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEe
Q psy17370         99 RMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLF  177 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~if  177 (262)
                      +|+|+||+||+...|.. +...++.+.+.+..+....   .+.|.||+||+++++|++||+.+++|+|+.+++|+|+|||
T Consensus         2 ~i~V~vRvRP~~~~e~~~~~~~~~~~~~~~~~v~~~~---~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~~~G~n~~i~   78 (341)
T cd01372           2 SVRVAVRVRPLLPKELLEGCQVCVSVVPGEPQVTVGT---DKSFTFDYVFDPSTSQEEVYNTCVAPLVDGLFEGYNATVL   78 (341)
T ss_pred             CeEEEEECCCCCchhcccCCCeEEEEeCCCCEEEecC---CcEEeccccCCCCCCHHHHHHHHHHHHHHHHhCCCcccee
Confidence            69999999999998876 5566777766655555533   6799999999999999999999999999999999999999


Q ss_pred             eeeccCCCCceecCCCC------CCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCC------CCceee
Q psy17370        178 AYGQTGSGKSYRGDSTL------NSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGC------GSWRFE  238 (262)
Q Consensus       178 aYG~tgSGKTyTm~G~~------~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~------~~l~i~  238 (262)
                      |||||||||||||+|+.      .++|||||++++||..++.    .++.|.|||+|||   ++|||.      ..++|+
T Consensus        79 ayG~tgSGKT~Tm~G~~~~~~~~~~~Giipr~~~~LF~~~~~~~~~~~~~v~vS~~EIy~e~v~DLL~~~~~~~~~l~i~  158 (341)
T cd01372          79 AYGQTGSGKTYTMGTAFTASEDEEEVGIIPRAIQHIFKKIDEKKDEPDFQLKVSFLELYNEEVRDLLSPSTSEKSPIQIR  158 (341)
T ss_pred             eecCCCCCCcEEecCCCccccccccCChHHHHHHHHHHHHHhccccceEEEEEEEEEeECCeeecCCCCcccCCCCceEE
Confidence            99999999999999984      5799999999999998874    4789999999999   999985      358999


Q ss_pred             ecCCCcEEEcCceEEecCChhhhC
Q psy17370        239 SKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       239 ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      ++..++++|.|++++.|.+.+|++
T Consensus       159 e~~~~~~~i~gl~~~~v~s~~e~~  182 (341)
T cd01372         159 EDSKGNIIIVGLTEVTVNSAQEVM  182 (341)
T ss_pred             ECCCCCEecCCCEEEEECCHHHHH
Confidence            999999999999999999999974


No 18 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=100.00  E-value=2.9e-37  Score=282.95  Aligned_cols=165  Identities=27%  Similarity=0.392  Sum_probs=147.6

Q ss_pred             CCCeEEEEEeCCCCccccCCCcceEEEcCCc-eEEEEcCC-CCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCce
Q psy17370         97 CSRMTVAVRIRPLLVKELHMDVSSIEISPDR-REMKVNDN-AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNV  174 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~~~~~~i~~~~~~-~~i~~~~~-~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~  174 (262)
                      +|+|+|+||+||+...|......++.+.+.+ ..+.+... .+.+.|.||+||+++++|++||+. +.|+|+.+++|+|+
T Consensus         1 ~~~i~V~vRirP~~~~e~~~~~~~~~~~~~~~~~i~~~~~~~~~~~f~fD~vf~~~~~q~~v~~~-v~p~v~~~~~G~~~   79 (329)
T cd01366           1 KGNIRVFCRVRPLLPSESTEYSSVISFPDEDGGTIELSKGTGKKKSFSFDRVFDPDASQEDVFEE-VSPLVQSALDGYNV   79 (329)
T ss_pred             CCCEEEEEEcCcCCccccCCCccEEEEcCCCceEEEEeCCCCCceEEecCEEECCCCCHHHHHHH-HHHHHHHHhCCCce
Confidence            4789999999999998866566677777764 66666554 688999999999999999999998 58999999999999


Q ss_pred             eEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEecCCC------Cceeeec
Q psy17370        175 CLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVDFGCG------SWRFESK  240 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~Dll~~------~l~i~ed  240 (262)
                      ||||||+|||||||||+|...++|||||++++||..++.     ..|.+++||+|||   ++||+..      .++|+++
T Consensus        80 ~i~ayG~tgSGKT~tl~G~~~~~Gli~r~~~~lf~~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~~~~~l~i~~~  159 (329)
T cd01366          80 CIFAYGQTGSGKTYTMEGPPENPGIIPRALEQLFNTAEELKEKGWSYTITASMLEIYNETIRDLLATKPAPKKKLEIKHD  159 (329)
T ss_pred             EEEEeCCCCCCCcEEecCCCCCCCcHHHHHHHHHHHHHhhhccCceEEEEEEEEEEECCEeEECCCCCcCCCCceEEEEC
Confidence            999999999999999999999999999999999987753     4788999999999   9999864      5899999


Q ss_pred             CCCcEEEcCceEEecCChhhhC
Q psy17370        241 PSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       241 ~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      ..+++++.|++++.|.+++|++
T Consensus       160 ~~~~~~i~~l~~~~v~s~~e~~  181 (329)
T cd01366         160 SKGETYVTNLTEVPVSSPEEVT  181 (329)
T ss_pred             CCCCEEecCCEEEEeCCHHHHH
Confidence            9999999999999999999974


No 19 
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=100.00  E-value=1.6e-37  Score=285.28  Aligned_cols=159  Identities=27%  Similarity=0.395  Sum_probs=136.0

Q ss_pred             CeEEEEEeCCCCccccCCCcceEEEcCCceEEEE--c---------CCCCceeeeeceeeCCCCCcchhhcccchhhHhh
Q psy17370         99 RMTVAVRIRPLLVKELHMDVSSIEISPDRREMKV--N---------DNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDA  167 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~~--~---------~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~  167 (262)
                      .|+|+||+||+...+..    .+.+..++..+.+  +         ...+.+.|.||+||++ ++|++||+.++.|+|+.
T Consensus         1 ~i~V~vRvRP~~~~~~~----~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~f~FD~vf~~-~~q~~vy~~~~~p~v~~   75 (334)
T cd01375           1 TIQVFVRVRPTPTKQGS----SIKLGPDGKSVSSNLPKDLVRGVVNNQQEDFSFKFDGVFHN-ASQEEVYETVAKPVVDS   75 (334)
T ss_pred             CeEEEEECCCCCCCCCc----cEEEcCCCCEEEEecccccccccccCCcCceEEEcCcccCC-CCHHHHHHHHHHHHHHH
Confidence            48999999999985422    2344444333222  1         2226788999999999 99999999999999999


Q ss_pred             hhCCCceeEeeeeccCCCCceecCCCC---CCCchHhhhhhccccccCc---cceEEEEEEEEEE---EEecCCCC----
Q psy17370        168 AFNGYNVCLFAYGQTGSGKSYRGDSTL---NSSVLRPRVLFYPGFSWSH---SGWTGWVSCVVVI---AVDFGCGS----  234 (262)
Q Consensus       168 ~l~G~n~~ifaYG~tgSGKTyTm~G~~---~~~Giipr~~~~lf~~~~~---~~~~~~vS~~EIy---l~Dll~~~----  234 (262)
                      +++|+|+||||||+|||||||||+|+.   .++|||||++++||..++.   ..|.|+|||+|||   ++|||...    
T Consensus        76 ~~~G~n~~i~ayG~tgSGKTyTm~G~~~~~~~~Glipr~~~~lf~~~~~~~~~~~~v~~S~~Eiy~e~v~DLL~~~~~~~  155 (334)
T cd01375          76 ALDGYNGTIFAYGQTGAGKTFTMTGGTESYKDRGLIPRALEQVFREVAMRATKTYTVHVSYLEIYNEQLYDLLGDTPEAL  155 (334)
T ss_pred             HhCCCccceeeecCCCCCCeEEccCCCCcccCCchHHHHHHHHHHHHHhccCcceEEEEEEEEEECCEeecCCCCCcccc
Confidence            999999999999999999999999986   5789999999999998864   4799999999999   99998644    


Q ss_pred             -----ceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        235 -----WRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       235 -----l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                           +.|++|..++++|.|++++.|.+++|++
T Consensus       156 ~~~~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~  188 (334)
T cd01375         156 ESLPAVTILEDSEQNIHVKGLSLHSATTEEEAL  188 (334)
T ss_pred             ccCCceEEEEcCCCCEEeCCcEEEEeCCHHHHH
Confidence                 7999999999999999999999999974


No 20 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=100.00  E-value=1.4e-36  Score=277.94  Aligned_cols=164  Identities=25%  Similarity=0.374  Sum_probs=146.7

Q ss_pred             CeEEEEEeCCCCccccCCCcceEEEcCCceEEEEcCC----CCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCce
Q psy17370         99 RMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDN----AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNV  174 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~~~~~----~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~  174 (262)
                      +|+|+||+||+...|..+...+|.+.+++..+.....    ...+.|.||+||+++++|++||+.++.|+|+.+++|+|+
T Consensus         1 ~i~V~vRvrP~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~f~fd~vf~~~~~q~~v~~~~~~~~v~~~~~G~~~   80 (328)
T cd00106           1 NIRVVVRIRPLNGRESKSEESCITVDDNKTVTLTPPKDGRKAGPKSFTFDHVFDPNSTQEDVYETTAKPLVESVLEGYNG   80 (328)
T ss_pred             CeEEEEEcCCCCcccccCCCcEEEECCCCEEEEecCccccCcCceEEECCeEEcCCCCHHHHHHHHHHHHHHHHhCCCce
Confidence            5899999999998875567788888886544333322    367999999999999999999999999999999999999


Q ss_pred             eEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCcc-----ceEEEEEEEEEE---EEecCCC-----CceeeecC
Q psy17370        175 CLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHS-----GWTGWVSCVVVI---AVDFGCG-----SWRFESKP  241 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~~-----~~~~~vS~~EIy---l~Dll~~-----~l~i~ed~  241 (262)
                      |||+||++||||||||+|+..++|||||++++||..+.+.     .+.|.+||+|||   ++||+..     .+++++|.
T Consensus        81 ~i~~yG~tgSGKT~tl~G~~~~~Gli~~~~~~Lf~~~~~~~~~~~~~~v~~S~~Ei~~e~v~DLL~~~~~~~~l~i~~~~  160 (328)
T cd00106          81 TIFAYGQTGSGKTYTMFGSPKDPGIIPRALEDLFNLIDERKEKNKSFSVSVSYLEIYNEKVYDLLSPEPPSKPLSLREDP  160 (328)
T ss_pred             eEEEecCCCCCCeEEecCCCCCCchHHHHHHHHHHHHhhccccCceEEEEEEEEEEECCEeEECCCCCCCCCCcEEEEcC
Confidence            9999999999999999999999999999999999988754     589999999999   9999854     58999999


Q ss_pred             CCcEEEcCceEEecCChhhhC
Q psy17370        242 SHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       242 ~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      .+++++.|++++.|.+.+|++
T Consensus       161 ~~~~~v~~l~~~~v~s~~e~~  181 (328)
T cd00106         161 KGGVYVKGLTEVEVGSAEDAL  181 (328)
T ss_pred             CCCEEEeCCEEEEeCCHHHHH
Confidence            999999999999999999974


No 21 
>KOG0239|consensus
Probab=100.00  E-value=2.1e-37  Score=303.75  Aligned_cols=177  Identities=27%  Similarity=0.395  Sum_probs=146.7

Q ss_pred             cccCCccccccCCCCCCeEEEEEeCCCCccccCC-CcceEEEcCCc-eEEEEcCCC---CceeeeeceeeCCCCCcchhh
Q psy17370         83 MRSSSENCVADNLECSRMTVAVRIRPLLVKELHM-DVSSIEISPDR-REMKVNDNA---KSYTFKLDHCLGQDTDQTSVF  157 (262)
Q Consensus        83 ~~~~~~~~~~~~~~~~~IkV~vRiRP~~~~E~~~-~~~~i~~~~~~-~~i~~~~~~---~~~~f~FD~vf~~~~~q~~vy  157 (262)
                      .+...+|...+.  +|||+|+||+||+...|... ...++...+.. ..+..+...   ..+.|.||+||++.++|++||
T Consensus       301 ~r~kL~N~i~eL--kGnIRV~CRvRP~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~fdkVf~p~~sQ~~VF  378 (670)
T KOG0239|consen  301 ERRKLHNEILEL--KGNIRVFCRVRPLLPSEKQRLQSKVIDTEEQGEVQVDSPDKGDKLEPQSFKFDKVFGPLASQDDVF  378 (670)
T ss_pred             HHHHHHHHHHHh--hcCceEEEEecCCCccccccccccccccCCcceeEeecCCCCCCCccccceeeeecCCcccHHHHH
Confidence            455677777775  89999999999999988773 33344343331 233333332   223599999999999999999


Q ss_pred             cccchhhHhhhhCCCceeEeeeeccCCCCceecCC-CCCCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEe
Q psy17370        158 TIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDS-TLNSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVD  229 (262)
Q Consensus       158 ~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~G-~~~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~D  229 (262)
                      +++. |+|..+|+|||+||||||||||||||||.| .++++|||||++++||..+..    -.|.+.++++|||   |+|
T Consensus       379 ~e~~-~lv~S~lDGYnVCIFAYGQTGSGKTyTM~G~~~~~~Giipral~~lF~~~~~~~~g~~y~~~~s~~EIYNe~i~D  457 (670)
T KOG0239|consen  379 EEVS-PLVQSALDGYNVCIFAYGQTGSGKTYTMSGPTPEDPGIIPRALEKLFRTITSLKSGWKYDKTVSMLEIYNEAIRD  457 (670)
T ss_pred             HHHH-HHHHHHhcCcceeEEEecccCCCccccccCCCcccCCccHHHHHHHHHHHHhhccCceEEeeeehhHHHHHHHHH
Confidence            9955 999999999999999999999999999999 689999999999999987764    3788899999999   999


Q ss_pred             cCC-----CCceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        230 FGC-----GSWRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       230 ll~-----~~l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      ||.     ..+.|+++.++.++|.+++..+|.+.+|++
T Consensus       458 lL~~~~~~~k~~I~~~~~~~~~V~~~t~~~V~s~~~v~  495 (670)
T KOG0239|consen  458 LLSDESYVGKLEIVDDAEGNLMVPLLTVIKVGSSEEVD  495 (670)
T ss_pred             hccccccccceeEEEcCCCceecccceEEecCCHHHHH
Confidence            884     467999999999999999999999998873


No 22 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=100.00  E-value=1.2e-35  Score=272.76  Aligned_cols=164  Identities=29%  Similarity=0.419  Sum_probs=146.5

Q ss_pred             CeEEEEEeCCCCccccC-CCcceEEEcCCc-eEEEEcC---CCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCc
Q psy17370         99 RMTVAVRIRPLLVKELH-MDVSSIEISPDR-REMKVND---NAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYN  173 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~-~~i~~~~---~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n  173 (262)
                      +|+|+||+||+...|.. +..+++.+.++. ..+.+..   ....+.|.||+||+++++|++||+.++.|+|+.+++|+|
T Consensus         1 ~v~v~vRvrP~~~~e~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~f~fD~vf~~~~~q~~v~~~~~~p~v~~~~~G~~   80 (335)
T smart00129        1 NIRVVVRVRPLNKREKSRKSPSVVPFDDKDGKTLNVNSPKNRKEEKKFTFDKVFGATASQEDVFEETAAPLVDSVLEGYN   80 (335)
T ss_pred             CcEEEEEcCcCCccchhcCCceEEEEcCCCCCEEEEeCCCCCCCCeEEecCEEECCCCChHHHHHHHHHHHHHHHhcCCc
Confidence            58999999999999876 677788886653 3444332   237799999999999999999999999999999999999


Q ss_pred             eeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCC---CCceeeecCCC
Q psy17370        174 VCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGC---GSWRFESKPSH  243 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~---~~l~i~ed~~~  243 (262)
                      +|||+||++||||||||+|+..++|||||++++||..+.+    ..+.|+|||+|||   ++||+.   ..++|+++..+
T Consensus        81 ~~i~~yG~tgSGKT~tl~G~~~~~Gli~~~~~~Lf~~~~~~~~~~~~~v~~S~~ei~~e~v~DLL~~~~~~l~i~~~~~~  160 (335)
T smart00129       81 ATIFAYGQTGSGKTYTMSGTPDSPGIIPRALKDLFEKIDKLEEGWQFQVKVSYLEIYNEKIRDLLNPSPKKLEIREDKKG  160 (335)
T ss_pred             eeEEEeCCCCCCCceEecCCCCCCCHHHHHHHHHHHHhhhcccCceEEEEEEEEEEECCEEEECcCCCCCCcEEEECCCC
Confidence            9999999999999999999999999999999999998865    3799999999999   999984   67899999999


Q ss_pred             cEEEcCceEEecCChhhhC
Q psy17370        244 EIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       244 ~v~v~gl~~~~V~s~~e~l  262 (262)
                      ++++.|++++.|.|++|++
T Consensus       161 ~~~i~~l~~~~v~s~~e~~  179 (335)
T smart00129      161 GVYVKGLTEISVSSFEEVY  179 (335)
T ss_pred             CEEecCCEEEEeCCHHHHH
Confidence            9999999999999999874


No 23 
>KOG0246|consensus
Probab=100.00  E-value=6e-36  Score=280.08  Aligned_cols=170  Identities=22%  Similarity=0.278  Sum_probs=149.6

Q ss_pred             cCCCCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEE--------cCCCCceeeeeceeeCCCCCcchhhcccchh
Q psy17370         93 DNLECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKV--------NDNAKSYTFKLDHCLGQDTDQTSVFTIIAQP  163 (262)
Q Consensus        93 ~~~~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~--------~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~p  163 (262)
                      +....+.|.||||.||++..|.. .+..+|.+..+...+..        ...-+++.|.||++||+.+++++||.-+++|
T Consensus       203 ~~v~ehrI~VCVRKRPLnkkE~~~keiDvisvps~~~l~vHEpk~kVDLtkYlEn~~F~FDyaFDe~~sNe~VYrfTa~P  282 (676)
T KOG0246|consen  203 DGVNEHRICVCVRKRPLNKKELTKKEIDVISVPSKNVLVVHEPKLKVDLTKYLENQKFRFDYAFDESASNELVYRFTAKP  282 (676)
T ss_pred             CCCccceEEEEeecCCCCchhccccccceEeccccceEEeeccccccchHHHHhhceEEEeeecccccchHHHHHHhhhH
Confidence            45567899999999999999987 66667777544443332        2233899999999999999999999999999


Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecCCCC------CCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEe
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGDSTL------NSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVD  229 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~G~~------~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~D  229 (262)
                      ||+.+|+|.-+||||||||||||||||.|+.      ...||.-++.+|+|..+..     .++.++++|||||   +||
T Consensus       283 lV~~IF~~G~ATCFAYGQTGSGKT~TMggdfsgk~q~~s~giya~aa~Dvf~~L~~p~Y~~~~l~v~~tFFEIYgGKvfD  362 (676)
T KOG0246|consen  283 LVKTIFEGGMATCFAYGQTGSGKTYTMGGDFSGKAQDCSKGIYALAARDVFRLLRQPTYRKLDLKVYVTFFEIYGGKVYD  362 (676)
T ss_pred             HHHHHHhCCceeeeeeccCCCCceeecccccCcccccccccchhhhhhHHHHHhcccchhhcceEEEEEEEEEeCcchhh
Confidence            9999999999999999999999999999986      5679999999999988875     4888999999999   999


Q ss_pred             cCC--CCceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        230 FGC--GSWRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       230 ll~--~~l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      ||+  .+|.++||.+..|.|.||+|..|.+.+|+|
T Consensus       363 LL~~k~KLrvLEDg~QQVqVVGLqE~~v~~~eeVl  397 (676)
T KOG0246|consen  363 LLNDKKKLRVLEDGNQQVQVVGLQEEEVSGVEEVL  397 (676)
T ss_pred             hhccccceEEeecCCceEEEeeceeeeccCHHHHH
Confidence            996  688899999999999999999999999986


No 24 
>KOG0241|consensus
Probab=100.00  E-value=1.8e-36  Score=294.38  Aligned_cols=166  Identities=27%  Similarity=0.415  Sum_probs=151.0

Q ss_pred             CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCCC-------CceeeeeceeeC-------CCCCcchhhccc
Q psy17370         96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDNA-------KSYTFKLDHCLG-------QDTDQTSVFTII  160 (262)
Q Consensus        96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~-------~~~~f~FD~vf~-------~~~~q~~vy~~~  160 (262)
                      .+.+|||.||+||++.+|.. ..+|++.++..++++..++..       ..++|.||++|.       ..+.|+.||+..
T Consensus         2 s~~kVkVaVRVRP~nrREl~l~tk~vv~vd~~q~vl~~~pp~~~~~~~k~pktFAFDhcF~s~dpes~n~agQE~Vf~~l   81 (1714)
T KOG0241|consen    2 SDAKVKVAVRVRPMNRRELELSTKCVVEVDKNQTVLHPPPPNHKIGESKGPKTFAFDHCFWSMDPESKNYAGQETVFKCL   81 (1714)
T ss_pred             CCcceEEEEEecccchhhhcccccceEEeccCceeecCCCccccccccCCCceeecccccccCCccccccccchhHHHhc
Confidence            46789999999999999998 888999999999888776433       678999999993       347899999999


Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEecC-
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVDFG-  231 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~Dll-  231 (262)
                      ...+|+.+|+|||+||||||||||||||||+|..+++|||||.++.||..+.+     ..|+|.|||+|||   ++||| 
T Consensus        82 G~~il~naf~GyNaCifaYGQtGsGKsYsmmGt~~QpGiIPrlc~~lFe~I~k~~n~~~tfkVeVSymEIynEkv~DLLd  161 (1714)
T KOG0241|consen   82 GEGILENAFQGYNACIFAYGQTGSGKSYSMMGTAEQPGIIPRLCESLFERIDKESNPSQTFKVEVSYMEIYNEKVRDLLD  161 (1714)
T ss_pred             chHHHHHHhhccceeeEEecccCCCceeEeeccCCCCCchhHHHHHHHHHHHhccCCCceEEEEEEHHHHhhcchhhhhC
Confidence            99999999999999999999999999999999999999999999999999874     4899999999999   77776 


Q ss_pred             ----CCCceeeecCCCcEEEcCceEEecCChhhh
Q psy17370        232 ----CGSWRFESKPSHEIYLSVSVLTDITKFIEV  261 (262)
Q Consensus       232 ----~~~l~i~ed~~~~v~v~gl~~~~V~s~~e~  261 (262)
                          +..|+++++.-.|.|++||++..|.|.+|+
T Consensus       162 Pk~ssqtlkVrehsvlGp~vdGLS~laV~S~qdI  195 (1714)
T KOG0241|consen  162 PKGSSQTLKVREHSVLGPYVDGLSQLAVTSFQDI  195 (1714)
T ss_pred             CCCCcceeEEeecccccccccchhhhhcccHHHH
Confidence                467899999999999999999999999874


No 25 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=100.00  E-value=5.6e-35  Score=268.12  Aligned_cols=158  Identities=25%  Similarity=0.387  Sum_probs=134.1

Q ss_pred             EeCCCCccccC-CCcceEEEcCCce--EEEE---cCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEee
Q psy17370        105 RIRPLLVKELH-MDVSSIEISPDRR--EMKV---NDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFA  178 (262)
Q Consensus       105 RiRP~~~~E~~-~~~~~i~~~~~~~--~i~~---~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifa  178 (262)
                      |+||++..|.. .....+.+.....  ....   ........|.||+||+++++|++||+.++.|+|+.+|+|+|+||||
T Consensus         1 RvRP~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~~~v~~~l~G~n~~i~a   80 (335)
T PF00225_consen    1 RVRPLNESEKESSAESIVSVDNQDSNQNKQSVNSNNSQKEKSFRFDRVFDEDATQEDVYEEVVSPLVDSVLDGYNATIFA   80 (335)
T ss_dssp             EEES-CHHHHHTTTEBCEEEETTETEEEEEETTEEETTEEEEEEESEEEETTSTHHHHHHHHTHHHHHHHHTT-EEEEEE
T ss_pred             CcCCCCHHHHhCCCcEEEEecCCccccccccccccCCCCceEEEcCeEECCCCCHHHHHHHHHHHHHHHhhcCCceEEEe
Confidence            89999999987 5555555542111  1111   1223789999999999999999999999999999999999999999


Q ss_pred             eeccCCCCceecCCC--CCCCchHhhhhhccccccCc------cceEEEEEEEEEE---EEecCCCC-------ceeeec
Q psy17370        179 YGQTGSGKSYRGDST--LNSSVLRPRVLFYPGFSWSH------SGWTGWVSCVVVI---AVDFGCGS-------WRFESK  240 (262)
Q Consensus       179 YG~tgSGKTyTm~G~--~~~~Giipr~~~~lf~~~~~------~~~~~~vS~~EIy---l~Dll~~~-------l~i~ed  240 (262)
                      ||+|||||||||+|+  ..++|||||++++||..++.      ..+.|+|||+|||   ++|||...       ++|++|
T Consensus        81 yG~tgSGKT~Tm~G~~~~~~~Gli~~~~~~lf~~~~~~~~~~~~~~~v~vS~~EIy~e~v~DLL~~~~~~~~~~l~i~~~  160 (335)
T PF00225_consen   81 YGQTGSGKTYTMFGSNDPSEPGLIPRALRDLFSQIEERKEKSGYEFSVSVSYLEIYNEKVYDLLSPNNSKSRKPLKIRED  160 (335)
T ss_dssp             EESTTSSHHHHHTBSTSTTTBSHHHHHHHHHHHHHHHHTTTSTEEEEEEEEEEEEETTEEEETTSTTSSSTTSEBEEEEE
T ss_pred             eccccccccccccccccccccchhhhHHHHHhhhhccccccccccccccccchhhhhhhhhhhcCccccccccccceeec
Confidence            999999999999999  89999999999999998875      3689999999999   99999754       899999


Q ss_pred             CCCc-EEEcCceEEecCChhhhC
Q psy17370        241 PSHE-IYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       241 ~~~~-v~v~gl~~~~V~s~~e~l  262 (262)
                      ...| +++.|++++.|.+.+|++
T Consensus       161 ~~~g~~~i~~l~~~~v~s~~~~~  183 (335)
T PF00225_consen  161 SNKGSVYIKGLTEVEVKSAEEAL  183 (335)
T ss_dssp             TTTEEEEETTSEEEEESSHHHHH
T ss_pred             cccccceeecccccccccccccc
Confidence            9866 999999999999999874


No 26 
>KOG0247|consensus
Probab=99.97  E-value=2.4e-32  Score=262.09  Aligned_cols=164  Identities=22%  Similarity=0.281  Sum_probs=141.3

Q ss_pred             CCCeEEEEEeCCCCccccCCCcceEEEcCCceEEEEcC-----------CCCceeeeeceeeCCCCCcchhhcccchhhH
Q psy17370         97 CSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVND-----------NAKSYTFKLDHCLGQDTDQTSVFTIIAQPLL  165 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~~~~-----------~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv  165 (262)
                      ...|.|+||+||+...  .++..++.+.++.+.+...+           ..-.+.|.|.+||+++++|.+||+.++.|+|
T Consensus        30 ~d~v~v~~rvrP~~~~--~~~~g~l~v~n~~tivL~~P~d~~~~~~~n~~q~e~~fsFt~VF~p~~tQ~dvF~~~~~plV  107 (809)
T KOG0247|consen   30 KDPVLVVCRVRPLSDA--SEDEGCLRVINEETIVLETPEDSFARRSVNGGQMEKKFSFTKVFGPSVTQADVFDTTVAPLV  107 (809)
T ss_pred             hcchheeEeecCCCCC--ccccceEEEeccceeEeeCcHHHHhhhccCccceeeEeeeeeecCCCccHHHHHHHHhHHHH
Confidence            5689999999999852  24566777777666655522           2256889999999999999999999999999


Q ss_pred             hhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc--------------------------------
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH--------------------------------  213 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~--------------------------------  213 (262)
                      .++|.|.|..+|.||.|||||||||+|++.++||+||+|+.||..+.+                                
T Consensus       108 ~dlLkgqn~LlFTyGVTgSGKTYTm~G~~~~~GIlPR~Ld~iF~siq~~~~~k~~~kp~~s~~~e~~~~~~alL~lkr~~  187 (809)
T KOG0247|consen  108 KDLLKGQNSLLFTYGVTGSGKTYTMTGTPDRPGILPRALDVIFNSIQGRQAKKPVFKPLRSNLFEIKAEEDALLQLKREA  187 (809)
T ss_pred             HHHHcccceeEEEeeccCCCceEEeecCCCCCCchHHHHHHHHHHhhceeccCceeccccchHHHHHHHHHHHHhhhhhh
Confidence            999999999999999999999999999999999999999999876442                                


Q ss_pred             ------------------------------------cceEEEEEEEEEE---EEecCCCC---------ceeeecCCCcE
Q psy17370        214 ------------------------------------SGWTGWVSCVVVI---AVDFGCGS---------WRFESKPSHEI  245 (262)
Q Consensus       214 ------------------------------------~~~~~~vS~~EIy---l~Dll~~~---------l~i~ed~~~~v  245 (262)
                                                          ..|.|||||+|||   |||||-+.         ..+++|.++.+
T Consensus       188 ~~nd~~~ts~~~~~~~~e~~e~~~~~e~~~~~l~~d~~ysV~VSf~EIYN~~iYDLLe~~s~q~~~~~~~ll~~d~~~~~  267 (809)
T KOG0247|consen  188 MLNDRKSTSKAHRQSTPEYAEHIHVIEQPALELDEDIVYSVFVSFVEIYNNYIYDLLEDASFQGKLQKLKLLREDTNGNM  267 (809)
T ss_pred             ccccccCcchhhccccHHHHhhcchhcccccccCcCcEEEEEeeHHHHHHHHHHHhhccccccchhhhhhhhhhccCCCe
Confidence                                                1478999999999   99998422         57789999999


Q ss_pred             EEcCceEEecCChhhhC
Q psy17370        246 YLSVSVLTDITKFIEVY  262 (262)
Q Consensus       246 ~v~gl~~~~V~s~~e~l  262 (262)
                      ||.|++++.|.+.+|+|
T Consensus       268 ~Vkgl~~V~VssseEA~  284 (809)
T KOG0247|consen  268 YVKGLTEVEVSSSEEAL  284 (809)
T ss_pred             eeccccEEEeccHHHHH
Confidence            99999999999999975


No 27 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=99.94  E-value=9.8e-28  Score=233.57  Aligned_cols=159  Identities=21%  Similarity=0.296  Sum_probs=133.6

Q ss_pred             CCCeEEEEEeCCCCccccCCCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeE
Q psy17370         97 CSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCL  176 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~i  176 (262)
                      -..++++++..|-...+      .+....+...+..... ....|.||+||++.++|++||+..++++++.++.||||||
T Consensus        21 ~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~-~~~~~~fdkvf~~~~~q~~v~e~~~~~l~~~~l~g~N~Tv   93 (568)
T COG5059          21 VSDIKSTIRIIPGELGE------RLINTSKKSHVSLEKS-KEGTYAFDKVFGPSATQEDVYEETIKPLIDSLLLGYNCTV   93 (568)
T ss_pred             ecCceEEEeecCCCcch------heeecccccccccccc-cceEEEEeeccCCCCcHHHHHHHhhhhHHHHHHhcccceE
Confidence            46789999999976542      1222222222222211 2678999999999999999999999999999999999999


Q ss_pred             eeeeccCCCCceecCCCCCCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCCCCc---eeeecCCCcEE
Q psy17370        177 FAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGCGSW---RFESKPSHEIY  246 (262)
Q Consensus       177 faYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~~~l---~i~ed~~~~v~  246 (262)
                      |||||||+||||||.|...++||||+++.+||..+++    ..+.+.+||+|||   ++||+..+.   .+++|..++|+
T Consensus        94 fayGqTgsgKtyt~~G~~~~~Gii~~~l~~lf~~l~~~~~~~~~~v~is~lEiYnEk~~DLl~~~~~~~~~~~~~~~~v~  173 (568)
T COG5059          94 FAYGQTGSGKTYTMSGTEEEPGIIPLSLKELFSKLEDLSMTKDFAVSISYLEIYNEKIYDLLSPNEESLNIREDSLLGVK  173 (568)
T ss_pred             EEEcccCCCceeEeecCccccchHHHHHHHHHHHHHhcccCcceeeEeehhHHHhhHHHhhccCccccccccccCCCceE
Confidence            9999999999999999999999999999999998875    4799999999999   999885443   48899999999


Q ss_pred             EcCceEEecCChhhhC
Q psy17370        247 LSVSVLTDITKFIEVY  262 (262)
Q Consensus       247 v~gl~~~~V~s~~e~l  262 (262)
                      +.|+++..+.+.+|+|
T Consensus       174 v~~l~~~~~~s~ee~l  189 (568)
T COG5059         174 VAGLTEKHVSSKEEIL  189 (568)
T ss_pred             eecceEEecCChHHHH
Confidence            9999999999999875


No 28 
>KOG0244|consensus
Probab=99.89  E-value=1e-24  Score=214.78  Aligned_cols=152  Identities=24%  Similarity=0.315  Sum_probs=132.7

Q ss_pred             eCCCCccccC-CCcceEEEcCCceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCC
Q psy17370        106 IRPLLVKELH-MDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGS  184 (262)
Q Consensus       106 iRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgS  184 (262)
                      +||+...|.. ++..|+.+.+...+|.+.   ....|+||+||+....|.++|+.++.+|++.+|+|||++++|||||||
T Consensus         1 vRpl~~~e~~~g~~~c~~~~~~~pqv~ig---~~~s~t~d~v~~~~~~Q~~~~e~~V~~l~~~lf~gynatvlaygQtgs   77 (913)
T KOG0244|consen    1 VRPLKQMEEEQGCRRCTEVSPRTPQVAIG---KDASFTYDKVFLDLESQKEVYESCVRPLREKLFAGYNATVLAYGQTGS   77 (913)
T ss_pred             CCCccchHHHhcchhhcccCCCCCceeec---CCcceeeeeeccCchHHHHHHHHHHHHHHHHHhhhhcceeeeecccCC
Confidence            6899988877 777777766666666554   578999999999999999999999999999999999999999999999


Q ss_pred             CCceecCCCC----CCCchHhhhhhccccccCc---cceEEEEEEEEEE---EEecCC-----CCceeeecCCCcEEEcC
Q psy17370        185 GKSYRGDSTL----NSSVLRPRVLFYPGFSWSH---SGWTGWVSCVVVI---AVDFGC-----GSWRFESKPSHEIYLSV  249 (262)
Q Consensus       185 GKTyTm~G~~----~~~Giipr~~~~lf~~~~~---~~~~~~vS~~EIy---l~Dll~-----~~l~i~ed~~~~v~v~g  249 (262)
                      ||||||.+..    ...|+|||+++.||.++.+   ..+.|.|+|+|||   ++||++     .++++++ +++++.+.|
T Consensus        78 gkTytmgt~~~~~~~~~Gvipr~v~~~f~~i~~~~~~~f~i~vs~vely~e~v~dl~~~~~~~~~i~~~e-~~g~it~~g  156 (913)
T KOG0244|consen   78 GKTYTMGTNDAPAQDTVGVIPRAVSTLFTRIGKTESFVFRITVSFVELYNEEVLDLLKPSRLKANIKLRE-PKGEITIRG  156 (913)
T ss_pred             CceeecccccccccccCCcCcchHHHHHHHHHhhhccceeeeeeeeeccchhhhhhcChhhhhhceeccc-cCCceEEEe
Confidence            9999998883    4469999999999998865   4689999999999   888885     5578888 788999999


Q ss_pred             ceEEecCChhhh
Q psy17370        250 SVLTDITKFIEV  261 (262)
Q Consensus       250 l~~~~V~s~~e~  261 (262)
                      +++..|....++
T Consensus       157 lte~tv~~~~q~  168 (913)
T KOG0244|consen  157 LTEKTVRMKLQL  168 (913)
T ss_pred             ehHHHHHHHHHH
Confidence            999998877765


No 29 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=99.71  E-value=2.9e-18  Score=145.26  Aligned_cols=53  Identities=45%  Similarity=0.768  Sum_probs=50.5

Q ss_pred             hhcccchhhHhhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhcccc
Q psy17370        156 VFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGF  209 (262)
Q Consensus       156 vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~  209 (262)
                      ||+.++ |+|+.+++|+|+|||+||||||||||||+|+..+.||||+++++++.
T Consensus         8 vf~~~~-~~v~~~~~G~n~~i~~yG~tGsGKT~Tm~G~~~~~Giip~~~~~~~~   60 (186)
T cd01363           8 VFRDVG-PLLQSALDGYNVCIFAYGQTGSGKTYTMEGKREGAGIIPRTVTDVID   60 (186)
T ss_pred             HHHHHH-HHHHHHhCCcceeEEEECCCCCcceEecCCCCCCCCcchHHHHHHHH
Confidence            999999 99999999999999999999999999999999999999999997633


No 30 
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=95.67  E-value=0.014  Score=56.57  Aligned_cols=83  Identities=20%  Similarity=0.178  Sum_probs=51.1

Q ss_pred             eeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecCC------CC-----CCCchHhhhhhcc
Q psy17370        139 YTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDS------TL-----NSSVLRPRVLFYP  207 (262)
Q Consensus       139 ~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~G------~~-----~~~Giipr~~~~l  207 (262)
                      ..|....-|.|.-+|-.    .+..|++.+-+|..--+ -.|.|||||||||--      -+     .+.-+--....++
T Consensus         3 ~~F~l~s~f~PaGDQP~----AI~~Lv~gi~~g~~~Qt-LLGvTGSGKTfT~AnVI~~~~rPtLV~AhNKTLAaQLy~Ef   77 (663)
T COG0556           3 KPFKLHSPFKPAGDQPE----AIAELVEGIENGLKHQT-LLGVTGSGKTFTMANVIAKVQRPTLVLAHNKTLAAQLYSEF   77 (663)
T ss_pred             CceEeccCCCCCCCcHH----HHHHHHHHHhcCceeeE-EeeeccCCchhHHHHHHHHhCCCeEEEecchhHHHHHHHHH
Confidence            35777777888888865    34566777666654333 359999999999931      11     1222222222221


Q ss_pred             ccccCccceEEEEEEEEEE
Q psy17370        208 GFSWSHSGWTGWVSCVVVI  226 (262)
Q Consensus       208 f~~~~~~~~~~~vS~~EIy  226 (262)
                      -.-+-+..+++.|||+..|
T Consensus        78 k~fFP~NaVEYFVSYYDYY   96 (663)
T COG0556          78 KEFFPENAVEYFVSYYDYY   96 (663)
T ss_pred             HHhCcCcceEEEeeecccc
Confidence            1112357888999999888


No 31 
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=94.97  E-value=0.0091  Score=51.80  Aligned_cols=50  Identities=22%  Similarity=0.381  Sum_probs=30.3

Q ss_pred             eeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        139 YTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       139 ~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ..|+||.-+. ...++..|.. +..+.+.--..+| .+|-||.+|+||||-|.
T Consensus         3 ~~~tFdnfv~-g~~N~~a~~~-~~~ia~~~~~~~~-~l~l~G~~G~GKTHLL~   52 (219)
T PF00308_consen    3 PKYTFDNFVV-GESNELAYAA-AKAIAENPGERYN-PLFLYGPSGLGKTHLLQ   52 (219)
T ss_dssp             TT-SCCCS---TTTTHHHHHH-HHHHHHSTTTSSS-EEEEEESTTSSHHHHHH
T ss_pred             CCCccccCCc-CCcHHHHHHH-HHHHHhcCCCCCC-ceEEECCCCCCHHHHHH
Confidence            4689998663 3456666654 3244444222234 47889999999999663


No 32 
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=93.20  E-value=0.039  Score=50.25  Aligned_cols=30  Identities=27%  Similarity=0.300  Sum_probs=26.7

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +-+++..+++-.++.|+.-|+|||||+.||
T Consensus       113 lP~i~~~~~~~~~GLILVTGpTGSGKSTTl  142 (353)
T COG2805         113 LPPIVRELAESPRGLILVTGPTGSGKSTTL  142 (353)
T ss_pred             CCHHHHHHHhCCCceEEEeCCCCCcHHHHH
Confidence            346677888999999999999999999998


No 33 
>PRK06893 DNA replication initiation factor; Validated
Probab=93.10  E-value=0.046  Score=47.62  Aligned_cols=48  Identities=17%  Similarity=0.133  Sum_probs=30.9

Q ss_pred             ceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        138 SYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       138 ~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ...++||..+... ++..     +.-+...+-+++|..++-||.+|+||||-+.
T Consensus        10 ~~~~~fd~f~~~~-~~~~-----~~~~~~~~~~~~~~~l~l~G~~G~GKThL~~   57 (229)
T PRK06893         10 IDDETLDNFYADN-NLLL-----LDSLRKNFIDLQQPFFYIWGGKSSGKSHLLK   57 (229)
T ss_pred             CCcccccccccCC-hHHH-----HHHHHHHhhccCCCeEEEECCCCCCHHHHHH
Confidence            4567888888543 2211     1122223334677788999999999999774


No 34 
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=92.55  E-value=0.048  Score=52.66  Aligned_cols=32  Identities=25%  Similarity=0.168  Sum_probs=27.2

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceecCC
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDS  192 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~G  192 (262)
                      -...+..+++.-++.|+.-|+||||||.||+.
T Consensus       246 ~~~~~~~~~~~p~GliLvTGPTGSGKTTTLY~  277 (500)
T COG2804         246 QLARLLRLLNRPQGLILVTGPTGSGKTTTLYA  277 (500)
T ss_pred             HHHHHHHHHhCCCeEEEEeCCCCCCHHHHHHH
Confidence            34566778889999999999999999999963


No 35 
>PRK14086 dnaA chromosomal replication initiation protein; Provisional
Probab=91.96  E-value=0.055  Score=53.79  Aligned_cols=52  Identities=23%  Similarity=0.339  Sum_probs=34.5

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      -+..|+||..+-. .+++..|.. +..+++..-.++|. ||-||.+|+||||-+.
T Consensus       281 L~~~~TFDnFvvG-~sN~~A~aa-a~avae~~~~~~Np-L~LyG~sGsGKTHLL~  332 (617)
T PRK14086        281 LNPKYTFDTFVIG-ASNRFAHAA-AVAVAEAPAKAYNP-LFIYGESGLGKTHLLH  332 (617)
T ss_pred             CCCCCCHhhhcCC-CccHHHHHH-HHHHHhCccccCCc-EEEECCCCCCHHHHHH
Confidence            4567899886633 345555533 33555543345675 8999999999999874


No 36 
>PRK09087 hypothetical protein; Validated
Probab=91.88  E-value=0.075  Score=46.31  Aligned_cols=49  Identities=18%  Similarity=0.185  Sum_probs=31.7

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ....|+||.-+.. ..+..+|..     +.....-.+..++=||.+||||||-+.
T Consensus        14 ~~~~~~~~~Fi~~-~~N~~a~~~-----l~~~~~~~~~~l~l~G~~GsGKThLl~   62 (226)
T PRK09087         14 HDPAYGRDDLLVT-ESNRAAVSL-----VDHWPNWPSPVVVLAGPVGSGKTHLAS   62 (226)
T ss_pred             CCCCCChhceeec-CchHHHHHH-----HHhcccCCCCeEEEECCCCCCHHHHHH
Confidence            4556788887743 334446663     333222235558899999999999885


No 37 
>PRK06620 hypothetical protein; Validated
Probab=91.73  E-value=0.059  Score=46.58  Aligned_cols=52  Identities=23%  Similarity=0.349  Sum_probs=33.4

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCc---eeEeeeeccCCCCceecCC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYN---VCLFAYGQTGSGKSYRGDS  192 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n---~~ifaYG~tgSGKTyTm~G  192 (262)
                      .+..|+||..+ ...+|...|.... .+.+.  -|+|   -.++=||+.|+||||-+..
T Consensus         9 ~~~~~tfd~Fv-vg~~N~~a~~~~~-~~~~~--~~~~~~~~~l~l~Gp~G~GKThLl~a   63 (214)
T PRK06620          9 TSSKYHPDEFI-VSSSNDQAYNIIK-NWQCG--FGVNPYKFTLLIKGPSSSGKTYLTKI   63 (214)
T ss_pred             CCCCCCchhhE-ecccHHHHHHHHH-HHHHc--cccCCCcceEEEECCCCCCHHHHHHH
Confidence            45578899877 3344555665543 22221  1333   3589999999999998853


No 38 
>PRK05642 DNA replication initiation factor; Validated
Probab=90.94  E-value=0.099  Score=45.69  Aligned_cols=48  Identities=10%  Similarity=0.153  Sum_probs=29.0

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCC----CceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNG----YNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G----~n~~ifaYG~tgSGKTyTm~  191 (262)
                      -+..|+||.-+...  +..     +...++...++    .+..++-||.+|+||||-+.
T Consensus        12 ~~~~~tfdnF~~~~--~~~-----a~~~~~~~~~~~~~~~~~~l~l~G~~G~GKTHLl~   63 (234)
T PRK05642         12 LRDDATFANYYPGA--NAA-----ALGYVERLCEADAGWTESLIYLWGKDGVGRSHLLQ   63 (234)
T ss_pred             CCCcccccccCcCC--hHH-----HHHHHHHHhhccccCCCCeEEEECCCCCCHHHHHH
Confidence            34568888877331  222     33444433222    12467889999999999764


No 39 
>PRK06526 transposase; Provisional
Probab=90.04  E-value=0.13  Score=45.65  Aligned_cols=40  Identities=13%  Similarity=0.172  Sum_probs=23.9

Q ss_pred             eCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        147 LGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       147 f~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      +.+...+..+..-.....++   .+.|  |+-||++|+||||.+.
T Consensus        77 ~~~~~~~~~~~~l~~~~fi~---~~~n--lll~Gp~GtGKThLa~  116 (254)
T PRK06526         77 HQRSLKRDTIAHLGTLDFVT---GKEN--VVFLGPPGTGKTHLAI  116 (254)
T ss_pred             cCCCcchHHHHHHhcCchhh---cCce--EEEEeCCCCchHHHHH
Confidence            33444444444333333332   3444  6889999999999875


No 40 
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=89.91  E-value=0.11  Score=49.92  Aligned_cols=51  Identities=18%  Similarity=0.286  Sum_probs=34.1

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      -+..|+||.-.. ...+...|..+. .+.+. -..+|. +|-||.+|+||||-|.
T Consensus        98 l~~~~tFdnFv~-g~~n~~a~~~~~-~~~~~-~~~~n~-l~lyG~~G~GKTHLl~  148 (440)
T PRK14088         98 LNPDYTFENFVV-GPGNSFAYHAAL-EVAKN-PGRYNP-LFIYGGVGLGKTHLLQ  148 (440)
T ss_pred             CCCCCccccccc-CCchHHHHHHHH-HHHhC-cCCCCe-EEEEcCCCCcHHHHHH
Confidence            466799998774 345666666533 33332 112564 9999999999999884


No 41 
>PRK08084 DNA replication initiation factor; Provisional
Probab=89.10  E-value=0.17  Score=44.21  Aligned_cols=49  Identities=12%  Similarity=0.161  Sum_probs=30.5

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ....|+||.-+..  .|...+.... .+..   ......++-||+.|+||||-+.
T Consensus        15 ~~~~~~fd~f~~~--~n~~a~~~l~-~~~~---~~~~~~l~l~Gp~G~GKThLl~   63 (235)
T PRK08084         15 LPDDETFASFYPG--DNDSLLAALQ-NALR---QEHSGYIYLWSREGAGRSHLLH   63 (235)
T ss_pred             CCCcCCccccccC--ccHHHHHHHH-HHHh---CCCCCeEEEECCCCCCHHHHHH
Confidence            3456788865533  5666554322 2221   2222468999999999999884


No 42 
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=88.73  E-value=0.16  Score=41.24  Aligned_cols=19  Identities=26%  Similarity=0.251  Sum_probs=14.9

Q ss_pred             ceeEeeeeccCCCCceecC
Q psy17370        173 NVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~  191 (262)
                      ...++..+.||||||++|.
T Consensus        25 ~~~~ll~~~tGsGKT~~~~   43 (184)
T PF04851_consen   25 ERRVLLNAPTGSGKTIIAL   43 (184)
T ss_dssp             CSEEEEEESTTSSHHHHHH
T ss_pred             CCCEEEEECCCCCcChhhh
Confidence            3445556799999999996


No 43 
>PRK14087 dnaA chromosomal replication initiation protein; Provisional
Probab=88.68  E-value=0.16  Score=48.84  Aligned_cols=49  Identities=22%  Similarity=0.320  Sum_probs=31.0

Q ss_pred             eeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        140 TFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       140 ~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .|+||.-... .+++..|.. ++.+++.-=..+| -+|-||.+|+||||-|.
T Consensus       111 ~~tFdnFv~g-~~n~~A~~a-a~~~a~~~~~~~n-pl~i~G~~G~GKTHLl~  159 (450)
T PRK14087        111 ENTFENFVIG-SSNEQAFIA-VQTVSKNPGISYN-PLFIYGESGMGKTHLLK  159 (450)
T ss_pred             ccchhcccCC-CcHHHHHHH-HHHHHhCcCcccC-ceEEECCCCCcHHHHHH
Confidence            5899986633 355666643 3344332111234 47899999999999884


No 44 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=88.43  E-value=0.19  Score=46.29  Aligned_cols=49  Identities=20%  Similarity=0.287  Sum_probs=30.8

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhC-CCceeEeeeeccCCCCceec
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFN-GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~-G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |.-|++...-...++-++.+. ..+..+++ +....++-||+.|+|||+++
T Consensus         8 l~~~~~p~~l~gRe~e~~~l~-~~l~~~~~~~~~~~i~I~G~~GtGKT~l~   57 (365)
T TIGR02928         8 LEPDYVPDRIVHRDEQIEELA-KALRPILRGSRPSNVFIYGKTGTGKTAVT   57 (365)
T ss_pred             CCCCCCCCCCCCcHHHHHHHH-HHHHHHHcCCCCCcEEEECCCCCCHHHHH
Confidence            334444444455555555544 33444454 44567899999999999987


No 45 
>PRK12377 putative replication protein; Provisional
Probab=88.18  E-value=0.21  Score=44.26  Aligned_cols=49  Identities=18%  Similarity=0.278  Sum_probs=32.4

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+||.-......|..++.. +..+++.+..+. ..++-||.+|+||||.+.
T Consensus        71 ~tFdnf~~~~~~~~~a~~~-a~~~a~~~~~~~-~~l~l~G~~GtGKThLa~  119 (248)
T PRK12377         71 CSFANYQVQNDGQRYALSQ-AKSIADELMTGC-TNFVFSGKPGTGKNHLAA  119 (248)
T ss_pred             CCcCCcccCChhHHHHHHH-HHHHHHHHHhcC-CeEEEECCCCCCHHHHHH
Confidence            3566654444556666654 445666665554 457788999999999874


No 46 
>PRK08116 hypothetical protein; Validated
Probab=87.76  E-value=0.18  Score=45.17  Aligned_cols=53  Identities=25%  Similarity=0.375  Sum_probs=34.4

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhC--CCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN--GYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~--G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .-..++||.-. ....+...|.. +...++.+.+  ..+..++-||.+|+||||-+.
T Consensus        78 ~~~~~tFdnf~-~~~~~~~a~~~-a~~y~~~~~~~~~~~~gl~l~G~~GtGKThLa~  132 (268)
T PRK08116         78 KFRNSTFENFL-FDKGSEKAYKI-ARKYVKKFEEMKKENVGLLLWGSVGTGKTYLAA  132 (268)
T ss_pred             HHHhcchhccc-CChHHHHHHHH-HHHHHHHHHhhccCCceEEEECCCCCCHHHHHH
Confidence            34456777644 34555555554 4455665543  334568899999999999874


No 47 
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=87.75  E-value=0.2  Score=47.33  Aligned_cols=52  Identities=21%  Similarity=0.293  Sum_probs=31.3

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      -+..|+||.-.- ...+...|.. ++.+.+..-..+| .++-||.+|+||||-+.
T Consensus       103 l~~~~tfd~fi~-g~~n~~a~~~-~~~~~~~~~~~~n-~l~l~G~~G~GKThL~~  154 (405)
T TIGR00362       103 LNPKYTFDNFVV-GKSNRLAHAA-ALAVAENPGKAYN-PLFIYGGVGLGKTHLLH  154 (405)
T ss_pred             CCCCCccccccc-CCcHHHHHHH-HHHHHhCcCccCC-eEEEECCCCCcHHHHHH
Confidence            446788888442 3455555544 2233333111234 47789999999999874


No 48 
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=87.17  E-value=0.23  Score=47.65  Aligned_cols=52  Identities=19%  Similarity=0.273  Sum_probs=31.6

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      -...|+||.-.. ...+...|..+ +.+.+.--..+| .++-||.+|+||||.+.
T Consensus       115 l~~~~tfd~fv~-g~~n~~a~~~~-~~~~~~~~~~~~-~l~l~G~~G~GKThL~~  166 (450)
T PRK00149        115 LNPKYTFDNFVV-GKSNRLAHAAA-LAVAENPGKAYN-PLFIYGGVGLGKTHLLH  166 (450)
T ss_pred             CCCCCccccccc-CCCcHHHHHHH-HHHHhCcCccCC-eEEEECCCCCCHHHHHH
Confidence            456788887442 33555555542 233332212334 47889999999999883


No 49 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=87.11  E-value=0.27  Score=45.79  Aligned_cols=46  Identities=20%  Similarity=0.239  Sum_probs=27.2

Q ss_pred             ceeeCCCCCcchhhcccchhhHhhhhC-CCceeEeeeeccCCCCceec
Q psy17370        144 DHCLGQDTDQTSVFTIIAQPLLDAAFN-GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       144 D~vf~~~~~q~~vy~~~~~plv~~~l~-G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.+.+.-...++-++... ..+...++ +....++-||+.|+|||+++
T Consensus        26 ~~~P~~l~~Re~e~~~l~-~~l~~~~~~~~~~~~lI~G~~GtGKT~l~   72 (394)
T PRK00411         26 DYVPENLPHREEQIEELA-FALRPALRGSRPLNVLIYGPPGTGKTTTV   72 (394)
T ss_pred             CCcCCCCCCHHHHHHHHH-HHHHHHhCCCCCCeEEEECCCCCCHHHHH
Confidence            333333334444444433 33334443 44456889999999999987


No 50 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=86.56  E-value=0.29  Score=37.49  Aligned_cols=19  Identities=32%  Similarity=0.482  Sum_probs=15.5

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      ....++-+|.+|+|||+.+
T Consensus        18 ~~~~v~i~G~~G~GKT~l~   36 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLA   36 (151)
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            3446788999999999866


No 51 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=86.15  E-value=0.24  Score=42.63  Aligned_cols=15  Identities=47%  Similarity=0.663  Sum_probs=12.8

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      +.-+|.||||||+|+
T Consensus        26 ~~I~G~TGsGKS~~~   40 (229)
T PF01935_consen   26 IAIFGTTGSGKSNTV   40 (229)
T ss_pred             EEEECCCCCCHHHHH
Confidence            345799999999998


No 52 
>PRK07952 DNA replication protein DnaC; Validated
Probab=85.97  E-value=0.34  Score=42.80  Aligned_cols=50  Identities=10%  Similarity=0.154  Sum_probs=30.4

Q ss_pred             eeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        140 TFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       140 ~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ..+||.-......|..++..+ ...++.+..+. ..++-||.+|+||||.+.
T Consensus        68 ~~tFdnf~~~~~~q~~al~~a-~~~~~~~~~~~-~~~~l~G~~GtGKThLa~  117 (244)
T PRK07952         68 NCSFENYRVECEGQMNALSKA-RQYVEEFDGNI-ASFIFSGKPGTGKNHLAA  117 (244)
T ss_pred             CCccccccCCCchHHHHHHHH-HHHHHhhccCC-ceEEEECCCCCCHHHHHH
Confidence            456665443334455555543 34444443443 367889999999999874


No 53 
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=85.96  E-value=0.26  Score=37.31  Aligned_cols=17  Identities=29%  Similarity=0.337  Sum_probs=14.1

Q ss_pred             EeeeeccCCCCceecCC
Q psy17370        176 LFAYGQTGSGKSYRGDS  192 (262)
Q Consensus       176 ifaYG~tgSGKTyTm~G  192 (262)
                      ++.+|.+|+|||+++..
T Consensus         3 ~~i~~~~G~GKT~~~~~   19 (144)
T cd00046           3 VLLAAPTGSGKTLAALL   19 (144)
T ss_pred             EEEECCCCCchhHHHHH
Confidence            45689999999998854


No 54 
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=85.68  E-value=0.36  Score=41.50  Aligned_cols=49  Identities=14%  Similarity=0.219  Sum_probs=28.6

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ....|+||..+..  .++.+... +..++..  ...+..++-||..|+||||-+
T Consensus        11 ~~~~~~~d~f~~~--~~~~~~~~-l~~~~~~--~~~~~~~~l~G~~G~GKT~La   59 (227)
T PRK08903         11 PPPPPTFDNFVAG--ENAELVAR-LRELAAG--PVADRFFYLWGEAGSGRSHLL   59 (227)
T ss_pred             CCChhhhcccccC--CcHHHHHH-HHHHHhc--cCCCCeEEEECCCCCCHHHHH
Confidence            3445888887722  22233221 2232221  133457889999999999976


No 55 
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=85.26  E-value=0.34  Score=47.14  Aligned_cols=28  Identities=21%  Similarity=0.209  Sum_probs=22.7

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+..++...++.|+-.|+||||||.||.
T Consensus       233 ~l~~~~~~~~GlilitGptGSGKTTtL~  260 (486)
T TIGR02533       233 RFERLIRRPHGIILVTGPTGSGKTTTLY  260 (486)
T ss_pred             HHHHHHhcCCCEEEEEcCCCCCHHHHHH
Confidence            4455667777888899999999999994


No 56 
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=85.20  E-value=0.38  Score=38.67  Aligned_cols=27  Identities=30%  Similarity=0.386  Sum_probs=20.0

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .++..+++|.+  ++..|+||+|||....
T Consensus         6 ~~~~~i~~~~~--~li~aptGsGKT~~~~   32 (169)
T PF00270_consen    6 EAIEAIISGKN--VLISAPTGSGKTLAYI   32 (169)
T ss_dssp             HHHHHHHTTSE--EEEECSTTSSHHHHHH
T ss_pred             HHHHHHHcCCC--EEEECCCCCccHHHHH
Confidence            34555666777  6678899999999764


No 57 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=85.04  E-value=0.3  Score=48.37  Aligned_cols=28  Identities=29%  Similarity=0.256  Sum_probs=23.2

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+..++..-++.|+-.|.||||||.||.
T Consensus       307 ~l~~~~~~~~Glilv~G~tGSGKTTtl~  334 (564)
T TIGR02538       307 LFLEAIHKPQGMVLVTGPTGSGKTVSLY  334 (564)
T ss_pred             HHHHHHHhcCCeEEEECCCCCCHHHHHH
Confidence            4556667778899999999999999984


No 58 
>PRK08181 transposase; Validated
Probab=84.89  E-value=0.49  Score=42.43  Aligned_cols=20  Identities=40%  Similarity=0.670  Sum_probs=16.1

Q ss_pred             CCCceeEeeeeccCCCCceecC
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .|.|  ++-||++|+||||-+.
T Consensus       105 ~~~n--lll~Gp~GtGKTHLa~  124 (269)
T PRK08181        105 KGAN--LLLFGPPGGGKSHLAA  124 (269)
T ss_pred             cCce--EEEEecCCCcHHHHHH
Confidence            3554  7889999999999774


No 59 
>PRK10436 hypothetical protein; Provisional
Probab=84.78  E-value=0.33  Score=46.93  Aligned_cols=28  Identities=25%  Similarity=0.243  Sum_probs=23.1

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+..++..-++.|+.-|+||||||.||.
T Consensus       209 ~l~~~~~~~~GliLvtGpTGSGKTTtL~  236 (462)
T PRK10436        209 QFRQALQQPQGLILVTGPTGSGKTVTLY  236 (462)
T ss_pred             HHHHHHHhcCCeEEEECCCCCChHHHHH
Confidence            3455666778899999999999999994


No 60 
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=84.25  E-value=0.32  Score=37.55  Aligned_cols=18  Identities=33%  Similarity=0.316  Sum_probs=12.9

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      +.+++-+|.+|+|||..+
T Consensus         4 ~~~~~i~G~~G~GKT~~~   21 (131)
T PF13401_consen    4 QRILVISGPPGSGKTTLI   21 (131)
T ss_dssp             ---EEEEE-TTSSHHHHH
T ss_pred             CcccEEEcCCCCCHHHHH
Confidence            457889999999999976


No 61 
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=84.22  E-value=0.45  Score=42.26  Aligned_cols=49  Identities=24%  Similarity=0.174  Sum_probs=29.4

Q ss_pred             eeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        139 YTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       139 ~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.|.+..+-.....+...+.... .+++.+-+|.|  ++-||+.|+||||-.
T Consensus        74 k~~~~~d~~~~~~~~~~~l~~~~-~~~~~~~~~~n--l~l~G~~G~GKThLa  122 (254)
T COG1484          74 KTFEEFDFEFQPGIDKKALEDLA-SLVEFFERGEN--LVLLGPPGVGKTHLA  122 (254)
T ss_pred             CCcccccccCCcchhHHHHHHHH-HHHHHhccCCc--EEEECCCCCcHHHHH
Confidence            34443333334445666666543 55545444444  566999999999966


No 62 
>PF13245 AAA_19:  Part of AAA domain
Probab=83.95  E-value=0.42  Score=34.39  Aligned_cols=25  Identities=20%  Similarity=0.220  Sum_probs=16.6

Q ss_pred             hhhhCCCceeEeeeeccCCCCceecC
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ...+. .+..+.--|..|||||+|+.
T Consensus         4 ~~al~-~~~~~vv~g~pGtGKT~~~~   28 (76)
T PF13245_consen    4 RRALA-GSPLFVVQGPPGTGKTTTLA   28 (76)
T ss_pred             HHHHh-hCCeEEEECCCCCCHHHHHH
Confidence            33445 23334448999999999874


No 63 
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=83.93  E-value=0.4  Score=45.51  Aligned_cols=49  Identities=20%  Similarity=0.288  Sum_probs=32.1

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhC---CCceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN---GYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~---G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+..|+||.-. ...+++..|..     ...+-+   +...-||-||.+|+||||-|.
T Consensus        80 l~~~ytFdnFv-~g~~N~~A~aa-----~~~va~~~g~~~nplfi~G~~GlGKTHLl~  131 (408)
T COG0593          80 LNPKYTFDNFV-VGPSNRLAYAA-----AKAVAENPGGAYNPLFIYGGVGLGKTHLLQ  131 (408)
T ss_pred             CCCCCchhhee-eCCchHHHHHH-----HHHHHhccCCcCCcEEEECCCCCCHHHHHH
Confidence            56679999865 44555554433     223332   223468999999999999983


No 64 
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=83.74  E-value=0.34  Score=42.91  Aligned_cols=18  Identities=33%  Similarity=0.331  Sum_probs=14.6

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.|+--|.||||||.+|
T Consensus       127 ~~~ili~G~tGSGKTT~l  144 (270)
T PF00437_consen  127 RGNILISGPTGSGKTTLL  144 (270)
T ss_dssp             TEEEEEEESTTSSHHHHH
T ss_pred             ceEEEEECCCccccchHH
Confidence            345566699999999998


No 65 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=83.59  E-value=0.47  Score=44.48  Aligned_cols=26  Identities=35%  Similarity=0.548  Sum_probs=19.3

Q ss_pred             HhhhhCCCce-eEeeeeccCCCCceec
Q psy17370        165 LDAAFNGYNV-CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       165 v~~~l~G~n~-~ifaYG~tgSGKTyTm  190 (262)
                      +..++.|.-. .++-||.+|+|||.++
T Consensus        33 l~~~~~~~~p~n~~iyG~~GTGKT~~~   59 (366)
T COG1474          33 LAPALRGERPSNIIIYGPTGTGKTATV   59 (366)
T ss_pred             HHHHhcCCCCccEEEECCCCCCHhHHH
Confidence            4455554433 3999999999999987


No 66 
>PF12846 AAA_10:  AAA-like domain
Probab=82.87  E-value=0.41  Score=42.18  Aligned_cols=19  Identities=37%  Similarity=0.410  Sum_probs=15.4

Q ss_pred             ceeEeeeeccCCCCceecC
Q psy17370        173 NVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~  191 (262)
                      |.-++..|.||||||++|.
T Consensus         1 n~h~~i~G~tGsGKT~~~~   19 (304)
T PF12846_consen    1 NPHTLILGKTGSGKTTLLK   19 (304)
T ss_pred             CCeEEEECCCCCcHHHHHH
Confidence            3456778999999999884


No 67 
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=82.60  E-value=0.52  Score=43.61  Aligned_cols=28  Identities=29%  Similarity=0.242  Sum_probs=20.6

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+..++.-..+.|+-.|.||||||.||.
T Consensus       113 ~l~~~~~~~~g~ili~G~tGSGKTT~l~  140 (343)
T TIGR01420       113 VLRELAERPRGLILVTGPTGSGKSTTLA  140 (343)
T ss_pred             HHHHHHhhcCcEEEEECCCCCCHHHHHH
Confidence            4444554445678888999999999993


No 68 
>PRK06835 DNA replication protein DnaC; Validated
Probab=82.59  E-value=0.54  Score=43.42  Aligned_cols=30  Identities=23%  Similarity=0.487  Sum_probs=21.9

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ++..++.+-.+. -.++-||++|+||||-+.
T Consensus       172 ~~~f~~~f~~~~-~~Lll~G~~GtGKThLa~  201 (329)
T PRK06835        172 CKNFIENFDKNN-ENLLFYGNTGTGKTFLSN  201 (329)
T ss_pred             HHHHHHHHhccC-CcEEEECCCCCcHHHHHH
Confidence            335666665444 458899999999999774


No 69 
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=82.52  E-value=0.64  Score=38.95  Aligned_cols=17  Identities=35%  Similarity=0.567  Sum_probs=14.5

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      .++-+|++|+||||-..
T Consensus        49 ~l~l~G~~G~GKThLa~   65 (178)
T PF01695_consen   49 NLILYGPPGTGKTHLAV   65 (178)
T ss_dssp             EEEEEESTTSSHHHHHH
T ss_pred             EEEEEhhHhHHHHHHHH
Confidence            47889999999999763


No 70 
>PRK08727 hypothetical protein; Validated
Probab=82.12  E-value=0.5  Score=41.17  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=15.5

Q ss_pred             eeEeeeeccCCCCceecC
Q psy17370        174 VCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm~  191 (262)
                      -.++-||.+|+||||-+.
T Consensus        42 ~~l~l~G~~G~GKThL~~   59 (233)
T PRK08727         42 DWLYLSGPAGTGKTHLAL   59 (233)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            358999999999999774


No 71 
>PRK08939 primosomal protein DnaI; Reviewed
Probab=82.10  E-value=0.52  Score=43.06  Aligned_cols=50  Identities=28%  Similarity=0.289  Sum_probs=30.3

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhCC-CceeEeeeeccCCCCceecC
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFNG-YNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G-~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+|+.+-.....+..++..+ ...++....| ..-.++-||.+|+||||-+.
T Consensus       124 atf~~~~~~~~~~~~~~~~~-~~fi~~~~~~~~~~gl~L~G~~G~GKThLa~  174 (306)
T PRK08939        124 ASLADIDLDDRDRLDALMAA-LDFLEAYPPGEKVKGLYLYGDFGVGKSYLLA  174 (306)
T ss_pred             CcHHHhcCCChHHHHHHHHH-HHHHHHhhccCCCCeEEEECCCCCCHHHHHH
Confidence            34444332223555666643 4566655443 23358899999999999874


No 72 
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=81.87  E-value=0.57  Score=41.77  Aligned_cols=28  Identities=21%  Similarity=0.253  Sum_probs=21.0

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+..++..-.+.|+-.|.||||||.+|.
T Consensus        71 ~l~~~~~~~~GlilisG~tGSGKTT~l~   98 (264)
T cd01129          71 IFRKLLEKPHGIILVTGPTGSGKTTTLY   98 (264)
T ss_pred             HHHHHHhcCCCEEEEECCCCCcHHHHHH
Confidence            3455565555667778999999999983


No 73 
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=81.71  E-value=0.34  Score=38.58  Aligned_cols=18  Identities=28%  Similarity=0.671  Sum_probs=13.7

Q ss_pred             ceeEeee-eccCCCCceec
Q psy17370        173 NVCLFAY-GQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaY-G~tgSGKTyTm  190 (262)
                      ...|+++ |.+|+||+|.-
T Consensus        52 KpLVlSfHG~tGtGKn~v~   70 (127)
T PF06309_consen   52 KPLVLSFHGWTGTGKNFVS   70 (127)
T ss_pred             CCEEEEeecCCCCcHHHHH
Confidence            3456665 99999999954


No 74 
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=80.80  E-value=0.68  Score=43.26  Aligned_cols=23  Identities=35%  Similarity=0.304  Sum_probs=18.5

Q ss_pred             hCCCceeEeeeeccCCCCceecC
Q psy17370        169 FNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      +.-..+.|+-.|+||||||.||.
T Consensus       130 ~~~~~glilI~GpTGSGKTTtL~  152 (358)
T TIGR02524       130 IAPQEGIVFITGATGSGKSTLLA  152 (358)
T ss_pred             HhccCCEEEEECCCCCCHHHHHH
Confidence            33346788889999999999983


No 75 
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=80.69  E-value=0.67  Score=43.54  Aligned_cols=19  Identities=37%  Similarity=0.300  Sum_probs=16.2

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++.++-.|+||||||.||
T Consensus       148 ~~GlilI~G~TGSGKTT~l  166 (372)
T TIGR02525       148 AAGLGLICGETGSGKSTLA  166 (372)
T ss_pred             cCCEEEEECCCCCCHHHHH
Confidence            3556778999999999998


No 76 
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=80.62  E-value=0.62  Score=42.85  Aligned_cols=27  Identities=30%  Similarity=0.302  Sum_probs=18.4

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..++.+.. .|+-.|.||||||.+|
T Consensus       139 ~~L~~~v~~~~-~ilI~G~tGSGKTTll  165 (319)
T PRK13894        139 EAIIAAVRAHR-NILVIGGTGSGKTTLV  165 (319)
T ss_pred             HHHHHHHHcCC-eEEEECCCCCCHHHHH
Confidence            45555555443 4555599999999876


No 77 
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=80.56  E-value=0.57  Score=39.73  Aligned_cols=18  Identities=39%  Similarity=0.374  Sum_probs=15.4

Q ss_pred             eeEeeeeccCCCCceecC
Q psy17370        174 VCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm~  191 (262)
                      +.|+-.|+||||||.++.
T Consensus         2 GlilI~GptGSGKTTll~   19 (198)
T cd01131           2 GLVLVTGPTGSGKSTTLA   19 (198)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            567778999999999983


No 78 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=79.91  E-value=0.91  Score=39.77  Aligned_cols=45  Identities=13%  Similarity=0.136  Sum_probs=27.7

Q ss_pred             eeCCCCCcchhhcccchh-h---HhhhhCCCceeEeeeeccCCCCceec
Q psy17370        146 CLGQDTDQTSVFTIIAQP-L---LDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       146 vf~~~~~q~~vy~~~~~p-l---v~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -|....+...+|...... .   +...++.....++-+|+.|+|||+.+
T Consensus        12 pF~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~G~~G~GKTtl~   60 (269)
T TIGR03015        12 PFQLLPDPDFFYPSKGHKRAMAYLEYGLSQREGFILITGEVGAGKTTLI   60 (269)
T ss_pred             CCCCCCCHHHhCCCHHHHHHHHHHHHHHhcCCCEEEEEcCCCCCHHHHH
Confidence            355555555666655432 2   22233444556778999999999877


No 79 
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=79.42  E-value=0.58  Score=44.34  Aligned_cols=92  Identities=18%  Similarity=0.261  Sum_probs=50.7

Q ss_pred             CeEEEEEeCCCCccccCCCcceEEEcCCceEE--EEcCC----------CCceeeeeceeeCCCCCcchhhcccchhhHh
Q psy17370         99 RMTVAVRIRPLLVKELHMDVSSIEISPDRREM--KVNDN----------AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLD  166 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i--~~~~~----------~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~  166 (262)
                      .-+.+|++....+.+.......+.++.....+  .++..          .+....+|+.|-+.+..-+++-+.+..|+..
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~~~~~~~~~~~~~~~~p~v~~~digGl~~~k~~l~~~v~~pl~~  167 (398)
T PTZ00454         88 GSNYYVRILSTLNRELLKPNASVALHRHSHAVVDILPPEADSSIQLLQMSEKPDVTYSDIGGLDIQKQEIREAVELPLTC  167 (398)
T ss_pred             CCEEEEecccccCHhhCCCCCEEEeeccchhHHHhccccccchhhhhcccCCCCCCHHHcCCHHHHHHHHHHHHHHHhcC
Confidence            34677887777766554333333333222111  01110          1334566777777666666666665556553


Q ss_pred             h-hhC--C--CceeEeeeeccCCCCceec
Q psy17370        167 A-AFN--G--YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       167 ~-~l~--G--~n~~ifaYG~tgSGKTyTm  190 (262)
                      . .++  |  ....|+-||+.|+|||+..
T Consensus       168 ~~~~~~~Gl~~pkgvLL~GppGTGKT~LA  196 (398)
T PTZ00454        168 PELYEQIGIDPPRGVLLYGPPGTGKTMLA  196 (398)
T ss_pred             HHHHHhcCCCCCceEEEECCCCCCHHHHH
Confidence            2 333  2  2345778999999999865


No 80 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=79.04  E-value=0.68  Score=34.91  Aligned_cols=16  Identities=31%  Similarity=0.540  Sum_probs=14.0

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-+|.+|+|||..+
T Consensus         4 ~~~l~G~~G~GKTtl~   19 (148)
T smart00382        4 VILIVGPPGSGKTTLA   19 (148)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            4677899999999988


No 81 
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=78.54  E-value=1.2  Score=44.96  Aligned_cols=81  Identities=21%  Similarity=0.214  Sum_probs=46.8

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecCCCC---CCCch--------Hhhhhhcccc
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTL---NSSVL--------RPRVLFYPGF  209 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~G~~---~~~Gi--------ipr~~~~lf~  209 (262)
                      |....-|.|.-.|..-++.    |++.+-+|....+ -+|.|||||||+|-.--   ..+-|        .-....+|-.
T Consensus         2 f~~~~~~~~~~~Q~~ai~~----l~~~~~~~~~~~~-l~Gvtgs~kt~~~a~~~~~~~~p~Lvi~~n~~~A~ql~~el~~   76 (655)
T TIGR00631         2 FKLHSPFQPAGDQPKAIAK----LVEGLTDGEKHQT-LLGVTGSGKTFTMANVIAQVNRPTLVIAHNKTLAAQLYNEFKE   76 (655)
T ss_pred             ceeccCCCCChHHHHHHHH----HHHhhhcCCCcEE-EECCCCcHHHHHHHHHHHHhCCCEEEEECCHHHHHHHHHHHHH
Confidence            4455567888888877665    4455555542223 68999999999984321   11111        1112222211


Q ss_pred             ccCccceEEEEEEEEEE
Q psy17370        210 SWSHSGWTGWVSCVVVI  226 (262)
Q Consensus       210 ~~~~~~~~~~vS~~EIy  226 (262)
                      -+.+....+.|||+-.|
T Consensus        77 f~p~~~V~~f~sy~d~y   93 (655)
T TIGR00631        77 FFPENAVEYFVSYYDYY   93 (655)
T ss_pred             hCCCCeEEEEeeecccC
Confidence            11344578889999888


No 82 
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=78.34  E-value=0.99  Score=47.06  Aligned_cols=28  Identities=29%  Similarity=0.503  Sum_probs=20.5

Q ss_pred             hhHhhhhC--CCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFN--GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~--G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+..++.  |-+.+||-||.+|+|||.|+
T Consensus       769 sfL~paIkgsgpnnvLYIyG~PGTGKTATV  798 (1164)
T PTZ00112        769 GFLESGIKQSGSNQILYISGMPGTGKTATV  798 (1164)
T ss_pred             HHHHHHHhcCCCCceEEEECCCCCCHHHHH
Confidence            33444443  44567889999999999987


No 83 
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=78.31  E-value=0.88  Score=43.78  Aligned_cols=52  Identities=19%  Similarity=0.286  Sum_probs=32.9

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhh--hCC--CceeEeeeeccCCCCceecC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAA--FNG--YNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~--l~G--~n~~ifaYG~tgSGKTyTm~  191 (262)
                      -+..|+||.-.- ..+++..|.. +..+.+..  ..|  +| -+|-||..|+||||-+.
T Consensus       104 l~~~~tFdnFv~-g~~N~~a~~~-a~~~a~~~~~~~~~~~n-pl~L~G~~G~GKTHLl~  159 (445)
T PRK12422        104 LDPLMTFANFLV-TPENDLPHRI-LQEFTKVSEQGKGFPFN-PIYLFGPEGSGKTHLMQ  159 (445)
T ss_pred             CCccccccceee-CCcHHHHHHH-HHHHHhccccccCCCCc-eEEEEcCCCCCHHHHHH
Confidence            467799998774 3456555543 33443322  223  34 46789999999999873


No 84 
>PRK09183 transposase/IS protein; Provisional
Probab=78.18  E-value=1.1  Score=39.77  Aligned_cols=20  Identities=25%  Similarity=0.345  Sum_probs=15.3

Q ss_pred             CCCceeEeeeeccCCCCceecC
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .|.|  ++-+|++|+||||-+.
T Consensus       101 ~~~~--v~l~Gp~GtGKThLa~  120 (259)
T PRK09183        101 RNEN--IVLLGPSGVGKTHLAI  120 (259)
T ss_pred             cCCe--EEEEeCCCCCHHHHHH
Confidence            4555  4568999999999763


No 85 
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=78.12  E-value=0.87  Score=38.63  Aligned_cols=27  Identities=19%  Similarity=0.175  Sum_probs=18.7

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+..++...+..++-.|.-|+||||+|
T Consensus         9 a~~~~l~~~~~~~~l~G~aGtGKT~~l   35 (196)
T PF13604_consen    9 AVRAILTSGDRVSVLQGPAGTGKTTLL   35 (196)
T ss_dssp             HHHHHHHCTCSEEEEEESTTSTHHHHH
T ss_pred             HHHHHHhcCCeEEEEEECCCCCHHHHH
Confidence            445565544434455799999999988


No 86 
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=77.72  E-value=0.85  Score=42.05  Aligned_cols=27  Identities=26%  Similarity=0.431  Sum_probs=18.4

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..++.+. ..|+--|.||||||.+|
T Consensus       135 ~~L~~~v~~~-~nilI~G~tGSGKTTll  161 (323)
T PRK13833        135 SVIRSAIDSR-LNIVISGGTGSGKTTLA  161 (323)
T ss_pred             HHHHHHHHcC-CeEEEECCCCCCHHHHH
Confidence            4444555432 23567799999999988


No 87 
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=77.08  E-value=0.89  Score=41.35  Aligned_cols=27  Identities=30%  Similarity=0.346  Sum_probs=19.4

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..++.+. ..|+-.|.||||||.+|
T Consensus       123 ~~L~~~v~~~-~~ilI~G~tGSGKTTll  149 (299)
T TIGR02782       123 DVLREAVLAR-KNILVVGGTGSGKTTLA  149 (299)
T ss_pred             HHHHHHHHcC-CeEEEECCCCCCHHHHH
Confidence            4555555543 45667799999999987


No 88 
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=76.81  E-value=1.5  Score=42.10  Aligned_cols=91  Identities=16%  Similarity=0.187  Sum_probs=44.9

Q ss_pred             eEEEEEeCCCCccccCCCcceEEEcCCce-EEEEcCCC-----------CceeeeeceeeCCCCCcchhhcccchhhHhh
Q psy17370        100 MTVAVRIRPLLVKELHMDVSSIEISPDRR-EMKVNDNA-----------KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDA  167 (262)
Q Consensus       100 IkV~vRiRP~~~~E~~~~~~~i~~~~~~~-~i~~~~~~-----------~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~  167 (262)
                      -..+|++.+..+.+.....+.+.+..... .+......           ....-+|+.|.+-+..-+++.+.+..++...
T Consensus       127 ~~~~~~~~~~~~~~~l~~~~~v~l~~~~~~~~~~~~~~~d~~~~~~~~~~~p~~~~~DIgGl~~qi~~l~e~v~lpl~~p  206 (438)
T PTZ00361        127 PEYYVNILSFVDKEQLEPGCSVLLHNKTHSVVGILLDEVDPLVSVMKVDKAPLESYADIGGLEQQIQEIKEAVELPLTHP  206 (438)
T ss_pred             CEEEEeccCcCCHhhCCCCCEEEEcCCCCceEecCccccchhhhhcccccCCCCCHHHhcCHHHHHHHHHHHHHhhhhCH
Confidence            46789998888777553444444443322 22221111           1111234444444333444444443444332


Q ss_pred             -hhC--CC--ceeEeeeeccCCCCceec
Q psy17370        168 -AFN--GY--NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       168 -~l~--G~--n~~ifaYG~tgSGKTyTm  190 (262)
                       ++.  |.  .-.++-||++|+|||...
T Consensus       207 ~~~~~~gi~~p~gVLL~GPPGTGKT~LA  234 (438)
T PTZ00361        207 ELYDDIGIKPPKGVILYGPPGTGKTLLA  234 (438)
T ss_pred             HHHHhcCCCCCcEEEEECCCCCCHHHHH
Confidence             111  11  123667999999999875


No 89 
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=76.77  E-value=1.2  Score=41.32  Aligned_cols=16  Identities=31%  Similarity=0.679  Sum_probs=13.9

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-||+.|+|||+.+
T Consensus       158 gvLL~GppGtGKT~la  173 (364)
T TIGR01242       158 GVLLYGPPGTGKTLLA  173 (364)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4788999999999876


No 90 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=76.55  E-value=1.3  Score=37.76  Aligned_cols=45  Identities=20%  Similarity=0.260  Sum_probs=27.9

Q ss_pred             eeeeeceeeCCCCCcchhhcccchhhHhhh-hCCCceeEeeeeccCCCCceec
Q psy17370        139 YTFKLDHCLGQDTDQTSVFTIIAQPLLDAA-FNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       139 ~~f~FD~vf~~~~~q~~vy~~~~~plv~~~-l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..++||.... . .+..+++.     +... .......|+-||..|+||||.+
T Consensus        10 ~~~~~~~~~~-~-~~~~~~~~-----l~~~~~~~~~~~lll~G~~G~GKT~la   55 (226)
T TIGR03420        10 DDPTFDNFYA-G-GNAELLAA-----LRQLAAGKGDRFLYLWGESGSGKSHLL   55 (226)
T ss_pred             CchhhcCcCc-C-CcHHHHHH-----HHHHHhcCCCCeEEEECCCCCCHHHHH
Confidence            3466766552 1 33333333     2222 2455667899999999999977


No 91 
>PHA00729 NTP-binding motif containing protein
Probab=76.36  E-value=1.4  Score=38.47  Aligned_cols=29  Identities=28%  Similarity=0.368  Sum_probs=22.1

Q ss_pred             hhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        162 QPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.+++.+.+|.-..|+-+|..|+||||-.
T Consensus         6 k~~~~~l~~~~f~nIlItG~pGvGKT~LA   34 (226)
T PHA00729          6 KKIVSAYNNNGFVSAVIFGKQGSGKTTYA   34 (226)
T ss_pred             HHHHHHHhcCCeEEEEEECCCCCCHHHHH
Confidence            44566666655567999999999999855


No 92 
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=76.19  E-value=1.1  Score=37.55  Aligned_cols=28  Identities=29%  Similarity=0.217  Sum_probs=18.2

Q ss_pred             hhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        162 QPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..++...+... ..+.--|.+|||||.+|
T Consensus        15 ~~~l~~~v~~g-~~i~I~G~tGSGKTTll   42 (186)
T cd01130          15 AAYLWLAVEAR-KNILISGGTGSGKTTLL   42 (186)
T ss_pred             HHHHHHHHhCC-CEEEEECCCCCCHHHHH
Confidence            34555555432 23455699999999876


No 93 
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=76.12  E-value=1.6  Score=39.42  Aligned_cols=28  Identities=29%  Similarity=0.215  Sum_probs=21.7

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ++++++.--.-+.|+--|.|||||+.||
T Consensus       117 evlk~la~~kRGLviiVGaTGSGKSTtm  144 (375)
T COG5008         117 EVLKDLALAKRGLVIIVGATGSGKSTTM  144 (375)
T ss_pred             HHHHHhhcccCceEEEECCCCCCchhhH
Confidence            4455555566778888899999999987


No 94 
>PF13479 AAA_24:  AAA domain
Probab=75.77  E-value=1.2  Score=38.27  Aligned_cols=20  Identities=35%  Similarity=0.602  Sum_probs=16.2

Q ss_pred             ceeEeeeeccCCCCceecCC
Q psy17370        173 NVCLFAYGQTGSGKSYRGDS  192 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~G  192 (262)
                      +..++-||+.|+|||+....
T Consensus         3 ~~~~lIyG~~G~GKTt~a~~   22 (213)
T PF13479_consen    3 PIKILIYGPPGSGKTTLAAS   22 (213)
T ss_pred             ceEEEEECCCCCCHHHHHHh
Confidence            45678899999999997743


No 95 
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=75.47  E-value=0.99  Score=36.79  Aligned_cols=27  Identities=44%  Similarity=0.496  Sum_probs=14.7

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +++....|....++-+|..|+|||+.+
T Consensus        15 ~l~~~~~~~~~~~ll~G~~G~GKT~ll   41 (185)
T PF13191_consen   15 LLDAAQSGSPRNLLLTGESGSGKTSLL   41 (185)
T ss_dssp             TTGGTSS-----EEE-B-TTSSHHHHH
T ss_pred             HHHHHHcCCCcEEEEECCCCCCHHHHH
Confidence            333334566778999999999999866


No 96 
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=75.34  E-value=1  Score=42.06  Aligned_cols=37  Identities=24%  Similarity=0.478  Sum_probs=27.0

Q ss_pred             CCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        150 DTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       150 ~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +..|+.+|+.++..+..    .....+|--|.-|+||||.+
T Consensus         3 n~eQ~~~~~~v~~~~~~----~~~~~~fv~G~~GtGKs~l~   39 (364)
T PF05970_consen    3 NEEQRRVFDTVIEAIEN----EEGLNFFVTGPAGTGKSFLI   39 (364)
T ss_pred             CHHHHHHHHHHHHHHHc----cCCcEEEEEcCCCCChhHHH
Confidence            35688999887654432    33345688899999999986


No 97 
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=74.85  E-value=0.86  Score=38.33  Aligned_cols=27  Identities=30%  Similarity=0.372  Sum_probs=19.3

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |.+.+-.|.+..++-||+.|+|||..|
T Consensus        11 l~~~l~~~~~~~~~l~G~rg~GKTsLl   37 (234)
T PF01637_consen   11 LKELLESGPSQHILLYGPRGSGKTSLL   37 (234)
T ss_dssp             HHHCHHH--SSEEEEEESTTSSHHHHH
T ss_pred             HHHHHHhhcCcEEEEEcCCcCCHHHHH
Confidence            333333466788999999999999977


No 98 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=74.84  E-value=0.19  Score=49.84  Aligned_cols=104  Identities=15%  Similarity=0.164  Sum_probs=65.0

Q ss_pred             CCeEEEEEeCCCCccccCCCcceEEEcC----CceEEEEc----CCCCceeeeeceeeCCCCCcchhhcccchhhHhhhh
Q psy17370         98 SRMTVAVRIRPLLVKELHMDVSSIEISP----DRREMKVN----DNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAF  169 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~~~~~~i~~~~----~~~~i~~~----~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l  169 (262)
                      .+++|+|+|+|.+..... ....+....    -...+...    ...+...|.||.+|.....+..++.... .+++..+
T Consensus       305 ~~~~~i~~Isp~~~~~~e-t~~tL~~a~rak~I~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~-~~~~~~~  382 (568)
T COG5059         305 CNTRVICTISPSSNSFEE-TINTLKFASRAKSIKNKIQVNSSSDSSREIEEIKFDLSEDRSEIEILVFREQS-QLSQSSL  382 (568)
T ss_pred             ccEEEEEEEcCCCCchHH-HHHHHHHHHHHhhcCCcccccCcCcchHHHHHHHhhhhhhhhhhhhHHHHHHH-hhhhhhh
Confidence            499999999999855321 001111100    00011111    1226678999999999999988888755 6667777


Q ss_pred             CCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhcccc
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGF  209 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~  209 (262)
                      +|    +++|++++++++++|.-.  ..++..-.+..++.
T Consensus       383 ~~----~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~  416 (568)
T COG5059         383 SG----IFAYMQSLKKETETLKSR--IDLIMKSIISGTFE  416 (568)
T ss_pred             hh----HHHHHhhhhhhhhcccch--hhhhhhhhhhhhhh
Confidence            77    899999999999999532  23444444343333


No 99 
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=74.48  E-value=1.1  Score=38.12  Aligned_cols=15  Identities=33%  Similarity=0.388  Sum_probs=13.2

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|+||+|||.|+
T Consensus         4 i~lvGptGvGKTTt~   18 (196)
T PF00448_consen    4 IALVGPTGVGKTTTI   18 (196)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCchHhHH
Confidence            566799999999987


No 100
>KOG0989|consensus
Probab=74.04  E-value=1.3  Score=40.51  Aligned_cols=30  Identities=23%  Similarity=0.332  Sum_probs=20.0

Q ss_pred             chhhHhhhhCC-CceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFNG-YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~G-~n~~ifaYG~tgSGKTyTm  190 (262)
                      +...+...+.+ .---.+-||+.|+|||.|.
T Consensus        44 vV~~L~~a~~~~~lp~~LFyGPpGTGKTSta   74 (346)
T KOG0989|consen   44 VVQVLKNALLRRILPHYLFYGPPGTGKTSTA   74 (346)
T ss_pred             HHHHHHHHHhhcCCceEEeeCCCCCcHhHHH
Confidence            33444444444 3334678999999999987


No 101
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=74.03  E-value=1.3  Score=40.98  Aligned_cols=27  Identities=22%  Similarity=0.225  Sum_probs=17.6

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..++.+. ..|+-.|.||||||.+|
T Consensus       151 ~~L~~~v~~~-~nili~G~tgSGKTTll  177 (332)
T PRK13900        151 EFLEHAVISK-KNIIISGGTSTGKTTFT  177 (332)
T ss_pred             HHHHHHHHcC-CcEEEECCCCCCHHHHH
Confidence            3444444333 23556799999999988


No 102
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=73.08  E-value=2.1  Score=44.09  Aligned_cols=36  Identities=31%  Similarity=0.302  Sum_probs=26.5

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccc
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFS  210 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~  210 (262)
                      .+..+++|.|+.|.|  +||||||-+-        ++| ++..|+..
T Consensus        30 a~~~i~~G~nvLiiA--PTGsGKTeAA--------fLp-il~~l~~~   65 (814)
T COG1201          30 AIPEIHSGENVLIIA--PTGSGKTEAA--------FLP-VINELLSL   65 (814)
T ss_pred             HHHHHhCCCceEEEc--CCCCChHHHH--------HHH-HHHHHHhc
Confidence            456678999999988  9999999754        444 45555444


No 103
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=73.05  E-value=1.8  Score=34.86  Aligned_cols=27  Identities=26%  Similarity=0.347  Sum_probs=17.4

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ++..++++. ..++-.|.+|+|||.++.
T Consensus        16 ~~~~~~~~~-~~~~i~~~~GsGKT~~~~   42 (201)
T smart00487       16 AIEALLSGL-RDVILAAPTGSGKTLAAL   42 (201)
T ss_pred             HHHHHHcCC-CcEEEECCCCCchhHHHH
Confidence            344455442 234556899999999774


No 104
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=72.32  E-value=1.2  Score=37.67  Aligned_cols=46  Identities=26%  Similarity=0.200  Sum_probs=24.8

Q ss_pred             eEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCccceEEEEEEEEEEEEecCCCCcee
Q psy17370        175 CLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRF  237 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~~~~~~~vS~~EIyl~Dll~~~l~i  237 (262)
                      -++.+|.+|||||.++.      .|+-..+..    ....+       ++|||+|.-...+..
T Consensus        40 h~li~G~tgsGKS~~l~------~ll~~l~~~----~~p~~-------~~l~iiD~k~~~l~~   85 (205)
T PF01580_consen   40 HLLIAGATGSGKSTLLR------TLLLSLALT----YSPDD-------VQLYIIDPKGSDLAP   85 (205)
T ss_dssp             SEEEE--TTSSHHHHHH------HHHHHHHTT------TTT-------EEEEEE-TTSSCCGG
T ss_pred             eEEEEcCCCCCccHHHH------HHHHHHHHH----hcCCc-------cEEEEEcCCccccch
Confidence            56789999999999884      233333221    11111       468899987544433


No 105
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=71.63  E-value=2.1  Score=36.94  Aligned_cols=19  Identities=26%  Similarity=0.515  Sum_probs=13.3

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+-.+++.|+.||||||..
T Consensus        18 ~~~~v~~~G~AGTGKT~LA   36 (205)
T PF02562_consen   18 NNDLVIVNGPAGTGKTFLA   36 (205)
T ss_dssp             H-SEEEEE--TTSSTTHHH
T ss_pred             hCCeEEEECCCCCcHHHHH
Confidence            4557899999999999854


No 106
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=71.40  E-value=1.7  Score=36.52  Aligned_cols=26  Identities=19%  Similarity=0.331  Sum_probs=15.7

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      |..++.... ..+-.|+.|+|||+++.
T Consensus        10 i~~~~~~~~-~~~i~GpPGTGKT~~l~   35 (236)
T PF13086_consen   10 IQSALSSNG-ITLIQGPPGTGKTTTLA   35 (236)
T ss_dssp             HHHHCTSSE--EEEE-STTSSHHHHHH
T ss_pred             HHHHHcCCC-CEEEECCCCCChHHHHH
Confidence            344443333 34557999999999873


No 107
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=71.39  E-value=1.8  Score=32.94  Aligned_cols=16  Identities=38%  Similarity=0.517  Sum_probs=13.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|.+|||||+..
T Consensus         1 vI~I~G~~gsGKST~a   16 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLA   16 (121)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             CEEEECCCCCCHHHHH
Confidence            3677899999999865


No 108
>PRK06921 hypothetical protein; Provisional
Probab=71.22  E-value=1.8  Score=38.67  Aligned_cols=19  Identities=32%  Similarity=0.329  Sum_probs=15.8

Q ss_pred             ceeEeeeeccCCCCceecC
Q psy17370        173 NVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~  191 (262)
                      ...++-||++|+||||-+.
T Consensus       117 ~~~l~l~G~~G~GKThLa~  135 (266)
T PRK06921        117 KNSIALLGQPGSGKTHLLT  135 (266)
T ss_pred             CCeEEEECCCCCcHHHHHH
Confidence            4467889999999999774


No 109
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=70.54  E-value=1.8  Score=39.09  Aligned_cols=20  Identities=30%  Similarity=0.265  Sum_probs=15.6

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |....++-||+.|+|||+++
T Consensus        34 ~~~~~lll~Gp~GtGKT~la   53 (337)
T PRK12402         34 PNLPHLLVQGPPGSGKTAAV   53 (337)
T ss_pred             CCCceEEEECCCCCCHHHHH
Confidence            44335778999999999876


No 110
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=70.34  E-value=1.3  Score=33.71  Aligned_cols=15  Identities=40%  Similarity=0.736  Sum_probs=13.3

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-||..|.|||+.+
T Consensus         1 I~i~G~~G~GKS~l~   15 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLA   15 (107)
T ss_pred             CEEECCCCCCHHHHH
Confidence            467999999999977


No 111
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=70.07  E-value=2  Score=40.42  Aligned_cols=51  Identities=22%  Similarity=0.369  Sum_probs=28.3

Q ss_pred             eeeeceeeCCCCCcchhhcccchhhHhh-hhC--C--CceeEeeeeccCCCCceec
Q psy17370        140 TFKLDHCLGQDTDQTSVFTIIAQPLLDA-AFN--G--YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       140 ~f~FD~vf~~~~~q~~vy~~~~~plv~~-~l~--G--~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++||.+-+-+..-+++.+.+..|+... .+.  |  ....|+-||+.|+|||+..
T Consensus       127 ~~~~~di~Gl~~~~~~l~~~i~~pl~~~~~~~~~g~~~p~gvLL~GppGtGKT~lA  182 (389)
T PRK03992        127 NVTYEDIGGLEEQIREVREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLA  182 (389)
T ss_pred             CCCHHHhCCcHHHHHHHHHHHHHHhhCHHHHHhcCCCCCCceEEECCCCCChHHHH
Confidence            3455555544444444444444444432 222  1  1334788999999999865


No 112
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=69.71  E-value=1.8  Score=38.96  Aligned_cols=21  Identities=24%  Similarity=0.312  Sum_probs=15.9

Q ss_pred             CCC-ceeEeeeeccCCCCceec
Q psy17370        170 NGY-NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~-n~~ifaYG~tgSGKTyTm  190 (262)
                      .|. ...++-||+.|+|||+.+
T Consensus        39 ~~~~~~~lll~G~~G~GKT~la   60 (316)
T PHA02544         39 KGRIPNMLLHSPSPGTGKTTVA   60 (316)
T ss_pred             cCCCCeEEEeeCcCCCCHHHHH
Confidence            444 345666999999999876


No 113
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=69.55  E-value=2.2  Score=38.42  Aligned_cols=20  Identities=35%  Similarity=0.282  Sum_probs=17.3

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .-+.+|.-||..|||||+-|
T Consensus        18 ~~~~~IgL~G~WGsGKSs~l   37 (325)
T PF07693_consen   18 DDPFVIGLYGEWGSGKSSFL   37 (325)
T ss_pred             CCCeEEEEECCCCCCHHHHH
Confidence            45778889999999999966


No 114
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=69.28  E-value=1.8  Score=32.98  Aligned_cols=15  Identities=27%  Similarity=0.527  Sum_probs=12.7

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-||+.|+|||+..
T Consensus         1 ill~G~~G~GKT~l~   15 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLA   15 (132)
T ss_dssp             EEEESSTTSSHHHHH
T ss_pred             CEEECcCCCCeeHHH
Confidence            466999999999865


No 115
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=69.22  E-value=4.1  Score=38.18  Aligned_cols=118  Identities=14%  Similarity=0.147  Sum_probs=71.1

Q ss_pred             CCCeEEEEEeCCCCccccCCCcceEEEcCCceEEE--EcCCC----------CceeeeeceeeCCCCCcchhhcccchhh
Q psy17370         97 CSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMK--VNDNA----------KSYTFKLDHCLGQDTDQTSVFTIIAQPL  164 (262)
Q Consensus        97 ~~~IkV~vRiRP~~~~E~~~~~~~i~~~~~~~~i~--~~~~~----------~~~~f~FD~vf~~~~~q~~vy~~~~~pl  164 (262)
                      ...-+.+|++.+..+.+.....+.+.++.+...|.  ++...          +.-.-+|+.|=+-+..-+++.+.+-.||
T Consensus        92 ~~g~~~vV~i~~~vd~~~L~pG~rVal~~~s~~Iv~vLp~~~Dp~V~~M~v~e~PdvtY~dIGGL~~Qi~EirE~VELPL  171 (406)
T COG1222          92 STGPKFVVNILSFVDRDLLEPGMRVALNRDSYSIVRVLPPEVDPRVSVMEVEEKPDVTYEDIGGLDEQIQEIREVVELPL  171 (406)
T ss_pred             CCCCeEEEeccCCcCHHHcCCCCEEEEcCCcceeeeeCCCccCchhheeeeccCCCCChhhccCHHHHHHHHHHHhcccc
Confidence            34567889999988877664555555554433332  22222          2223344445455555677777777788


Q ss_pred             Hhh-hhC--CCc--eeEeeeeccCCCCcee--------------cCCCC---CCCchHhhhhhccccccCcc
Q psy17370        165 LDA-AFN--GYN--VCLFAYGQTGSGKSYR--------------GDSTL---NSSVLRPRVLFYPGFSWSHS  214 (262)
Q Consensus       165 v~~-~l~--G~n--~~ifaYG~tgSGKTyT--------------m~G~~---~~~Giipr~~~~lf~~~~~~  214 (262)
                      .+. +|+  |..  --|+-||+.|+|||--              +.|+.   ..-|==+|.+.+||....++
T Consensus       172 ~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvvgSElVqKYiGEGaRlVRelF~lArek  243 (406)
T COG1222         172 KNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGSELVQKYIGEGARLVRELFELAREK  243 (406)
T ss_pred             cCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCceEEEeccHHHHHHHhccchHHHHHHHHHHhhc
Confidence            754 333  442  2478899999999852              23332   33455578888888877654


No 116
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=69.03  E-value=2.5  Score=35.23  Aligned_cols=24  Identities=29%  Similarity=0.480  Sum_probs=17.6

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .++.+++|.|  ++..++||+|||.+
T Consensus        29 ~~~~~~~~~~--~li~~~TG~GKT~~   52 (203)
T cd00268          29 AIPPLLSGRD--VIGQAQTGSGKTAA   52 (203)
T ss_pred             HHHHHhcCCc--EEEECCCCCcHHHH
Confidence            3455566877  45567999999986


No 117
>PTZ00424 helicase 45; Provisional
Probab=68.84  E-value=2.2  Score=39.65  Aligned_cols=26  Identities=23%  Similarity=0.418  Sum_probs=19.6

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+..+++|.|..  ..++||||||.+.
T Consensus        57 ~ai~~i~~~~d~i--i~apTGsGKT~~~   82 (401)
T PTZ00424         57 RGIKPILDGYDTI--GQAQSGTGKTATF   82 (401)
T ss_pred             HHHHHHhCCCCEE--EECCCCChHHHHH
Confidence            4456678898864  5679999999754


No 118
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=68.66  E-value=1.9  Score=43.73  Aligned_cols=21  Identities=29%  Similarity=0.457  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.|.||+-.|.+|||||+++
T Consensus        82 ~~~~Q~IiisGeSGsGKTe~~  102 (689)
T PF00063_consen   82 TRQNQSIIISGESGSGKTETS  102 (689)
T ss_dssp             HTSEEEEEEEESTTSSHHHHH
T ss_pred             cccccceeeccccccccccch
Confidence            589999999999999999884


No 119
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=68.61  E-value=2.2  Score=33.35  Aligned_cols=15  Identities=40%  Similarity=0.574  Sum_probs=12.8

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+..|..|||||+-.
T Consensus         2 ii~~G~pgsGKSt~a   16 (143)
T PF13671_consen    2 IILCGPPGSGKSTLA   16 (143)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            677899999999854


No 120
>KOG0354|consensus
Probab=68.38  E-value=3.3  Score=42.17  Aligned_cols=24  Identities=38%  Similarity=0.591  Sum_probs=20.4

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .+++.+| |.|+.|.+  +||+|||+-
T Consensus        69 eivq~AL-gkNtii~l--PTG~GKTfI   92 (746)
T KOG0354|consen   69 ELVQPAL-GKNTIIAL--PTGSGKTFI   92 (746)
T ss_pred             HHhHHhh-cCCeEEEe--ecCCCccch
Confidence            6788899 99987765  999999984


No 121
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=67.75  E-value=3  Score=39.90  Aligned_cols=24  Identities=38%  Similarity=0.508  Sum_probs=18.4

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .+..+++|.|  ++..++||||||.+
T Consensus        34 ai~~~l~g~d--vi~~a~TGsGKT~a   57 (460)
T PRK11776         34 SLPAILAGKD--VIAQAKTGSGKTAA   57 (460)
T ss_pred             HHHHHhcCCC--EEEECCCCCcHHHH
Confidence            3556778888  55677999999965


No 122
>KOG2373|consensus
Probab=67.57  E-value=4.1  Score=38.15  Aligned_cols=27  Identities=33%  Similarity=0.572  Sum_probs=20.0

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      |.++..|.|.   .-|||. |+||||||.-|
T Consensus       261 pvLNk~LkGhR~GElTvlT-GpTGsGKTTFl  290 (514)
T KOG2373|consen  261 PVLNKYLKGHRPGELTVLT-GPTGSGKTTFL  290 (514)
T ss_pred             hHHHHHhccCCCCceEEEe-cCCCCCceeEe
Confidence            5566777776   456665 99999999765


No 123
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=67.49  E-value=2.5  Score=40.04  Aligned_cols=25  Identities=24%  Similarity=0.482  Sum_probs=19.6

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..+..+++|.|  +++.++||+|||.+
T Consensus        30 ~ai~~~~~g~d--~l~~apTGsGKT~~   54 (434)
T PRK11192         30 EAIPPALDGRD--VLGSAPTGTGKTAA   54 (434)
T ss_pred             HHHHHHhCCCC--EEEECCCCChHHHH
Confidence            34566778887  67788999999986


No 124
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=67.42  E-value=2.5  Score=39.99  Aligned_cols=24  Identities=33%  Similarity=0.450  Sum_probs=18.1

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .+..+++|.|..+  -++||||||.+
T Consensus        38 aip~il~g~dvi~--~ApTGsGKTla   61 (423)
T PRK04837         38 ALPLTLAGRDVAG--QAQTGTGKTMA   61 (423)
T ss_pred             HHHHHhCCCcEEE--ECCCCchHHHH
Confidence            3456788988554  55999999975


No 125
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=66.84  E-value=2.1  Score=35.59  Aligned_cols=17  Identities=24%  Similarity=0.358  Sum_probs=14.1

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      +.++-+|++|+|||+..
T Consensus         4 ~~~ll~GpsGvGKT~la   20 (171)
T PF07724_consen    4 SNFLLAGPSGVGKTELA   20 (171)
T ss_dssp             EEEEEESSTTSSHHHHH
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            45777899999999865


No 126
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=66.24  E-value=2.2  Score=38.38  Aligned_cols=17  Identities=29%  Similarity=0.339  Sum_probs=13.5

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      .|.-.|++|+|||+|+.
T Consensus       196 vi~~vGptGvGKTTt~~  212 (282)
T TIGR03499       196 VIALVGPTGVGKTTTLA  212 (282)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            44455999999999984


No 127
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=66.03  E-value=3.2  Score=40.01  Aligned_cols=26  Identities=27%  Similarity=0.317  Sum_probs=19.4

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..|..+++|.++.  ...+||||||.+.
T Consensus        18 ~ai~~~l~g~dvl--v~apTGsGKTl~y   43 (470)
T TIGR00614        18 EVINAVLLGRDCF--VVMPTGGGKSLCY   43 (470)
T ss_pred             HHHHHHHcCCCEE--EEcCCCCcHhHHH
Confidence            4566788899754  4569999999753


No 128
>PRK13342 recombination factor protein RarA; Reviewed
Probab=66.01  E-value=2.6  Score=39.97  Aligned_cols=41  Identities=20%  Similarity=0.300  Sum_probs=24.0

Q ss_pred             CCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        149 QDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       149 ~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ....|+++... ...+..-+-.+.-..++-||+.|+|||+..
T Consensus        13 d~vGq~~~v~~-~~~L~~~i~~~~~~~ilL~GppGtGKTtLA   53 (413)
T PRK13342         13 EVVGQEHLLGP-GKPLRRMIEAGRLSSMILWGPPGTGKTTLA   53 (413)
T ss_pred             HhcCcHHHhCc-chHHHHHHHcCCCceEEEECCCCCCHHHHH
Confidence            34455555443 122333333444446666999999999866


No 129
>PRK04328 hypothetical protein; Provisional
Probab=65.95  E-value=4.9  Score=35.32  Aligned_cols=26  Identities=31%  Similarity=0.492  Sum_probs=20.7

Q ss_pred             hhHhhhhCC---CceeEeeeeccCCCCce
Q psy17370        163 PLLDAAFNG---YNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       163 plv~~~l~G---~n~~ifaYG~tgSGKTy  188 (262)
                      +-++.+|.|   ....++-+|..|+|||-
T Consensus        10 ~~LD~lL~GGip~gs~ili~G~pGsGKT~   38 (249)
T PRK04328         10 PGMDEILYGGIPERNVVLLSGGPGTGKSI   38 (249)
T ss_pred             hhHHHHhcCCCcCCcEEEEEcCCCCCHHH
Confidence            456778876   47778889999999975


No 130
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=65.18  E-value=2.1  Score=38.37  Aligned_cols=43  Identities=26%  Similarity=0.236  Sum_probs=24.8

Q ss_pred             eCCCCCcchhhcccchhhHhhhhC--CCceeEeeeeccCCCCceec
Q psy17370        147 LGQDTDQTSVFTIIAQPLLDAAFN--GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       147 f~~~~~q~~vy~~~~~plv~~~l~--G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |+....|+++-+... ..+.....  +....++-||+.|+|||+..
T Consensus         3 ~~~~iG~~~~~~~l~-~~l~~~~~~~~~~~~~ll~Gp~G~GKT~la   47 (305)
T TIGR00635         3 LAEFIGQEKVKEQLQ-LFIEAAKMRQEALDHLLLYGPPGLGKTTLA   47 (305)
T ss_pred             HHHHcCHHHHHHHHH-HHHHHHHhcCCCCCeEEEECCCCCCHHHHH
Confidence            344556666665522 33332221  22234667999999999966


No 131
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=65.09  E-value=2.2  Score=37.75  Aligned_cols=20  Identities=25%  Similarity=0.119  Sum_probs=14.6

Q ss_pred             CceeEeeeeccCCCCceecC
Q psy17370        172 YNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .++.++.-|.-|||||+||.
T Consensus        12 ~~~~~lV~a~AGSGKT~~l~   31 (315)
T PF00580_consen   12 TEGPLLVNAGAGSGKTTTLL   31 (315)
T ss_dssp             -SSEEEEEE-TTSSHHHHHH
T ss_pred             CCCCEEEEeCCCCCchHHHH
Confidence            45566677889999999984


No 132
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=64.78  E-value=3.3  Score=39.70  Aligned_cols=25  Identities=36%  Similarity=0.549  Sum_probs=19.0

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..|..+++|.|  +++-.+||||||.+
T Consensus        30 ~ai~~il~g~d--vlv~apTGsGKTla   54 (456)
T PRK10590         30 QAIPAVLEGRD--LMASAQTGTGKTAG   54 (456)
T ss_pred             HHHHHHhCCCC--EEEECCCCCcHHHH
Confidence            33556788988  55667999999976


No 133
>KOG0926|consensus
Probab=64.61  E-value=4.3  Score=41.79  Aligned_cols=18  Identities=39%  Similarity=0.569  Sum_probs=14.6

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      |-.++-+|+||||||.-+
T Consensus       271 n~vvIIcGeTGsGKTTQv  288 (1172)
T KOG0926|consen  271 NPVVIICGETGSGKTTQV  288 (1172)
T ss_pred             CCeEEEecCCCCCccccc
Confidence            445667799999999876


No 134
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=64.28  E-value=2.4  Score=39.43  Aligned_cols=26  Identities=31%  Similarity=0.461  Sum_probs=17.7

Q ss_pred             hhHhhhhC-CCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFN-GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~-G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..+.. +.|  |+--|.||||||.+|
T Consensus       153 ~~l~~~v~~~~n--ilI~G~tGSGKTTll  179 (344)
T PRK13851        153 AFLHACVVGRLT--MLLCGPTGSGKTTMS  179 (344)
T ss_pred             HHHHHHHHcCCe--EEEECCCCccHHHHH
Confidence            34444443 444  566799999999988


No 135
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=63.95  E-value=2.8  Score=39.65  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=15.7

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      ...|+.+|+||+|||.|+
T Consensus       174 ~~vi~lvGptGvGKTTT~  191 (388)
T PRK12723        174 KRVFILVGPTGVGKTTTI  191 (388)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            356788999999999998


No 136
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=63.55  E-value=4.1  Score=34.32  Aligned_cols=25  Identities=32%  Similarity=0.424  Sum_probs=18.1

Q ss_pred             hhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        166 DAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       166 ~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +.+|.|.   ...+.-||..|||||.-.
T Consensus         2 D~~l~GGi~~g~i~~i~G~~GsGKT~l~   29 (209)
T TIGR02237         2 DELLGGGVERGTITQIYGPPGSGKTNIC   29 (209)
T ss_pred             hhhhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            3455544   566788999999998753


No 137
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional
Probab=63.43  E-value=3.2  Score=39.27  Aligned_cols=52  Identities=19%  Similarity=0.259  Sum_probs=35.8

Q ss_pred             ceeeeeceeeCCCCCcchhhcccchhhHhhhhC--C--CceeEeeeeccCCCCcee
Q psy17370        138 SYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN--G--YNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       138 ~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~--G--~n~~ifaYG~tgSGKTyT  189 (262)
                      ...+.|+++.+..---..+.+.++.++.+.++.  |  .---|.-||+.|+|||+.
T Consensus       109 ~~~~~f~~~~g~~~~~p~f~dk~~~hi~kn~l~~~~ik~PlgllL~GPPGcGKTll  164 (413)
T PLN00020        109 QRTRSFDNLVGGYYIAPAFMDKVAVHIAKNFLALPNIKVPLILGIWGGKGQGKSFQ  164 (413)
T ss_pred             hhhcchhhhcCccccCHHHHHHHHHHHHhhhhhccCCCCCeEEEeeCCCCCCHHHH
Confidence            445677877666655666666677677777663  2  223466799999999986


No 138
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=63.36  E-value=3  Score=31.63  Aligned_cols=15  Identities=33%  Similarity=0.357  Sum_probs=12.2

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|.+|||||...
T Consensus         1 I~i~G~~GsGKtTia   15 (129)
T PF13238_consen    1 IGISGIPGSGKTTIA   15 (129)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             CEEECCCCCCHHHHH
Confidence            456799999999854


No 139
>KOG2543|consensus
Probab=63.09  E-value=2.7  Score=39.71  Aligned_cols=35  Identities=26%  Similarity=0.426  Sum_probs=24.2

Q ss_pred             EeeeeccCCCCceecCCCCCCCchHhhhhhccccccCccceEEEEEEEEEE
Q psy17370        176 LFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVI  226 (262)
Q Consensus       176 ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~~~~~~~vS~~EIy  226 (262)
                      |+-||.+||||||++              ..+|...  ..-.+|++++|-|
T Consensus        33 ~~iyG~sgTGKT~~~--------------r~~l~~~--n~~~vw~n~~ecf   67 (438)
T KOG2543|consen   33 VHIYGHSGTGKTYLV--------------RQLLRKL--NLENVWLNCVECF   67 (438)
T ss_pred             EEEeccCCCchhHHH--------------HHHHhhc--CCcceeeehHHhc
Confidence            588999999999976              2223333  3445777777777


No 140
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=62.66  E-value=2.9  Score=37.79  Aligned_cols=40  Identities=15%  Similarity=0.089  Sum_probs=27.3

Q ss_pred             eeEeeeeccCCCCceec---CCCC--------------CCCchHhhhhhccccccCc
Q psy17370        174 VCLFAYGQTGSGKSYRG---DSTL--------------NSSVLRPRVLFYPGFSWSH  213 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm---~G~~--------------~~~Giipr~~~~lf~~~~~  213 (262)
                      -.|+-||++|+|||++-   -+..              ++-|=-.|-+++||.+..+
T Consensus       152 knVLFyGppGTGKTm~Akalane~kvp~l~vkat~liGehVGdgar~Ihely~rA~~  208 (368)
T COG1223         152 KNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIGEHVGDGARRIHELYERARK  208 (368)
T ss_pred             ceeEEECCCCccHHHHHHHHhcccCCceEEechHHHHHHHhhhHHHHHHHHHHHHHh
Confidence            35788999999999864   2221              4455556777777776655


No 141
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=62.51  E-value=2.7  Score=32.95  Aligned_cols=15  Identities=27%  Similarity=0.530  Sum_probs=12.8

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-+|++|+|||..+
T Consensus         2 vlL~G~~G~GKt~l~   16 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLA   16 (139)
T ss_dssp             EEEEESSSSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999865


No 142
>PRK13764 ATPase; Provisional
Probab=62.17  E-value=3  Score=41.72  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=15.3

Q ss_pred             eeEeeeeccCCCCceecC
Q psy17370        174 VCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm~  191 (262)
                      ..|+-.|.||||||+++.
T Consensus       258 ~~ILIsG~TGSGKTTll~  275 (602)
T PRK13764        258 EGILIAGAPGAGKSTFAQ  275 (602)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            347888999999999883


No 143
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=62.15  E-value=3.8  Score=39.56  Aligned_cols=28  Identities=25%  Similarity=0.399  Sum_probs=19.0

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ...++..+..|.|..+  ||+.|+|||+..
T Consensus       184 le~l~~~L~~~~~iil--~GppGtGKT~lA  211 (459)
T PRK11331        184 IETILKRLTIKKNIIL--QGPPGVGKTFVA  211 (459)
T ss_pred             HHHHHHHHhcCCCEEE--ECCCCCCHHHHH
Confidence            3344555556666444  999999999855


No 144
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family. Members of this family are assumed to differ from each other in DNA site specificity.
Probab=62.09  E-value=4.1  Score=41.26  Aligned_cols=28  Identities=18%  Similarity=0.211  Sum_probs=17.6

Q ss_pred             hhHhhhhC-----CCceeEeeeeccCCCCceecC
Q psy17370        163 PLLDAAFN-----GYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       163 plv~~~l~-----G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .+++.+.+     |.+..|+ .-.||||||+||.
T Consensus       249 ~~~~~~~~~~~~~~~~~gli-~~~TGsGKT~t~~  281 (667)
T TIGR00348       249 KIVESITRKTWGKDERGGLI-WHTQGSGKTLTML  281 (667)
T ss_pred             HHHHHHHhcccCCCCceeEE-EEecCCCccHHHH
Confidence            34455554     3344443 3489999999994


No 145
>PRK10536 hypothetical protein; Provisional
Probab=61.97  E-value=4.4  Score=36.24  Aligned_cols=40  Identities=23%  Similarity=0.351  Sum_probs=24.9

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |.|..+-+-+..|.....        .+.+  +..++..|..|+||||..
T Consensus        52 ~~~~~i~p~n~~Q~~~l~--------al~~--~~lV~i~G~aGTGKT~La   91 (262)
T PRK10536         52 RDTSPILARNEAQAHYLK--------AIES--KQLIFATGEAGCGKTWIS   91 (262)
T ss_pred             cCCccccCCCHHHHHHHH--------HHhc--CCeEEEECCCCCCHHHHH
Confidence            444555555555544332        2233  237899999999999854


No 146
>PLN03025 replication factor C subunit; Provisional
Probab=61.22  E-value=3.5  Score=37.52  Aligned_cols=16  Identities=31%  Similarity=0.405  Sum_probs=13.3

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-||+.|+|||++.
T Consensus        36 ~lll~Gp~G~GKTtla   51 (319)
T PLN03025         36 NLILSGPPGTGKTTSI   51 (319)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3556999999999876


No 147
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=61.21  E-value=3.8  Score=37.29  Aligned_cols=27  Identities=30%  Similarity=0.304  Sum_probs=17.7

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++...+.+.. .+.--|.||||||..|
T Consensus       135 ~~l~~~v~~~~-~ili~G~tGsGKTTll  161 (308)
T TIGR02788       135 EFLRLAIASRK-NIIISGGTGSGKTTFL  161 (308)
T ss_pred             HHHHHHhhCCC-EEEEECCCCCCHHHHH
Confidence            44555554433 3444699999999966


No 148
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=61.08  E-value=3.3  Score=34.88  Aligned_cols=18  Identities=39%  Similarity=0.464  Sum_probs=13.5

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      -..+|.-|+.|||||+.+
T Consensus        15 P~~~i~aG~~GsGKSt~~   32 (199)
T PF06414_consen   15 PTLIIIAGQPGSGKSTLA   32 (199)
T ss_dssp             -EEEEEES-TTSTTHHHH
T ss_pred             CEEEEEeCCCCCCHHHHH
Confidence            356788899999999866


No 149
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=60.58  E-value=4.3  Score=41.22  Aligned_cols=21  Identities=24%  Similarity=0.433  Sum_probs=19.5

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T smart00242       89 DKENQSIIISGESGAGKTENT  109 (677)
T ss_pred             cCCCceEEEecCCCCcchHHH
Confidence            588999999999999999976


No 150
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=60.24  E-value=3.5  Score=38.77  Aligned_cols=17  Identities=29%  Similarity=0.347  Sum_probs=14.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..+.-.|+||+|||+|+
T Consensus       138 ~ii~lvGptGvGKTTti  154 (374)
T PRK14722        138 GVFALMGPTGVGKTTTT  154 (374)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            35566899999999998


No 151
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=59.91  E-value=2.8  Score=44.99  Aligned_cols=26  Identities=31%  Similarity=0.356  Sum_probs=17.7

Q ss_pred             hhhhCCCceeEeeeeccCCCCceecCC
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRGDS  192 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm~G  192 (262)
                      +.+.+|....++. ..||||||+||.+
T Consensus       427 ~a~~~g~r~~Ll~-maTGSGKT~tai~  452 (1123)
T PRK11448        427 KAIVEGQREILLA-MATGTGKTRTAIA  452 (1123)
T ss_pred             HHHHhccCCeEEE-eCCCCCHHHHHHH
Confidence            3344566544444 7999999999853


No 152
>PHA02653 RNA helicase NPH-II; Provisional
Probab=59.80  E-value=5.6  Score=40.38  Aligned_cols=25  Identities=24%  Similarity=0.361  Sum_probs=18.7

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .++..+++|.+  ++..|+||||||.-
T Consensus       171 qil~~i~~gkd--vIv~A~TGSGKTtq  195 (675)
T PHA02653        171 KIFEAWISRKP--VVLTGGTGVGKTSQ  195 (675)
T ss_pred             HHHHHHHhCCC--EEEECCCCCCchhH
Confidence            44555677775  47789999999975


No 153
>PRK06547 hypothetical protein; Provisional
Probab=59.42  E-value=5.6  Score=33.05  Aligned_cols=25  Identities=24%  Similarity=0.359  Sum_probs=16.6

Q ss_pred             hhhhCCCceeEeeeeccCCCCceec
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+..+.---|.-+|..|||||+..
T Consensus         8 ~~~~~~~~~~i~i~G~~GsGKTt~a   32 (172)
T PRK06547          8 ARLCGGGMITVLIDGRSGSGKTTLA   32 (172)
T ss_pred             HHhhcCCCEEEEEECCCCCCHHHHH
Confidence            3333444445666799999999854


No 154
>TIGR01389 recQ ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ.
Probab=59.04  E-value=4.9  Score=39.89  Aligned_cols=26  Identities=27%  Similarity=0.390  Sum_probs=19.9

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..|..+++|.|+.+  -.+||+|||.+.
T Consensus        20 ~~i~~il~g~dvlv--~~PTG~GKTl~y   45 (591)
T TIGR01389        20 EIISHVLDGRDVLV--VMPTGGGKSLCY   45 (591)
T ss_pred             HHHHHHHcCCCEEE--EcCCCccHhHHH
Confidence            55677889998544  459999999864


No 155
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=58.98  E-value=7.9  Score=33.62  Aligned_cols=26  Identities=31%  Similarity=0.551  Sum_probs=19.1

Q ss_pred             hhHhhhhCC-C--ceeEeeeeccCCCCce
Q psy17370        163 PLLDAAFNG-Y--NVCLFAYGQTGSGKSY  188 (262)
Q Consensus       163 plv~~~l~G-~--n~~ifaYG~tgSGKTy  188 (262)
                      +-++.+|.| .  ..+++-+|..|+|||-
T Consensus         8 ~~LD~~l~GG~~~gs~~lI~G~pGsGKT~   36 (237)
T TIGR03877         8 PGMDEILHGGIPERNVVLLSGGPGTGKSI   36 (237)
T ss_pred             HhHHHHhcCCCcCCeEEEEEcCCCCCHHH
Confidence            445666653 3  5667889999999986


No 156
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=58.96  E-value=6.9  Score=38.27  Aligned_cols=24  Identities=33%  Similarity=0.527  Sum_probs=18.0

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .+..+++|.|+  ++-.+||||||..
T Consensus       151 aip~il~g~dv--iv~ApTGSGKTla  174 (518)
T PLN00206        151 AIPAALSGRSL--LVSADTGSGKTAS  174 (518)
T ss_pred             HHHHHhcCCCE--EEEecCCCCccHH
Confidence            35667889875  5566999999964


No 157
>PF02456 Adeno_IVa2:  Adenovirus IVa2 protein;  InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter [].; GO: 0019083 viral transcription
Probab=58.10  E-value=3.3  Score=38.10  Aligned_cols=15  Identities=53%  Similarity=0.556  Sum_probs=12.5

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ...||+|||||++-+
T Consensus        90 ~~VYGPTG~GKSqLl  104 (369)
T PF02456_consen   90 GVVYGPTGSGKSQLL  104 (369)
T ss_pred             EEEECCCCCCHHHHH
Confidence            356999999999865


No 158
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=57.64  E-value=5.6  Score=38.28  Aligned_cols=26  Identities=27%  Similarity=0.270  Sum_probs=19.6

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+..+++|.|+.+.  .+||||||.+.
T Consensus       116 ~ai~~~~~G~dvi~~--apTGSGKTlay  141 (475)
T PRK01297        116 QVLGYTLAGHDAIGR--AQTGTGKTAAF  141 (475)
T ss_pred             HHHHHHhCCCCEEEE--CCCCChHHHHH
Confidence            445677899987654  49999999654


No 159
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=57.37  E-value=5.4  Score=40.51  Aligned_cols=21  Identities=24%  Similarity=0.520  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        85 ~~~~QsIiisGESGaGKTe~~  105 (674)
T cd01384          85 EGKSQSILVSGESGAGKTETT  105 (674)
T ss_pred             cCCCceEEEECCCCCCchhHH
Confidence            589999999999999999876


No 160
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=56.97  E-value=4  Score=35.99  Aligned_cols=17  Identities=24%  Similarity=0.458  Sum_probs=14.2

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..++-||+.|+|||+..
T Consensus        43 ~~vll~GppGtGKTtlA   59 (261)
T TIGR02881        43 LHMIFKGNPGTGKTTVA   59 (261)
T ss_pred             ceEEEEcCCCCCHHHHH
Confidence            44677999999999876


No 161
>PF06048 DUF927:  Domain of unknown function (DUF927);  InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=56.85  E-value=5.3  Score=35.93  Aligned_cols=34  Identities=29%  Similarity=0.340  Sum_probs=24.7

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceec------CCCCC
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRG------DSTLN  195 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm------~G~~~  195 (262)
                      +.||+ ..+.--+..+--||++++|||.++      +|++.
T Consensus       182 a~pLL-~~l~~~~~~~hl~G~Ss~GKTt~~~~a~Sv~G~p~  221 (286)
T PF06048_consen  182 AAPLL-SLLGVEGFGFHLYGQSSSGKTTALQLAASVWGNPD  221 (286)
T ss_pred             HHHHH-HHhCCCceEEEEEeCCCCCHHHHHHHhhhhCcCch
Confidence            33444 445566778889999999999865      67764


No 162
>PHA02244 ATPase-like protein
Probab=56.76  E-value=6.4  Score=37.11  Aligned_cols=20  Identities=35%  Similarity=0.360  Sum_probs=14.8

Q ss_pred             hCCCceeEeeeeccCCCCceec
Q psy17370        169 FNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -.|.+..|  +|++|+|||+-.
T Consensus       117 ~~~~PVLL--~GppGtGKTtLA  136 (383)
T PHA02244        117 NANIPVFL--KGGAGSGKNHIA  136 (383)
T ss_pred             hcCCCEEE--ECCCCCCHHHHH
Confidence            34666544  899999999754


No 163
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=56.59  E-value=5  Score=39.47  Aligned_cols=29  Identities=28%  Similarity=0.472  Sum_probs=20.8

Q ss_pred             hhhHhhhhCCCc--eeEeeeeccCCCCceec
Q psy17370        162 QPLLDAAFNGYN--VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~~l~G~n--~~ifaYG~tgSGKTyTm  190 (262)
                      +..++..+.|..  ..++-+|+.|+|||.|+
T Consensus        32 ~~wl~~~~~~~~~~~iLlLtGP~G~GKtttv   62 (519)
T PF03215_consen   32 RSWLEEMFSGSSPKRILLLTGPSGCGKTTTV   62 (519)
T ss_pred             HHHHHHHhccCCCcceEEEECCCCCCHHHHH
Confidence            344555555442  45778999999999998


No 164
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=56.33  E-value=5.4  Score=39.59  Aligned_cols=25  Identities=36%  Similarity=0.433  Sum_probs=18.8

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|..+|+|.|+.  +..+||||||.+.
T Consensus        39 ~ip~~l~G~Dvi--~~ApTGSGKTlaf   63 (572)
T PRK04537         39 TLPVALPGGDVA--GQAQTGTGKTLAF   63 (572)
T ss_pred             HHHHHhCCCCEE--EEcCCCCcHHHHH
Confidence            345678999854  4679999999753


No 165
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=56.33  E-value=4.7  Score=37.39  Aligned_cols=15  Identities=40%  Similarity=0.647  Sum_probs=12.3

Q ss_pred             eeEeeeeccCCCCce
Q psy17370        174 VCLFAYGQTGSGKSY  188 (262)
Q Consensus       174 ~~ifaYG~tgSGKTy  188 (262)
                      +-|+-.|+||||||+
T Consensus        98 SNILLiGPTGsGKTl  112 (408)
T COG1219          98 SNILLIGPTGSGKTL  112 (408)
T ss_pred             ccEEEECCCCCcHHH
Confidence            346778999999996


No 166
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=56.27  E-value=7.6  Score=34.13  Aligned_cols=41  Identities=27%  Similarity=0.263  Sum_probs=26.7

Q ss_pred             eCCCCCcchhhcccchhhHhhhhC-C-CceeEeeeeccCCCCce
Q psy17370        147 LGQDTDQTSVFTIIAQPLLDAAFN-G-YNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       147 f~~~~~q~~vy~~~~~plv~~~l~-G-~n~~ifaYG~tgSGKTy  188 (262)
                      |++...|+++-+. .+.+++.+.. | .-..++-||+.|.|||.
T Consensus        23 L~efiGQ~~l~~~-l~i~i~aa~~r~~~l~h~lf~GPPG~GKTT   65 (233)
T PF05496_consen   23 LDEFIGQEHLKGN-LKILIRAAKKRGEALDHMLFYGPPGLGKTT   65 (233)
T ss_dssp             CCCS-S-HHHHHH-HHHHHHHHHCTTS---EEEEESSTTSSHHH
T ss_pred             HHHccCcHHHHhh-hHHHHHHHHhcCCCcceEEEECCCccchhH
Confidence            5677888888876 3456666553 2 23457889999999986


No 167
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=56.07  E-value=7.1  Score=33.62  Aligned_cols=27  Identities=30%  Similarity=0.388  Sum_probs=20.3

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyT  189 (262)
                      +-++.+|.|.   ..++.-+|.+|+|||+-
T Consensus        12 ~~LD~~l~gG~~~g~~~~i~G~~GsGKt~l   41 (234)
T PRK06067         12 EELDRKLGGGIPFPSLILIEGDHGTGKSVL   41 (234)
T ss_pred             HHHHHhhCCCCcCCcEEEEECCCCCChHHH
Confidence            5567777644   66777889999999763


No 168
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=55.93  E-value=6.1  Score=40.25  Aligned_cols=21  Identities=33%  Similarity=0.612  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.|.
T Consensus        91 ~~~~QsIiisGESGAGKTet~  111 (692)
T cd01385          91 KKVNQCIVISGESGSGKTEST  111 (692)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            588999999999999999876


No 169
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=55.84  E-value=4.6  Score=41.32  Aligned_cols=21  Identities=29%  Similarity=0.382  Sum_probs=16.6

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.-..++-||+.|+|||+..
T Consensus        49 ~~~~~slLL~GPpGtGKTTLA   69 (725)
T PRK13341         49 ADRVGSLILYGPPGVGKTTLA   69 (725)
T ss_pred             cCCCceEEEECCCCCCHHHHH
Confidence            344456788999999999876


No 170
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=55.77  E-value=6.4  Score=39.63  Aligned_cols=25  Identities=32%  Similarity=0.445  Sum_probs=19.1

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|..+++|.+  ++..++||||||.+.
T Consensus        36 ai~~ll~g~d--vl~~ApTGsGKT~af   60 (629)
T PRK11634         36 CIPHLLNGRD--VLGMAQTGSGKTAAF   60 (629)
T ss_pred             HHHHHHcCCC--EEEEcCCCCcHHHHH
Confidence            4566778877  566779999999764


No 171
>PF04466 Terminase_3:  Phage terminase large subunit;  InterPro: IPR006701 Initiation of packaging of double-stranded viral DNA involves the specific interaction of the prohead with viral DNA in a process mediated by a phage-encoded terminase protein. The terminase enzymes are usually hetero-oligomers composed of a small and a large subunit. This region is found on the large subunit and possesses an endonuclease and ATPase activity that requires Mg2+ and a neutral or slightly basic reaction. This region is also found in bacterial sequences [, ].; GO: 0006323 DNA packaging; PDB: 2WBN_A 2WC9_A.
Probab=55.51  E-value=3.9  Score=38.53  Aligned_cols=18  Identities=33%  Similarity=0.301  Sum_probs=0.0

Q ss_pred             EeeeeccCCCCceecCCC
Q psy17370        176 LFAYGQTGSGKSYRGDST  193 (262)
Q Consensus       176 ifaYG~tgSGKTyTm~G~  193 (262)
                      +.+||..||||||++...
T Consensus         5 ~v~~GGrGS~KS~~~a~~   22 (387)
T PF04466_consen    5 IVLKGGRGSGKSSFIAQK   22 (387)
T ss_dssp             ------------------
T ss_pred             EEEECCCCchHHHHHHHH
Confidence            467999999999998654


No 172
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=55.50  E-value=5.6  Score=40.67  Aligned_cols=21  Identities=19%  Similarity=0.358  Sum_probs=19.5

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        88 ~~~~QsIiisGESGaGKTes~  108 (717)
T cd01382          88 LKMSQSIIVSGESGAGKTENT  108 (717)
T ss_pred             cCCCCeEEEecCCCCChhHHH
Confidence            589999999999999999976


No 173
>PRK13767 ATP-dependent helicase; Provisional
Probab=55.23  E-value=5.8  Score=41.46  Aligned_cols=24  Identities=33%  Similarity=0.480  Sum_probs=18.5

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceec
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +..+++|.|+.|.|  +||||||...
T Consensus        41 i~~il~g~nvli~A--PTGSGKTlaa   64 (876)
T PRK13767         41 IPLIHEGKNVLISS--PTGSGKTLAA   64 (876)
T ss_pred             HHHHHcCCCEEEEC--CCCCcHHHHH
Confidence            44567899877655  9999999863


No 174
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=55.22  E-value=6.3  Score=40.01  Aligned_cols=21  Identities=24%  Similarity=0.449  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTe~~  103 (679)
T cd00124          83 DRRNQSIIISGESGAGKTENT  103 (679)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            589999999999999999876


No 175
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=55.07  E-value=6.3  Score=40.03  Aligned_cols=21  Identities=29%  Similarity=0.612  Sum_probs=19.5

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTe~~  103 (674)
T cd01378          83 ENENQCVIISGESGAGKTEAA  103 (674)
T ss_pred             cCCCceEEEEcCCCCCcchHH
Confidence            589999999999999999976


No 176
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=55.01  E-value=6.9  Score=39.75  Aligned_cols=21  Identities=24%  Similarity=0.480  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T cd01383          89 DEVNQSIIISGESGAGKTETA  109 (677)
T ss_pred             cCCCceEEEecCCCCCcchHH
Confidence            589999999999999999876


No 177
>KOG0727|consensus
Probab=54.71  E-value=5  Score=36.10  Aligned_cols=116  Identities=17%  Similarity=0.197  Sum_probs=67.9

Q ss_pred             CCeEEEEEeCCCCccccCCCcceE----------EEcC--CceEEEEcCCCCceeeeeceeeCCCCCcchhhcccchhhH
Q psy17370         98 SRMTVAVRIRPLLVKELHMDVSSI----------EISP--DRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLL  165 (262)
Q Consensus        98 ~~IkV~vRiRP~~~~E~~~~~~~i----------~~~~--~~~~i~~~~~~~~~~f~FD~vf~~~~~q~~vy~~~~~plv  165 (262)
                      ..-.-+||+--..++|.......+          .+.+  ....|......+.-.-+|..|=+-+...++|-+.+-.||.
T Consensus        97 tgsny~vrilstidrellkps~svalhrhsnalvdvlppeadssi~ml~~~ekpdvsy~diggld~qkqeireavelplt  176 (408)
T KOG0727|consen   97 TGSNYYVRILSTIDRELLKPSASVALHRHSNALVDVLPPEADSSISMLGPDEKPDVSYADIGGLDVQKQEIREAVELPLT  176 (408)
T ss_pred             cCCceEEeehhhhhHHHcCCccchhhhhcccceeeccCCcccccccccCCCCCCCccccccccchhhHHHHHHHHhccch
Confidence            345678999888888865222222          2211  1112222222233344455565677777788888878887


Q ss_pred             hhhh-C--CCc--eeEeeeeccCCCCceec--------------CCCC---CCCchHhhhhhccccccCc
Q psy17370        166 DAAF-N--GYN--VCLFAYGQTGSGKSYRG--------------DSTL---NSSVLRPRVLFYPGFSWSH  213 (262)
Q Consensus       166 ~~~l-~--G~n--~~ifaYG~tgSGKTyTm--------------~G~~---~~~Giipr~~~~lf~~~~~  213 (262)
                      ..=| .  |..  --++-||+.|+|||--.              .|+.   ...|==||.+.++|....+
T Consensus       177 ~~~ly~qigidpprgvllygppg~gktml~kava~~t~a~firvvgsefvqkylgegprmvrdvfrlake  246 (408)
T KOG0727|consen  177 HADLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKE  246 (408)
T ss_pred             HHHHHHHhCCCCCcceEEeCCCCCcHHHHHHHHhhccchheeeeccHHHHHHHhccCcHHHHHHHHHHhc
Confidence            6643 1  332  24789999999997422              2332   3456668888888776654


No 178
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=54.65  E-value=6.5  Score=40.07  Aligned_cols=21  Identities=24%  Similarity=0.450  Sum_probs=19.3

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.|.||+.-|.+|||||.+.
T Consensus        88 ~~~~QsIiiSGESGAGKTes~  108 (693)
T cd01377          88 DRENQSILITGESGAGKTENT  108 (693)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            589999999999999999875


No 179
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=54.46  E-value=6.7  Score=39.86  Aligned_cols=21  Identities=33%  Similarity=0.577  Sum_probs=19.5

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+--|.+|||||.+.
T Consensus        84 ~~~~QsIiisGESGaGKTe~~  104 (677)
T cd01387          84 AKQNQCVIISGESGSGKTEAT  104 (677)
T ss_pred             cCCCceEEEEcCCCCCeehHH
Confidence            589999999999999999976


No 180
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=54.41  E-value=6.6  Score=37.32  Aligned_cols=37  Identities=24%  Similarity=0.380  Sum_probs=24.8

Q ss_pred             CCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCce
Q psy17370        151 TDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       151 ~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTy  188 (262)
                      ..|+.+... .++|=.-+-.|.-.+.+-||+.|+|||.
T Consensus        27 vGQ~HLlg~-~~~lrr~v~~~~l~SmIl~GPPG~GKTT   63 (436)
T COG2256          27 VGQEHLLGE-GKPLRRAVEAGHLHSMILWGPPGTGKTT   63 (436)
T ss_pred             cChHhhhCC-CchHHHHHhcCCCceeEEECCCCCCHHH
Confidence            445555544 2244333445777888899999999997


No 181
>smart00488 DEXDc2 DEAD-like helicases superfamily.
Probab=54.30  E-value=5.1  Score=36.15  Aligned_cols=37  Identities=19%  Similarity=0.009  Sum_probs=22.5

Q ss_pred             CCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        149 QDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       149 ~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      +...|.++-+    .+.+.+.+|.++  +.=.+||+|||.+.+
T Consensus         9 ~r~~Q~~~m~----~v~~~~~~~~~~--~~eapTGtGKTl~~L   45 (289)
T smart00488        9 PYPIQYEFME----ELKRVLDRGKIG--ILESPTGTGKTLSLL   45 (289)
T ss_pred             CCHHHHHHHH----HHHHHHHcCCcE--EEECCCCcchhHHHH
Confidence            3455555433    333445567654  445699999998764


No 182
>smart00489 DEXDc3 DEAD-like helicases superfamily.
Probab=54.30  E-value=5.1  Score=36.15  Aligned_cols=37  Identities=19%  Similarity=0.009  Sum_probs=22.5

Q ss_pred             CCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        149 QDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       149 ~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      +...|.++-+    .+.+.+.+|.++  +.=.+||+|||.+.+
T Consensus         9 ~r~~Q~~~m~----~v~~~~~~~~~~--~~eapTGtGKTl~~L   45 (289)
T smart00489        9 PYPIQYEFME----ELKRVLDRGKIG--ILESPTGTGKTLSLL   45 (289)
T ss_pred             CCHHHHHHHH----HHHHHHHcCCcE--EEECCCCcchhHHHH
Confidence            3455555433    333445567654  445699999998764


No 183
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=54.02  E-value=6.7  Score=34.70  Aligned_cols=25  Identities=32%  Similarity=0.429  Sum_probs=16.8

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ++..+..|.+..  -+|.+|+|||...
T Consensus        14 ~l~~l~~g~~vL--L~G~~GtGKT~lA   38 (262)
T TIGR02640        14 ALRYLKSGYPVH--LRGPAGTGKTTLA   38 (262)
T ss_pred             HHHHHhcCCeEE--EEcCCCCCHHHHH
Confidence            334444566554  4899999999743


No 184
>KOG0330|consensus
Probab=53.92  E-value=8.1  Score=36.62  Aligned_cols=25  Identities=36%  Similarity=0.396  Sum_probs=19.0

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -|-.+|.|..+.+.|  +||||||-+-
T Consensus        91 aiP~~L~g~dvIglA--eTGSGKT~af  115 (476)
T KOG0330|consen   91 AIPVALGGRDVIGLA--ETGSGKTGAF  115 (476)
T ss_pred             hcchhhCCCcEEEEe--ccCCCchhhh
Confidence            345678999876655  9999999754


No 185
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=53.88  E-value=8.7  Score=32.80  Aligned_cols=28  Identities=32%  Similarity=0.452  Sum_probs=21.1

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...+.-+|..|+|||.-.
T Consensus        10 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l~   40 (225)
T PRK09361         10 KMLDELLGGGFERGTITQIYGPPGSGKTNIC   40 (225)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            5567788644   456788999999998754


No 186
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=53.62  E-value=9.6  Score=39.32  Aligned_cols=30  Identities=27%  Similarity=0.387  Sum_probs=24.0

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      +..+++.+-+|.+-.++++ .||+|||||-+
T Consensus       174 I~rv~Eaf~~g~~raLlvM-ATGTGKTrTAi  203 (875)
T COG4096         174 IRRVIEAFSKGQNRALLVM-ATGTGKTRTAI  203 (875)
T ss_pred             HHHHHHHHhcCCceEEEEE-ecCCCcceeHH
Confidence            4556777788999877776 59999999985


No 187
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=53.61  E-value=7.3  Score=39.52  Aligned_cols=21  Identities=29%  Similarity=0.594  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTes~  103 (671)
T cd01381          83 EKKNQCIIISGESGAGKTEST  103 (671)
T ss_pred             cCCCceEEEEcCCCCCeehHH
Confidence            589999999999999999976


No 188
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=52.88  E-value=8  Score=38.66  Aligned_cols=25  Identities=32%  Similarity=0.510  Sum_probs=19.0

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..+..+++|.++.+.  ++||+|||.+
T Consensus        32 ~ai~~il~g~dvlv~--apTGsGKTl~   56 (607)
T PRK11057         32 EIIDAVLSGRDCLVV--MPTGGGKSLC   56 (607)
T ss_pred             HHHHHHHcCCCEEEE--cCCCchHHHH
Confidence            445667889887654  6999999974


No 189
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=52.78  E-value=5.7  Score=34.58  Aligned_cols=19  Identities=26%  Similarity=0.466  Sum_probs=16.0

Q ss_pred             ceeEeeeeccCCCCceecC
Q psy17370        173 NVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm~  191 (262)
                      ...++-||..|+|||+..-
T Consensus        12 ~~~~liyG~~G~GKtt~a~   30 (220)
T TIGR01618        12 PNMYLIYGKPGTGKTSTIK   30 (220)
T ss_pred             CcEEEEECCCCCCHHHHHH
Confidence            3458999999999999774


No 190
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=52.76  E-value=10  Score=36.78  Aligned_cols=26  Identities=23%  Similarity=0.342  Sum_probs=20.5

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCce
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSY  188 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTy  188 (262)
                      +-++.+|.|.   +.+++-+|..|+|||.
T Consensus         8 ~gLD~il~GGlp~g~~~Li~G~pGsGKT~   36 (484)
T TIGR02655         8 EGFDDISHGGLPIGRSTLVSGTSGTGKTL   36 (484)
T ss_pred             hhHHHhcCCCCCCCeEEEEEcCCCCCHHH
Confidence            4567777753   6788899999999985


No 191
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=52.72  E-value=9.2  Score=32.66  Aligned_cols=26  Identities=35%  Similarity=0.525  Sum_probs=19.8

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCce
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSY  188 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTy  188 (262)
                      +-++.+|.|.   +..++-+|.+|+|||.
T Consensus         6 ~~LD~~l~GGip~gs~~li~G~~GsGKT~   34 (226)
T PF06745_consen    6 PGLDELLGGGIPKGSVVLISGPPGSGKTT   34 (226)
T ss_dssp             TTHHHHTTTSEETTSEEEEEESTTSSHHH
T ss_pred             hhHHHhhcCCCCCCcEEEEEeCCCCCcHH
Confidence            4456777543   6778889999999986


No 192
>KOG0953|consensus
Probab=52.71  E-value=6.2  Score=39.04  Aligned_cols=39  Identities=18%  Similarity=0.049  Sum_probs=26.1

Q ss_pred             eEeeeeccCCCCceecC---CCC---CCCchHhhhhhccccccCc
Q psy17370        175 CLFAYGQTGSGKSYRGD---STL---NSSVLRPRVLFYPGFSWSH  213 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~---G~~---~~~Giipr~~~~lf~~~~~  213 (262)
                      -||..|+|+|||||.-.   +..   --.|-+-....++|.++..
T Consensus       193 Ii~H~GPTNSGKTy~ALqrl~~aksGvycGPLrLLA~EV~~r~na  237 (700)
T KOG0953|consen  193 IIMHVGPTNSGKTYRALQRLKSAKSGVYCGPLRLLAHEVYDRLNA  237 (700)
T ss_pred             EEEEeCCCCCchhHHHHHHHhhhccceecchHHHHHHHHHHHhhh
Confidence            37999999999999653   211   2346566666667666553


No 193
>KOG0335|consensus
Probab=52.55  E-value=6.3  Score=38.19  Aligned_cols=57  Identities=25%  Similarity=0.166  Sum_probs=35.7

Q ss_pred             hhCCCceeEeeeeccCCCCceecCCCC--------------CCCchHhhh---------hhccccccCccceEEEEEEEE
Q psy17370        168 AFNGYNVCLFAYGQTGSGKSYRGDSTL--------------NSSVLRPRV---------LFYPGFSWSHSGWTGWVSCVV  224 (262)
Q Consensus       168 ~l~G~n~~ifaYG~tgSGKTyTm~G~~--------------~~~Giipr~---------~~~lf~~~~~~~~~~~vS~~E  224 (262)
                      +.+|..  ++|.+|||||||+.-.++-              ...|..|++         +.+||...++-.+.-.|-.+.
T Consensus       108 i~~Grd--l~acAqTGsGKT~aFLiPii~~~~~~~~~~~~~~~~~~~P~~lIlapTReL~~Qi~nea~k~~~~s~~~~~~  185 (482)
T KOG0335|consen  108 ISGGRD--LMACAQTGSGKTAAFLIPIISYLLDEGPEDRGESGGGVYPRALILAPTRELVDQIYNEARKFSYLSGMKSVV  185 (482)
T ss_pred             eecCCc--eEEEccCCCcchHHHHHHHHHHHHhcCcccCcccCCCCCCceEEEeCcHHHhhHHHHHHHhhcccccceeee
Confidence            445555  4889999999999765542              111123333         234566666667777777788


Q ss_pred             EE
Q psy17370        225 VI  226 (262)
Q Consensus       225 Iy  226 (262)
                      +|
T Consensus       186 ~y  187 (482)
T KOG0335|consen  186 VY  187 (482)
T ss_pred             ee
Confidence            88


No 194
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=52.43  E-value=6  Score=35.34  Aligned_cols=21  Identities=24%  Similarity=0.295  Sum_probs=15.8

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|...-++-||+.|+|||+.+
T Consensus        35 ~~~~~~~ll~G~~G~GKt~~~   55 (319)
T PRK00440         35 EKNMPHLLFAGPPGTGKTTAA   55 (319)
T ss_pred             CCCCCeEEEECCCCCCHHHHH
Confidence            344344677999999999866


No 195
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=52.21  E-value=7.5  Score=39.58  Aligned_cols=21  Identities=24%  Similarity=0.504  Sum_probs=19.5

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiiSGESGaGKTes~  103 (691)
T cd01380          83 DEKNQSIIVSGESGAGKTVSA  103 (691)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            699999999999999999875


No 196
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=52.14  E-value=5.3  Score=34.25  Aligned_cols=13  Identities=46%  Similarity=0.460  Sum_probs=11.4

Q ss_pred             eeeccCCCCceec
Q psy17370        178 AYGQTGSGKSYRG  190 (262)
Q Consensus       178 aYG~tgSGKTyTm  190 (262)
                      -.|++|+|||.+|
T Consensus        30 ivGpNGaGKSTll   42 (212)
T cd03274          30 IVGPNGSGKSNVI   42 (212)
T ss_pred             EECCCCCCHHHHH
Confidence            4599999999987


No 197
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=52.06  E-value=6.6  Score=35.83  Aligned_cols=22  Identities=32%  Similarity=0.252  Sum_probs=18.7

Q ss_pred             CCCceeEeeeeccCCCCceecC
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ...+..++-||..|||||.+|.
T Consensus        20 ~~~~~r~vL~G~~GsGKS~~L~   41 (309)
T PF10236_consen   20 SSKNNRYVLTGERGSGKSVLLA   41 (309)
T ss_pred             cCCceEEEEECCCCCCHHHHHH
Confidence            4567778999999999999984


No 198
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]
Probab=51.32  E-value=6.1  Score=36.74  Aligned_cols=26  Identities=31%  Similarity=0.280  Sum_probs=18.5

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ++..+.++. +.|+--|-||||||.++
T Consensus       165 ~L~~av~~r-~NILisGGTGSGKTTlL  190 (355)
T COG4962         165 FLRRAVGIR-CNILISGGTGSGKTTLL  190 (355)
T ss_pred             HHHHHHhhc-eeEEEeCCCCCCHHHHH
Confidence            333444444 66777899999999876


No 199
>PRK05580 primosome assembly protein PriA; Validated
Probab=50.96  E-value=5  Score=40.74  Aligned_cols=17  Identities=35%  Similarity=0.294  Sum_probs=14.0

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..++.+|.||||||...
T Consensus       163 ~~~Ll~~~TGSGKT~v~  179 (679)
T PRK05580        163 SPFLLDGVTGSGKTEVY  179 (679)
T ss_pred             CcEEEECCCCChHHHHH
Confidence            34788999999999765


No 200
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=50.95  E-value=6.2  Score=35.35  Aligned_cols=27  Identities=26%  Similarity=0.322  Sum_probs=18.8

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+++.++.. +--++-.|++|+|||-.+
T Consensus        24 ~ll~~l~~~-~~pvLl~G~~GtGKT~li   50 (272)
T PF12775_consen   24 YLLDLLLSN-GRPVLLVGPSGTGKTSLI   50 (272)
T ss_dssp             HHHHHHHHC-TEEEEEESSTTSSHHHHH
T ss_pred             HHHHHHHHc-CCcEEEECCCCCchhHHH
Confidence            445555543 335577899999999877


No 201
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.
Probab=50.93  E-value=8.3  Score=39.57  Aligned_cols=26  Identities=31%  Similarity=0.275  Sum_probs=19.9

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+..+++|.|+.+.|  +||||||..-
T Consensus        43 ~ai~~il~G~nvvv~a--pTGSGKTla~   68 (742)
T TIGR03817        43 RAAELAHAGRHVVVAT--GTASGKSLAY   68 (742)
T ss_pred             HHHHHHHCCCCEEEEC--CCCCcHHHHH
Confidence            3455678999977665  8999999853


No 202
>PRK00131 aroK shikimate kinase; Reviewed
Probab=50.83  E-value=6.8  Score=31.47  Aligned_cols=16  Identities=38%  Similarity=0.513  Sum_probs=13.8

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-+|..|||||+.-
T Consensus         6 ~i~l~G~~GsGKstla   21 (175)
T PRK00131          6 NIVLIGFMGAGKSTIG   21 (175)
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            6888999999999863


No 203
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type. subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. It contains helicase motifs and appears to represent the Cas3 protein of the Cyano subtype of CRISPR/Cas system.
Probab=50.74  E-value=9  Score=35.55  Aligned_cols=26  Identities=23%  Similarity=0.268  Sum_probs=20.4

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceec
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.+.+|.+..++.-.+||||||...
T Consensus         6 ~~~~~~~~~~~~~i~apTGsGKT~~~   31 (357)
T TIGR03158         6 FEALQSKDADIIFNTAPTGAGKTLAW   31 (357)
T ss_pred             HHHHHcCCCCEEEEECCCCCCHHHHH
Confidence            45567787777788899999999863


No 204
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=50.43  E-value=11  Score=31.95  Aligned_cols=28  Identities=29%  Similarity=0.446  Sum_probs=19.9

Q ss_pred             hhHhhhhCC-C--ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNG-Y--NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G-~--n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.| .  ...+.-+|..|+|||.-.
T Consensus         6 ~~LD~~l~GGi~~g~i~~i~G~~GsGKT~l~   36 (218)
T cd01394           6 KGLDELLGGGVERGTVTQVYGPPGTGKTNIA   36 (218)
T ss_pred             hHHHHHhcCCccCCeEEEEECCCCCCHHHHH
Confidence            446677763 3  344678999999999854


No 205
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion. These proteins aid the transfer of DNA from the plasmid into the host bacterial chromosome. They contain an ATP binding domain. VirD4 is involved in DNA transfer to plant cells and is required for virulence.
Probab=50.27  E-value=7.8  Score=36.15  Aligned_cols=16  Identities=25%  Similarity=0.272  Sum_probs=13.3

Q ss_pred             EeeeeccCCCCceecC
Q psy17370        176 LFAYGQTGSGKSYRGD  191 (262)
Q Consensus       176 ifaYG~tgSGKTyTm~  191 (262)
                      ++..|.||||||.++.
T Consensus         2 ~lv~g~tGsGKt~~~v   17 (384)
T cd01126           2 VLVFAPTRSGKGVGFV   17 (384)
T ss_pred             eeEecCCCCCCccEEE
Confidence            4678999999999873


No 206
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=50.18  E-value=4.6  Score=36.36  Aligned_cols=12  Identities=42%  Similarity=0.578  Sum_probs=11.1

Q ss_pred             eeccCCCCceec
Q psy17370        179 YGQTGSGKSYRG  190 (262)
Q Consensus       179 YG~tgSGKTyTm  190 (262)
                      .|.+|||||.||
T Consensus        33 iGpSGsGKTTtL   44 (309)
T COG1125          33 IGPSGSGKTTTL   44 (309)
T ss_pred             ECCCCCcHHHHH
Confidence            499999999998


No 207
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=50.08  E-value=6  Score=37.82  Aligned_cols=17  Identities=29%  Similarity=0.319  Sum_probs=13.6

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      .++-.|++|+|||+|+.
T Consensus       223 ~i~~vGptGvGKTTt~~  239 (424)
T PRK05703        223 VVALVGPTGVGKTTTLA  239 (424)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45556999999999873


No 208
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=50.02  E-value=6.5  Score=31.14  Aligned_cols=15  Identities=47%  Similarity=0.731  Sum_probs=12.2

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|..|||||+.-
T Consensus         2 i~l~G~~GsGKST~a   16 (150)
T cd02021           2 IVVMGVSGSGKSTVG   16 (150)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            566799999998853


No 209
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=49.81  E-value=6.6  Score=35.40  Aligned_cols=19  Identities=32%  Similarity=0.662  Sum_probs=17.0

Q ss_pred             CCceeEeeeeccCCCCcee
Q psy17370        171 GYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyT  189 (262)
                      |++-+|+.-|++|+|||.-
T Consensus         2 g~~fnImVvG~sG~GKTTF   20 (281)
T PF00735_consen    2 GFNFNIMVVGESGLGKTTF   20 (281)
T ss_dssp             EEEEEEEEEECTTSSHHHH
T ss_pred             CceEEEEEECCCCCCHHHH
Confidence            7788999999999999983


No 210
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=49.61  E-value=5.9  Score=37.56  Aligned_cols=17  Identities=29%  Similarity=0.417  Sum_probs=14.1

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      --++.+|.||||||..|
T Consensus        43 ~h~~i~g~tGsGKt~~i   59 (410)
T cd01127          43 AHTMIIGTTGTGKTTQI   59 (410)
T ss_pred             ccEEEEcCCCCCHHHHH
Confidence            34678899999999866


No 211
>PTZ00110 helicase; Provisional
Probab=49.60  E-value=8  Score=38.11  Aligned_cols=23  Identities=30%  Similarity=0.502  Sum_probs=18.0

Q ss_pred             HhhhhCCCceeEeeeeccCCCCcee
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      +..+++|.+..  +.++||||||.+
T Consensus       161 ip~~l~G~dvI--~~ApTGSGKTla  183 (545)
T PTZ00110        161 WPIALSGRDMI--GIAETGSGKTLA  183 (545)
T ss_pred             HHHHhcCCCEE--EEeCCCChHHHH
Confidence            45678898764  567999999976


No 212
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=49.52  E-value=6.8  Score=30.62  Aligned_cols=15  Identities=40%  Similarity=0.787  Sum_probs=12.4

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      +.-+|.+|+|||+.+
T Consensus         2 ~~i~G~~G~GKT~l~   16 (165)
T cd01120           2 ILVFGPTGSGKTTLA   16 (165)
T ss_pred             eeEeCCCCCCHHHHH
Confidence            345899999999966


No 213
>PRK04195 replication factor C large subunit; Provisional
Probab=49.46  E-value=7.5  Score=37.63  Aligned_cols=28  Identities=25%  Similarity=0.490  Sum_probs=19.6

Q ss_pred             hhHhhhhCCC-ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY-NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~-n~~ifaYG~tgSGKTyTm  190 (262)
                      .++.....|. .-.++-||+.|+|||+..
T Consensus        28 ~~l~~~~~g~~~~~lLL~GppG~GKTtla   56 (482)
T PRK04195         28 EWIESWLKGKPKKALLLYGPPGVGKTSLA   56 (482)
T ss_pred             HHHHHHhcCCCCCeEEEECCCCCCHHHHH
Confidence            3344444554 456788999999999876


No 214
>PF05729 NACHT:  NACHT domain
Probab=49.26  E-value=6.9  Score=30.89  Aligned_cols=15  Identities=47%  Similarity=0.569  Sum_probs=13.3

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ++-+|..|+|||..|
T Consensus         3 l~I~G~~G~GKStll   17 (166)
T PF05729_consen    3 LWISGEPGSGKSTLL   17 (166)
T ss_pred             EEEECCCCCChHHHH
Confidence            567899999999977


No 215
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=49.22  E-value=11  Score=32.13  Aligned_cols=28  Identities=29%  Similarity=0.364  Sum_probs=20.6

Q ss_pred             hhHhhhhCC---CceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNG---YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G---~n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|   ....+.-+|..|||||.-+
T Consensus         6 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l~   36 (235)
T cd01123           6 KALDELLGGGIETGSITEIFGEFGSGKTQLC   36 (235)
T ss_pred             hhhHhhccCCCCCCeEEEEECCCCCCHHHHH
Confidence            456677775   2556678899999999754


No 216
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=49.21  E-value=11  Score=33.19  Aligned_cols=29  Identities=21%  Similarity=0.177  Sum_probs=21.2

Q ss_pred             hhhHhhhhC--CCceeEeeeeccCCCCceec
Q psy17370        162 QPLLDAAFN--GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~~l~--G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+.+.+.+  .....|.-+|..|.|||.-.
T Consensus         6 ~~l~~~L~~~~~~~~~v~I~G~~G~GKT~LA   36 (287)
T PF00931_consen    6 EKLKDWLLDNSNEVRVVAIVGMGGIGKTTLA   36 (287)
T ss_dssp             HHHHHHHHTTTTSSEEEEEEESTTSSHHHHH
T ss_pred             HHHHHHhhCCCCCeEEEEEEcCCcCCcceee
Confidence            345555555  56777889999999998744


No 217
>PF10923 DUF2791:  P-loop Domain of unknown function (DUF2791);  InterPro: IPR021228  This is a family of proteins found in archaea and bacteria. Some of the proteins in this family are annotated as being methyl-accepting chemotaxis proteins and ATP/GTP binding proteins. 
Probab=49.19  E-value=8.3  Score=36.85  Aligned_cols=27  Identities=33%  Similarity=0.397  Sum_probs=23.2

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -++.+-+|....-|-.|.-||||||.+
T Consensus        40 ~l~~v~~G~s~~kfi~G~YGsGKTf~l   66 (416)
T PF10923_consen   40 DLDRVADGGSSFKFIRGEYGSGKTFFL   66 (416)
T ss_pred             HHHHHhCCCCeEEEEEeCCCCcHHHHH
Confidence            356677899998999999999999966


No 218
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=48.73  E-value=7.6  Score=36.91  Aligned_cols=17  Identities=29%  Similarity=0.305  Sum_probs=13.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .-|.-.|+||-|||.|+
T Consensus       204 ~vi~LVGPTGVGKTTTl  220 (407)
T COG1419         204 RVIALVGPTGVGKTTTL  220 (407)
T ss_pred             cEEEEECCCCCcHHHHH
Confidence            33444599999999998


No 219
>TIGR00376 DNA helicase, putative. The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Probab=48.69  E-value=8.3  Score=38.87  Aligned_cols=26  Identities=19%  Similarity=0.282  Sum_probs=17.8

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      |..++.... .++-.|+.|+|||||+.
T Consensus       166 v~~~l~~~~-~~lI~GpPGTGKT~t~~  191 (637)
T TIGR00376       166 VSFALSSKD-LFLIHGPPGTGKTRTLV  191 (637)
T ss_pred             HHHHhcCCC-eEEEEcCCCCCHHHHHH
Confidence            344444322 34578999999999984


No 220
>TIGR02902 spore_lonB ATP-dependent protease LonB. Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.
Probab=48.38  E-value=7.9  Score=38.09  Aligned_cols=42  Identities=24%  Similarity=0.360  Sum_probs=25.7

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -+|+.+++.+..        ++.+...++.....-++-||++|+|||+..
T Consensus        62 ~~f~~iiGqs~~--------i~~l~~al~~~~~~~vLi~Ge~GtGKt~lA  103 (531)
T TIGR02902        62 KSFDEIIGQEEG--------IKALKAALCGPNPQHVIIYGPPGVGKTAAA  103 (531)
T ss_pred             CCHHHeeCcHHH--------HHHHHHHHhCCCCceEEEECCCCCCHHHHH
Confidence            346666654422        223333344455566777999999998754


No 221
>KOG0348|consensus
Probab=48.26  E-value=11  Score=37.23  Aligned_cols=23  Identities=35%  Similarity=0.502  Sum_probs=17.8

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCce
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTy  188 (262)
                      .|-.+|+|.++.|-|  |||||||-
T Consensus       167 ~IP~lL~grD~lV~a--QTGSGKTL  189 (708)
T KOG0348|consen  167 AIPVLLEGRDALVRA--QTGSGKTL  189 (708)
T ss_pred             chhhhhcCcceEEEc--CCCCcccH
Confidence            345578899876655  99999985


No 222
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=48.22  E-value=7.6  Score=35.43  Aligned_cols=43  Identities=23%  Similarity=0.228  Sum_probs=23.9

Q ss_pred             eCCCCCcchhhcccchhhHhhhhC--CCceeEeeeeccCCCCceec
Q psy17370        147 LGQDTDQTSVFTIIAQPLLDAAFN--GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       147 f~~~~~q~~vy~~~~~plv~~~l~--G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |+....|+++-+... .++.....  +....++-||+.|+|||+..
T Consensus        24 ~~~~vG~~~~~~~l~-~~l~~~~~~~~~~~~~ll~GppG~GKT~la   68 (328)
T PRK00080         24 LDEFIGQEKVKENLK-IFIEAAKKRGEALDHVLLYGPPGLGKTTLA   68 (328)
T ss_pred             HHHhcCcHHHHHHHH-HHHHHHHhcCCCCCcEEEECCCCccHHHHH
Confidence            344455555444422 23332221  22235677999999999866


No 223
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves.
Probab=47.49  E-value=5.3  Score=41.86  Aligned_cols=19  Identities=42%  Similarity=0.483  Sum_probs=16.5

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.+-.|.||||||++|
T Consensus       474 ~n~n~~I~G~TGSGKS~l~  492 (893)
T TIGR03744       474 KNAHLLILGPTGAGKSATL  492 (893)
T ss_pred             CcccEEEECCCCCCHHHHH
Confidence            3677788899999999988


No 224
>PRK07261 topology modulation protein; Provisional
Probab=47.47  E-value=7.7  Score=31.97  Aligned_cols=15  Identities=40%  Similarity=0.503  Sum_probs=12.1

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|.+|||||.-.
T Consensus         3 i~i~G~~GsGKSTla   17 (171)
T PRK07261          3 IAIIGYSGSGKSTLA   17 (171)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            566799999998744


No 225
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=47.20  E-value=6.6  Score=40.31  Aligned_cols=18  Identities=33%  Similarity=0.475  Sum_probs=15.3

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      |.-++..|.||||||++|
T Consensus       430 n~n~~I~G~tGsGKS~~~  447 (797)
T TIGR02746       430 NYNIAVVGGSGAGKSFFM  447 (797)
T ss_pred             ccceEEEcCCCCCHHHHH
Confidence            445677899999999998


No 226
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=47.07  E-value=8.6  Score=35.31  Aligned_cols=17  Identities=24%  Similarity=0.389  Sum_probs=13.6

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..+.-.|++|+|||.|+
T Consensus       115 ~vi~lvGpnGsGKTTt~  131 (318)
T PRK10416        115 FVILVVGVNGVGKTTTI  131 (318)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            34555699999999887


No 227
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=46.58  E-value=15  Score=32.29  Aligned_cols=25  Identities=28%  Similarity=0.486  Sum_probs=18.1

Q ss_pred             hHhhhhCC---CceeEeeeeccCCCCce
Q psy17370        164 LLDAAFNG---YNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       164 lv~~~l~G---~n~~ifaYG~tgSGKTy  188 (262)
                      -++.+|.|   ....++-||..|||||-
T Consensus        11 glD~~l~GG~p~g~~~lI~G~pGsGKT~   38 (260)
T COG0467          11 GLDEILGGGLPRGSVVLITGPPGTGKTI   38 (260)
T ss_pred             chHHHhcCCCcCCcEEEEEcCCCCcHHH
Confidence            35556654   25667889999999986


No 228
>KOG0651|consensus
Probab=46.54  E-value=11  Score=34.83  Aligned_cols=52  Identities=21%  Similarity=0.367  Sum_probs=38.8

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhC---CCc--eeEeeeeccCCCCce
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFN---GYN--VCLFAYGQTGSGKSY  188 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~---G~n--~~ifaYG~tgSGKTy  188 (262)
                      ....++|+++-+-.-.-.++-+.+..||++..|-   |..  --|.-||..|+|||+
T Consensus       125 ~~~~~s~~~~ggl~~qirelre~ielpl~np~lf~rvgIk~Pkg~ll~GppGtGKTl  181 (388)
T KOG0651|consen  125 DPRNISFENVGGLFYQIRELREVIELPLTNPELFLRVGIKPPKGLLLYGPPGTGKTL  181 (388)
T ss_pred             CccccCHHHhCChHHHHHHHHhheEeeccCchhccccCCCCCceeEEeCCCCCchhH
Confidence            6677888888777666677777788888877542   332  236789999999998


No 229
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional
Probab=46.39  E-value=5.9  Score=41.74  Aligned_cols=13  Identities=38%  Similarity=0.613  Sum_probs=10.9

Q ss_pred             ccCCCCceecCCC
Q psy17370        181 QTGSGKSYRGDST  193 (262)
Q Consensus       181 ~tgSGKTyTm~G~  193 (262)
                      .||+||||||.+.
T Consensus        67 ~TGtGKT~~~~~~   79 (986)
T PRK15483         67 ETGTGKTYVYTRL   79 (986)
T ss_pred             CCCCCHHHHHHHH
Confidence            7999999988654


No 230
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=46.23  E-value=7.4  Score=37.92  Aligned_cols=17  Identities=29%  Similarity=0.347  Sum_probs=13.9

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..+.-.|++|+|||.|+
T Consensus       257 ~Vi~LvGpnGvGKTTTi  273 (484)
T PRK06995        257 GVFALMGPTGVGKTTTT  273 (484)
T ss_pred             cEEEEECCCCccHHHHH
Confidence            34556699999999998


No 231
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=46.13  E-value=8.3  Score=31.52  Aligned_cols=17  Identities=41%  Similarity=0.360  Sum_probs=13.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      +...-||.+|+|||..|
T Consensus        20 g~~vi~G~Ng~GKStil   36 (202)
T PF13476_consen   20 GLNVIYGPNGSGKSTIL   36 (202)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            34456899999999865


No 232
>PRK01172 ski2-like helicase; Provisional
Probab=45.90  E-value=11  Score=38.00  Aligned_cols=24  Identities=25%  Similarity=0.284  Sum_probs=17.3

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .+..+++|.|+  +..++||||||..
T Consensus        30 ai~~l~~~~nv--lv~apTGSGKTl~   53 (674)
T PRK01172         30 AIEQLRKGENV--IVSVPTAAGKTLI   53 (674)
T ss_pred             HHHHHhcCCcE--EEECCCCchHHHH
Confidence            34455778774  5567999999975


No 233
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=45.84  E-value=8.4  Score=31.53  Aligned_cols=14  Identities=43%  Similarity=0.790  Sum_probs=12.2

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-+|..|||||+-
T Consensus         2 i~i~G~pGsGKst~   15 (183)
T TIGR01359         2 VFVLGGPGSGKGTQ   15 (183)
T ss_pred             EEEECCCCCCHHHH
Confidence            67889999999874


No 234
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=45.59  E-value=9.9  Score=39.23  Aligned_cols=21  Identities=19%  Similarity=0.390  Sum_probs=19.4

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|.|.||+.-|.+|+|||.+.
T Consensus        83 ~~~~QsIiiSGESGAGKTe~t  103 (767)
T cd01386          83 TRRDQSIIFLGRSGAGKTTSC  103 (767)
T ss_pred             cCCCceEEEecCCCCCcHHHH
Confidence            589999999999999999876


No 235
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=45.32  E-value=9.6  Score=38.56  Aligned_cols=21  Identities=29%  Similarity=0.591  Sum_probs=19.1

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.|-||.--|.+|||||.|+
T Consensus        83 ~~~~QsIiisGESGsGKTet~  103 (653)
T cd01379          83 YNQDQCIVISGESGSGKTESA  103 (653)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            488999999999999999976


No 236
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=45.29  E-value=8.6  Score=30.30  Aligned_cols=16  Identities=31%  Similarity=0.540  Sum_probs=12.9

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      +|+-+|..|||||+-.
T Consensus         1 ~i~l~G~~GsGKstla   16 (154)
T cd00464           1 NIVLIGMMGAGKTTVG   16 (154)
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            3677899999998744


No 237
>KOG3859|consensus
Probab=45.29  E-value=11  Score=34.34  Aligned_cols=29  Identities=28%  Similarity=0.442  Sum_probs=23.7

Q ss_pred             hhhHhh-hhCCCceeEeeeeccCCCCceec
Q psy17370        162 QPLLDA-AFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~-~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..||.. +-+|+.--|++-|.||-||+.-|
T Consensus        30 dQLV~ksv~~GF~FNilCvGETg~GKsTLm   59 (406)
T KOG3859|consen   30 DQLVNKSVSQGFCFNILCVGETGLGKSTLM   59 (406)
T ss_pred             HHHHHHHHhcCceEEEEEeccCCccHHHHH
Confidence            456655 45799999999999999999855


No 238
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.
Probab=45.04  E-value=8.6  Score=35.66  Aligned_cols=29  Identities=31%  Similarity=0.347  Sum_probs=21.0

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ...++..++.+. +.++--|.||||||..|
T Consensus       167 ~~~~L~~~v~~~-~~ili~G~tGsGKTTll  195 (340)
T TIGR03819       167 VARLLRAIVAAR-LAFLISGGTGSGKTTLL  195 (340)
T ss_pred             HHHHHHHHHhCC-CeEEEECCCCCCHHHHH
Confidence            345666666644 56777899999999866


No 239
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=44.64  E-value=10  Score=26.27  Aligned_cols=14  Identities=43%  Similarity=0.442  Sum_probs=11.1

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      +-.|.+|||||.-|
T Consensus        27 li~G~nGsGKSTll   40 (62)
T PF13555_consen   27 LITGPNGSGKSTLL   40 (62)
T ss_pred             EEECCCCCCHHHHH
Confidence            44699999998644


No 240
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=44.47  E-value=12  Score=40.74  Aligned_cols=23  Identities=30%  Similarity=0.423  Sum_probs=16.1

Q ss_pred             hhhCCCceeEeeeeccCCCCceec
Q psy17370        167 AAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       167 ~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+++.. .++-.|.||||||.-+
T Consensus        84 ~ai~~~~-VviI~GeTGSGKTTql  106 (1294)
T PRK11131         84 EAIRDHQ-VVIVAGETGSGKTTQL  106 (1294)
T ss_pred             HHHHhCC-eEEEECCCCCCHHHHH
Confidence            4455554 4566799999999844


No 241
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=44.42  E-value=7.5  Score=31.29  Aligned_cols=13  Identities=46%  Similarity=0.537  Sum_probs=10.4

Q ss_pred             eeeeccCCCCcee
Q psy17370        177 FAYGQTGSGKSYR  189 (262)
Q Consensus       177 faYG~tgSGKTyT  189 (262)
                      +-.|.+|||||+.
T Consensus         2 ~l~G~~GsGKSTl   14 (163)
T TIGR01313         2 VLMGVAGSGKSTI   14 (163)
T ss_pred             EEECCCCCCHHHH
Confidence            4469999999864


No 242
>PF13173 AAA_14:  AAA domain
Probab=44.38  E-value=8.8  Score=29.76  Aligned_cols=16  Identities=25%  Similarity=0.297  Sum_probs=13.9

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-+|+.|+|||+.|
T Consensus         4 ~~~l~G~R~vGKTtll   19 (128)
T PF13173_consen    4 IIILTGPRGVGKTTLL   19 (128)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4667899999999987


No 243
>PRK08118 topology modulation protein; Reviewed
Probab=44.05  E-value=9.4  Score=31.40  Aligned_cols=13  Identities=46%  Similarity=0.680  Sum_probs=11.4

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      |+-.|..|||||.
T Consensus         4 I~I~G~~GsGKST   16 (167)
T PRK08118          4 IILIGSGGSGKST   16 (167)
T ss_pred             EEEECCCCCCHHH
Confidence            6678999999996


No 244
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=43.98  E-value=11  Score=37.78  Aligned_cols=42  Identities=21%  Similarity=0.383  Sum_probs=26.8

Q ss_pred             eeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        141 FKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       141 f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -+||.+++    |.....    .++..+..++...++-||++|+|||+..
T Consensus       151 ~~~~~iiG----qs~~~~----~l~~~ia~~~~~~vlL~Gp~GtGKTTLA  192 (615)
T TIGR02903       151 RAFSEIVG----QERAIK----ALLAKVASPFPQHIILYGPPGVGKTTAA  192 (615)
T ss_pred             CcHHhcee----CcHHHH----HHHHHHhcCCCCeEEEECCCCCCHHHHH
Confidence            35565553    333333    2344455566667888999999999854


No 245
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=43.70  E-value=15  Score=30.44  Aligned_cols=26  Identities=31%  Similarity=0.345  Sum_probs=18.1

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .-+...+.| .. ++-.|++|.||+..+
T Consensus        27 ~~l~~~l~~-k~-~vl~G~SGvGKSSLi   52 (161)
T PF03193_consen   27 EELKELLKG-KT-SVLLGQSGVGKSSLI   52 (161)
T ss_dssp             HHHHHHHTT-SE-EEEECSTTSSHHHHH
T ss_pred             HHHHHHhcC-CE-EEEECCCCCCHHHHH
Confidence            344566777 44 444599999999865


No 246
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=43.69  E-value=20  Score=37.65  Aligned_cols=32  Identities=19%  Similarity=0.009  Sum_probs=20.4

Q ss_pred             eeeeccCCCCc-------eecCCCCCCCchHhhhhhccccc
Q psy17370        177 FAYGQTGSGKS-------YRGDSTLNSSVLRPRVLFYPGFS  210 (262)
Q Consensus       177 faYG~tgSGKT-------yTm~G~~~~~Giipr~~~~lf~~  210 (262)
                      +=.|+||||||       |.+||.....|  ....++++..
T Consensus        29 lI~G~nGsGKSSIldAI~~ALyG~~~~~~--~~~~~~~i~~   67 (908)
T COG0419          29 LIVGPNGAGKSSILDAITFALYGKTPRLG--AFSLDDLIRA   67 (908)
T ss_pred             EEECCCCCcHHHHHHHHHHHHcCCCCCcc--chhhhHHHhc
Confidence            34699999995       57788865444  3444444333


No 247
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=43.44  E-value=9.7  Score=31.34  Aligned_cols=15  Identities=33%  Similarity=0.649  Sum_probs=12.3

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-+|..|||||+-.
T Consensus         2 I~i~G~pGsGKst~a   16 (194)
T cd01428           2 ILLLGPPGSGKGTQA   16 (194)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678899999998643


No 248
>KOG0780|consensus
Probab=43.10  E-value=13  Score=35.28  Aligned_cols=73  Identities=21%  Similarity=0.173  Sum_probs=43.4

Q ss_pred             cchhhcccchhhHhh---hh---CCCceeEeeeeccCCCCceecC---------CCC----CCCchHhhhhhccccccCc
Q psy17370        153 QTSVFTIIAQPLLDA---AF---NGYNVCLFAYGQTGSGKSYRGD---------STL----NSSVLRPRVLFYPGFSWSH  213 (262)
Q Consensus       153 q~~vy~~~~~plv~~---~l---~G~n~~ifaYG~tgSGKTyTm~---------G~~----~~~Giipr~~~~lf~~~~~  213 (262)
                      |.-||++.+ .|++.   .|   .|.-..|+--|.-|+|||.|+.         |..    +..-.-+-++++|-+...+
T Consensus        76 ~~~vf~eL~-kl~dp~~~~~~~~K~kpsVimfVGLqG~GKTTtc~KlA~y~kkkG~K~~LvcaDTFRagAfDQLkqnA~k  154 (483)
T KOG0780|consen   76 QKAVFDELV-KLLDPGKSALQPKKGKPSVIMFVGLQGSGKTTTCTKLAYYYKKKGYKVALVCADTFRAGAFDQLKQNATK  154 (483)
T ss_pred             HHHHHHHHH-HHhCCCCcccccccCCCcEEEEEeccCCCcceeHHHHHHHHHhcCCceeEEeecccccchHHHHHHHhHh
Confidence            455666655 33322   11   3555566667999999999983         222    1222334455555555556


Q ss_pred             cceEEEEEEEEEE
Q psy17370        214 SGWTGWVSCVVVI  226 (262)
Q Consensus       214 ~~~~~~vS~~EIy  226 (262)
                      ....++.||-|+-
T Consensus       155 ~~iP~ygsyte~d  167 (483)
T KOG0780|consen  155 ARVPFYGSYTEAD  167 (483)
T ss_pred             hCCeeEecccccc
Confidence            6788888888875


No 249
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=43.06  E-value=15  Score=31.38  Aligned_cols=28  Identities=25%  Similarity=0.362  Sum_probs=19.3

Q ss_pred             hhHhhhhC-CC--ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFN-GY--NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~-G~--n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.++. |.  ..++.-+|.+|+|||...
T Consensus         7 ~~LD~~l~GGi~~G~~~~i~G~~G~GKT~l~   37 (229)
T TIGR03881         7 EGLDKLLEGGIPRGFFVAVTGEPGTGKTIFC   37 (229)
T ss_pred             hhHHHhhcCCCcCCeEEEEECCCCCChHHHH
Confidence            34556664 33  456777899999998754


No 250
>PRK06696 uridine kinase; Validated
Probab=43.06  E-value=14  Score=31.74  Aligned_cols=28  Identities=21%  Similarity=0.141  Sum_probs=18.5

Q ss_pred             hhhHhhhh---CCCceeEeeeeccCCCCcee
Q psy17370        162 QPLLDAAF---NGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       162 ~plv~~~l---~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..|.+.++   .+....|.--|.+|||||+.
T Consensus         8 ~~la~~~~~~~~~~~~iI~I~G~sgsGKSTl   38 (223)
T PRK06696          8 KELAEHILTLNLTRPLRVAIDGITASGKTTF   38 (223)
T ss_pred             HHHHHHHHHhCCCCceEEEEECCCCCCHHHH
Confidence            34444444   34455566779999999983


No 251
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=42.98  E-value=11  Score=33.81  Aligned_cols=21  Identities=29%  Similarity=0.502  Sum_probs=18.3

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|+...|+..|.+|+|||..+
T Consensus         1 ~g~~f~I~vvG~sg~GKSTli   21 (276)
T cd01850           1 KGFQFNIMVVGESGLGKSTFI   21 (276)
T ss_pred             CCcEEEEEEEcCCCCCHHHHH
Confidence            478889999999999998754


No 252
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=42.79  E-value=11  Score=38.32  Aligned_cols=39  Identities=21%  Similarity=0.147  Sum_probs=22.7

Q ss_pred             CCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        148 GQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       148 ~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .....|+.+...+.    ...-.+...-++..|+||||||...
T Consensus       261 ~lt~~Q~~ai~~I~----~d~~~~~~~~~Ll~~~TGSGKT~va  299 (681)
T PRK10917        261 ELTGAQKRVVAEIL----ADLASPKPMNRLLQGDVGSGKTVVA  299 (681)
T ss_pred             CCCHHHHHHHHHHH----HhhhccCCceEEEECCCCCcHHHHH
Confidence            34445555444333    2222334445778899999999754


No 253
>PRK06217 hypothetical protein; Validated
Probab=42.60  E-value=9.8  Score=31.50  Aligned_cols=14  Identities=29%  Similarity=0.496  Sum_probs=11.6

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-.|.+|||||.-
T Consensus         4 I~i~G~~GsGKSTl   17 (183)
T PRK06217          4 IHITGASGSGTTTL   17 (183)
T ss_pred             EEEECCCCCCHHHH
Confidence            66789999999863


No 254
>PF02534 T4SS-DNA_transf:  Type IV secretory system Conjugative DNA transfer;  InterPro: IPR003688 This entry represents TraG proteins and their homologues. These proteins contain a P-loop and walker-B site for nucleotide binding. TraG is essential for DNA transfer in bacterial conjugation. These proteins are thought to mediate interactions between the DNA-processing (Dtr) and the mating pair formation (Mpf) systems [, ].; GO: 0009291 unidirectional conjugation, 0016020 membrane
Probab=42.43  E-value=17  Score=34.80  Aligned_cols=17  Identities=35%  Similarity=0.464  Sum_probs=14.9

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .-++..|.||||||.++
T Consensus        45 ~h~lvig~tgSGKt~~~   61 (469)
T PF02534_consen   45 THVLVIGPTGSGKTTSF   61 (469)
T ss_pred             eEEEEEeCCCCCcccee
Confidence            55788999999999987


No 255
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=42.38  E-value=8.4  Score=35.26  Aligned_cols=17  Identities=29%  Similarity=0.362  Sum_probs=14.5

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      +|+-.|.||||||..|.
T Consensus       145 siii~G~t~sGKTt~ln  161 (312)
T COG0630         145 SIIICGGTASGKTTLLN  161 (312)
T ss_pred             cEEEECCCCCCHHHHHH
Confidence            46778999999999883


No 256
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=42.15  E-value=11  Score=28.10  Aligned_cols=15  Identities=27%  Similarity=0.452  Sum_probs=12.5

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|..|+|||.-+
T Consensus         2 I~V~G~~g~GKTsLi   16 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLI   16 (119)
T ss_dssp             EEEECSTTSSHHHHH
T ss_pred             EEEECcCCCCHHHHH
Confidence            567899999999854


No 257
>CHL00181 cbbX CbbX; Provisional
Probab=42.15  E-value=9.9  Score=34.29  Aligned_cols=15  Identities=27%  Similarity=0.417  Sum_probs=12.7

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ++-||.+|+|||+..
T Consensus        62 ill~G~pGtGKT~lA   76 (287)
T CHL00181         62 MSFTGSPGTGKTTVA   76 (287)
T ss_pred             EEEECCCCCCHHHHH
Confidence            566999999999854


No 258
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional
Probab=42.15  E-value=15  Score=39.63  Aligned_cols=25  Identities=36%  Similarity=0.749  Sum_probs=20.2

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..|..+++|.++.+.+  +||+|||.+
T Consensus       467 eaI~aiL~GrDVLVim--PTGSGKSLc  491 (1195)
T PLN03137        467 EIINATMSGYDVFVLM--PTGGGKSLT  491 (1195)
T ss_pred             HHHHHHHcCCCEEEEc--CCCccHHHH
Confidence            5677889999966555  999999986


No 259
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=42.04  E-value=19  Score=30.50  Aligned_cols=28  Identities=29%  Similarity=0.328  Sum_probs=20.0

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...+.-+|..|+|||..+
T Consensus         6 ~~lD~~l~GG~~~g~v~~I~G~~GsGKT~l~   36 (226)
T cd01393           6 KALDELLGGGIPTGRITEIFGEFGSGKTQLC   36 (226)
T ss_pred             HHHHHHhCCCCcCCcEEEEeCCCCCChhHHH
Confidence            5567777643   445667899999999854


No 260
>PRK08233 hypothetical protein; Provisional
Probab=41.71  E-value=10  Score=30.75  Aligned_cols=15  Identities=20%  Similarity=0.251  Sum_probs=11.4

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+--|.+|||||+..
T Consensus         6 I~I~G~~GsGKtTla   20 (182)
T PRK08233          6 ITIAAVSGGGKTTLT   20 (182)
T ss_pred             EEEECCCCCCHHHHH
Confidence            445699999999743


No 261
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=41.67  E-value=9  Score=37.20  Aligned_cols=16  Identities=25%  Similarity=0.495  Sum_probs=13.9

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-||+.|+|||+.+
T Consensus        90 giLL~GppGtGKT~la  105 (495)
T TIGR01241        90 GVLLVGPPGTGKTLLA  105 (495)
T ss_pred             cEEEECCCCCCHHHHH
Confidence            4778999999999875


No 262
>PF10412 TrwB_AAD_bind:  Type IV secretion-system coupling protein DNA-binding domain;  InterPro: IPR019476  The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein. It is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells []. This protein forms hexamers from six structurally very similar protomers []. This hexamer contains a central channel running from the cytosolic pole (formed by the all-alpha domains) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB all-alpha domain appears to be the DNA-binding domain of the structure. ; PDB: 1E9S_D 1E9R_F 1GKI_B 1GL7_G 1GL6_A.
Probab=41.60  E-value=8.9  Score=36.08  Aligned_cols=15  Identities=40%  Similarity=0.567  Sum_probs=11.9

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ++..|.+|||||..|
T Consensus        18 ~li~G~~GsGKT~~i   32 (386)
T PF10412_consen   18 ILIIGATGSGKTQAI   32 (386)
T ss_dssp             EEEEE-TTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999866


No 263
>KOG0340|consensus
Probab=41.54  E-value=14  Score=34.71  Aligned_cols=41  Identities=20%  Similarity=0.229  Sum_probs=28.6

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceecCCCC------CCCchHhhhhh
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTL------NSSVLRPRVLF  205 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm~G~~------~~~Giipr~~~  205 (262)
                      .+|..+|+|.+|  +....||||||...-+.-      +-.|+.-..+.
T Consensus        36 ~cIpkILeGrdc--ig~AkTGsGKT~AFaLPil~rLsedP~giFalvlT   82 (442)
T KOG0340|consen   36 ACIPKILEGRDC--IGCAKTGSGKTAAFALPILNRLSEDPYGIFALVLT   82 (442)
T ss_pred             hhhHHHhccccc--ccccccCCCcchhhhHHHHHhhccCCCcceEEEec
Confidence            457788999996  456799999999875543      33455555444


No 264
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model.
Probab=41.48  E-value=15  Score=34.04  Aligned_cols=43  Identities=19%  Similarity=0.153  Sum_probs=24.4

Q ss_pred             eeCCCCCcchhhccc-chhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        146 CLGQDTDQTSVFTII-AQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       146 vf~~~~~q~~vy~~~-~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+-+..+...+|+.- .+.++..+..+.  -|+-.|.+|+|||...
T Consensus        38 ~~~p~~d~~y~f~~~~~~~vl~~l~~~~--~ilL~G~pGtGKTtla   81 (327)
T TIGR01650        38 EHVPDIDPAYLFDKATTKAICAGFAYDR--RVMVQGYHGTGKSTHI   81 (327)
T ss_pred             CCCCCCCCCccCCHHHHHHHHHHHhcCC--cEEEEeCCCChHHHHH
Confidence            334444444555532 233333343333  4777999999999755


No 265
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]
Probab=41.26  E-value=11  Score=37.16  Aligned_cols=44  Identities=18%  Similarity=0.394  Sum_probs=29.6

Q ss_pred             CceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCC
Q psy17370        137 KSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGK  186 (262)
Q Consensus       137 ~~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGK  186 (262)
                      ....|+||.+-+....-.++-     .++ .-..+.+++|+-+|.||+||
T Consensus       238 ~~a~y~f~~Iig~S~~m~~~~-----~~a-kr~A~tdstVLi~GESGTGK  281 (560)
T COG3829         238 LKAKYTFDDIIGESPAMLRVL-----ELA-KRIAKTDSTVLILGESGTGK  281 (560)
T ss_pred             cccccchhhhccCCHHHHHHH-----HHH-HhhcCCCCcEEEecCCCccH
Confidence            345688888886653322211     111 23578999999999999999


No 266
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=41.18  E-value=7  Score=33.75  Aligned_cols=11  Identities=36%  Similarity=0.507  Sum_probs=10.2

Q ss_pred             eccCCCCceec
Q psy17370        180 GQTGSGKSYRG  190 (262)
Q Consensus       180 G~tgSGKTyTm  190 (262)
                      |.+|||||.++
T Consensus         6 G~sGSGKTTla   16 (220)
T cd02025           6 GSVAVGKSTTA   16 (220)
T ss_pred             CCCCCCHHHHH
Confidence            99999999977


No 267
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=41.11  E-value=12  Score=30.54  Aligned_cols=15  Identities=27%  Similarity=0.403  Sum_probs=12.3

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ++-+|.+|+|||.-.
T Consensus         2 ~li~G~~G~GKT~l~   16 (187)
T cd01124           2 TLLSGGPGTGKTTFA   16 (187)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            567899999999844


No 268
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=40.94  E-value=12  Score=29.01  Aligned_cols=14  Identities=43%  Similarity=0.496  Sum_probs=11.5

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-.|++|||||..
T Consensus         2 I~i~G~~GsGKst~   15 (147)
T cd02020           2 IAIDGPAGSGKSTV   15 (147)
T ss_pred             EEEECCCCCCHHHH
Confidence            45679999999873


No 269
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=40.90  E-value=19  Score=29.48  Aligned_cols=28  Identities=21%  Similarity=0.255  Sum_probs=21.1

Q ss_pred             hhHhhhhC-CCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFN-GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~-G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..++. .....|+-.|..|||||.-+
T Consensus         3 ~~~~~~~~~~~~~~ililGl~~sGKTtll   31 (175)
T PF00025_consen    3 SVLSKLKSKKKEIKILILGLDGSGKTTLL   31 (175)
T ss_dssp             HHHHHCTTTTSEEEEEEEESTTSSHHHHH
T ss_pred             HHHHHhcccCcEEEEEEECCCccchHHHH
Confidence            34555554 67788999999999999743


No 270
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=40.88  E-value=9.4  Score=34.51  Aligned_cols=12  Identities=33%  Similarity=0.484  Sum_probs=10.9

Q ss_pred             eeccCCCCceec
Q psy17370        179 YGQTGSGKSYRG  190 (262)
Q Consensus       179 YG~tgSGKTyTm  190 (262)
                      .|++|+|||.+|
T Consensus        37 lG~NGAGKTTll   48 (293)
T COG1131          37 LGPNGAGKTTLL   48 (293)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999987


No 271
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=40.87  E-value=11  Score=33.93  Aligned_cols=16  Identities=25%  Similarity=0.374  Sum_probs=13.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      -++-+|.+|+|||+..
T Consensus        60 ~vll~G~pGTGKT~lA   75 (284)
T TIGR02880        60 HMSFTGNPGTGKTTVA   75 (284)
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            4677899999999864


No 272
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype. This model describes a CRISPR-associated putative DEAH-box helicase, or Cas3, of a subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila. This protein includes both DEAH and HD motifs.
Probab=40.80  E-value=15  Score=38.36  Aligned_cols=27  Identities=22%  Similarity=0.079  Sum_probs=18.5

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .++..+++|.+- ++.--+||||||..|
T Consensus        22 ~~i~~il~G~~~-v~~~apTGSGKTaa~   48 (844)
T TIGR02621        22 SLAERFVAGQPP-ESCSTPTGLGKTSII   48 (844)
T ss_pred             HHHHHHHcCCCc-ceEecCCCCcccHHH
Confidence            455667899853 333359999999843


No 273
>KOG1803|consensus
Probab=40.58  E-value=11  Score=37.52  Aligned_cols=17  Identities=29%  Similarity=0.337  Sum_probs=13.8

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      ...--|+.|+|||||+.
T Consensus       203 l~~I~GPPGTGKT~Tlv  219 (649)
T KOG1803|consen  203 LLIIHGPPGTGKTRTLV  219 (649)
T ss_pred             ceEeeCCCCCCceeeHH
Confidence            34557999999999983


No 274
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=40.46  E-value=8.6  Score=39.31  Aligned_cols=18  Identities=33%  Similarity=0.333  Sum_probs=16.1

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      |.-.+-.|.||||||++|
T Consensus       434 ~~n~~I~G~tGsGKS~~~  451 (785)
T TIGR00929       434 LGHTLIFGPTGSGKTTLL  451 (785)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            667788999999999988


No 275
>PHA01747 putative ATP-dependent protease
Probab=40.19  E-value=14  Score=34.93  Aligned_cols=30  Identities=20%  Similarity=0.316  Sum_probs=24.3

Q ss_pred             chhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.|+++.-..+.|.-++=.|+-|+||||+-
T Consensus       178 LiPlVE~~~~~~NyNliELgPRGTGKS~~f  207 (425)
T PHA01747        178 LLPLFTSPVSKRPVHIIELSNRGTGKTTTF  207 (425)
T ss_pred             hhhheeccCCCCCeeEEEecCCCCChhhHH
Confidence            457777556678888899999999999964


No 276
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=39.94  E-value=5.8  Score=37.03  Aligned_cols=44  Identities=20%  Similarity=0.274  Sum_probs=26.3

Q ss_pred             eeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        139 YTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       139 ~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..|.|+.|-+    |+++=......+++.   +. +-|+-+|.+|+|||+.+
T Consensus        12 ~~~pf~~ivG----q~~~k~al~~~~~~p---~~-~~vli~G~~GtGKs~~a   55 (350)
T CHL00081         12 PVFPFTAIVG----QEEMKLALILNVIDP---KI-GGVMIMGDRGTGKSTTI   55 (350)
T ss_pred             CCCCHHHHhC----hHHHHHHHHHhccCC---CC-CeEEEEcCCCCCHHHHH
Confidence            3567776654    444333333333322   22 34778999999999987


No 277
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=39.94  E-value=13  Score=35.86  Aligned_cols=18  Identities=28%  Similarity=0.422  Sum_probs=15.3

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      -..|+-+|.+|+|||.|.
T Consensus        95 p~vI~lvG~~GsGKTTta  112 (437)
T PRK00771         95 PQTIMLVGLQGSGKTTTA  112 (437)
T ss_pred             CeEEEEECCCCCcHHHHH
Confidence            456777899999999987


No 278
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=39.90  E-value=11  Score=26.50  Aligned_cols=15  Identities=27%  Similarity=0.477  Sum_probs=11.7

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ++-+|..|+|||.+.
T Consensus         2 ~~~~g~~G~Gktt~~   16 (99)
T cd01983           2 IVVTGKGGVGKTTLA   16 (99)
T ss_pred             EEEECCCCCCHHHHH
Confidence            445677899999976


No 279
>PRK04040 adenylate kinase; Provisional
Probab=39.80  E-value=12  Score=31.39  Aligned_cols=16  Identities=25%  Similarity=0.291  Sum_probs=13.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-+|..|||||+-.
T Consensus         4 ~i~v~G~pG~GKtt~~   19 (188)
T PRK04040          4 VVVVTGVPGVGKTTVL   19 (188)
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            4678999999999855


No 280
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=39.71  E-value=20  Score=32.38  Aligned_cols=27  Identities=30%  Similarity=0.383  Sum_probs=19.6

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyT  189 (262)
                      +-++.+|.|.   ...+.-||..|+|||.-
T Consensus        82 ~~lD~~l~GGi~~g~i~ei~G~~g~GKT~l  111 (310)
T TIGR02236        82 KELDELLGGGIETQAITEVFGEFGSGKTQI  111 (310)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHH
Confidence            4456677654   45567899999999874


No 281
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=39.68  E-value=10  Score=35.98  Aligned_cols=17  Identities=35%  Similarity=0.321  Sum_probs=13.9

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      .+.-.|++|+|||+|+.
T Consensus       208 ii~lvGptGvGKTTt~a  224 (407)
T PRK12726        208 IISLIGQTGVGKTTTLV  224 (407)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45667999999999883


No 282
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=39.65  E-value=13  Score=33.34  Aligned_cols=17  Identities=24%  Similarity=0.298  Sum_probs=13.2

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .+|.-.|.+|+|||.|.
T Consensus        73 ~vi~l~G~~G~GKTTt~   89 (272)
T TIGR00064        73 NVILFVGVNGVGKTTTI   89 (272)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            34444599999999987


No 283
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=39.34  E-value=11  Score=29.61  Aligned_cols=20  Identities=25%  Similarity=0.363  Sum_probs=15.5

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+.-|+-+|..||||++..
T Consensus        19 ~~~~pvli~GE~GtGK~~~A   38 (138)
T PF14532_consen   19 KSSSPVLITGEPGTGKSLLA   38 (138)
T ss_dssp             CSSS-EEEECCTTSSHHHHH
T ss_pred             CCCCcEEEEcCCCCCHHHHH
Confidence            55666788999999999854


No 284
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=39.30  E-value=12  Score=30.04  Aligned_cols=15  Identities=33%  Similarity=0.470  Sum_probs=12.5

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.-+|+.|||||+..
T Consensus         3 I~i~G~~GSGKstia   17 (171)
T TIGR02173         3 ITISGPPGSGKTTVA   17 (171)
T ss_pred             EEEECCCCCCHHHHH
Confidence            667899999998754


No 285
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=39.17  E-value=11  Score=36.16  Aligned_cols=17  Identities=29%  Similarity=0.313  Sum_probs=14.6

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..|.-.|++|+|||.|+
T Consensus       242 ~vI~LVGptGvGKTTTi  258 (436)
T PRK11889        242 QTIALIGPTGVGKTTTL  258 (436)
T ss_pred             cEEEEECCCCCcHHHHH
Confidence            45677899999999988


No 286
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=38.74  E-value=11  Score=30.76  Aligned_cols=16  Identities=25%  Similarity=0.476  Sum_probs=13.3

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-.|.+|||||..+
T Consensus         3 ~~~i~G~sGsGKttl~   18 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLL   18 (179)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3566799999999977


No 287
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=38.72  E-value=12  Score=38.45  Aligned_cols=17  Identities=35%  Similarity=0.368  Sum_probs=14.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..|.-.|++|+|||.|+
T Consensus       186 ~Vi~lVGpnGvGKTTTi  202 (767)
T PRK14723        186 GVLALVGPTGVGKTTTT  202 (767)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            35666799999999988


No 288
>PRK14974 cell division protein FtsY; Provisional
Probab=38.60  E-value=14  Score=34.23  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=15.1

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      ...|.-.|.+|+|||.|+
T Consensus       140 ~~vi~~~G~~GvGKTTti  157 (336)
T PRK14974        140 PVVIVFVGVNGTGKTTTI  157 (336)
T ss_pred             CeEEEEEcCCCCCHHHHH
Confidence            456777899999999976


No 289
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=38.41  E-value=18  Score=39.02  Aligned_cols=53  Identities=25%  Similarity=0.169  Sum_probs=33.1

Q ss_pred             cccchhhHhhhhCCCceeEeeeeccCCCCceec------CCCCCCCchHhhhhhccccccCc
Q psy17370        158 TIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG------DSTLNSSVLRPRVLFYPGFSWSH  213 (262)
Q Consensus       158 ~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm------~G~~~~~Giipr~~~~lf~~~~~  213 (262)
                      ++.+.+++-.+-.|+++-|   |+.||||+=-+      +|.....++=---+.||++.-..
T Consensus        12 KSF~~~~~i~f~~~~t~Iv---GPNGSGKSNI~DAi~fVLG~~s~k~lRa~~~~DlIf~g~~   70 (1163)
T COG1196          12 KSFADPTEINFSPGFTAIV---GPNGSGKSNIVDAIRFVLGEQSAKNLRASKMSDLIFAGSG   70 (1163)
T ss_pred             ccCCCCeeeecCCCCeEEE---CCCCCchHHHHHHHHHHhCcchhhhhhccCCcceeeCCCC
Confidence            3334455556667888765   99999997533      66655555555556666554443


No 290
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=38.11  E-value=13  Score=35.58  Aligned_cols=17  Identities=29%  Similarity=0.298  Sum_probs=14.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..+.-.|.+|+|||.|+
T Consensus       192 ~vi~lvGpnG~GKTTtl  208 (420)
T PRK14721        192 GVYALIGPTGVGKTTTT  208 (420)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            35666799999999998


No 291
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=38.10  E-value=19  Score=33.74  Aligned_cols=24  Identities=25%  Similarity=0.410  Sum_probs=21.3

Q ss_pred             CCCceeEeeeeccCCCCce---ecCCC
Q psy17370        170 NGYNVCLFAYGQTGSGKSY---RGDST  193 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTy---Tm~G~  193 (262)
                      .|..-+|+..|+.|+|||.   ||+|.
T Consensus        20 ~Gi~f~im~~G~sG~GKttfiNtL~~~   46 (373)
T COG5019          20 KGIDFTIMVVGESGLGKTTFINTLFGT   46 (373)
T ss_pred             cCCceEEEEecCCCCchhHHHHhhhHh
Confidence            5999999999999999997   66776


No 292
>PHA02624 large T antigen; Provisional
Probab=37.97  E-value=16  Score=36.79  Aligned_cols=26  Identities=19%  Similarity=0.172  Sum_probs=20.0

Q ss_pred             HhhhhCCCce--eEeeeeccCCCCceec
Q psy17370        165 LDAAFNGYNV--CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       165 v~~~l~G~n~--~ifaYG~tgSGKTyTm  190 (262)
                      ++.++.|.-.  |++-||+-|||||+-.
T Consensus       421 lk~~l~giPKk~~il~~GPpnTGKTtf~  448 (647)
T PHA02624        421 LKLIVENVPKRRYWLFKGPVNSGKTTLA  448 (647)
T ss_pred             HHHHHhcCCCCeEEEEECCCCCCHHHHH
Confidence            5566776544  8899999999998743


No 293
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG. This protein is found in the Agrobacterium tumefaciens Ti plasmid tra region responsible for conjugative transfer of the entire plasmid among Agrobacterium strains. The protein is distantly related to the F-type conjugation system TraG protein. Both of these systems are examples of type IV secretion systems.
Probab=37.96  E-value=19  Score=36.28  Aligned_cols=25  Identities=20%  Similarity=0.311  Sum_probs=18.9

Q ss_pred             eeEeeeeccCCCCceecCCCCCCCchHhhhhhc
Q psy17370        174 VCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFY  206 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~  206 (262)
                      .=++.+|.||||||.++        +||..+.+
T Consensus       212 ~H~lv~ApTgsGKgvg~--------VIPnLL~~  236 (623)
T TIGR02767       212 THMIFFAGSGGFKTTSV--------VVPTALKY  236 (623)
T ss_pred             ceEEEEeCCCCCcccee--------ehhhhhcC
Confidence            34678899999999965        56666654


No 294
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=37.92  E-value=21  Score=32.39  Aligned_cols=28  Identities=32%  Similarity=0.336  Sum_probs=19.5

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...+.-||..|+|||...
T Consensus        89 ~~lD~~l~GGi~~g~vtei~G~~GsGKT~l~  119 (317)
T PRK04301         89 KELDELLGGGIETQSITEFYGEFGSGKTQIC  119 (317)
T ss_pred             HHHHHHhcCCccCCcEEEEECCCCCCHhHHH
Confidence            4455666643   455678899999999743


No 295
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=37.87  E-value=14  Score=30.21  Aligned_cols=16  Identities=38%  Similarity=0.607  Sum_probs=12.8

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+..|..|||||...
T Consensus         5 ii~i~G~~GsGKsTl~   20 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQC   20 (188)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3566899999999854


No 296
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=37.81  E-value=16  Score=32.10  Aligned_cols=13  Identities=46%  Similarity=0.480  Sum_probs=10.7

Q ss_pred             eeeccCCCCceec
Q psy17370        178 AYGQTGSGKSYRG  190 (262)
Q Consensus       178 aYG~tgSGKTyTm  190 (262)
                      -.|++|||||.-+
T Consensus        33 iiGpSGSGKSTlL   45 (240)
T COG1126          33 IIGPSGSGKSTLL   45 (240)
T ss_pred             EECCCCCCHHHHH
Confidence            3699999999855


No 297
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=37.79  E-value=17  Score=32.09  Aligned_cols=28  Identities=32%  Similarity=0.438  Sum_probs=20.9

Q ss_pred             hhhCCCceeE------eeeeccCCCCc---eecCCCC
Q psy17370        167 AAFNGYNVCL------FAYGQTGSGKS---YRGDSTL  194 (262)
Q Consensus       167 ~~l~G~n~~i------faYG~tgSGKT---yTm~G~~  194 (262)
                      .+|.|.|-+|      --.|++||||+   |+++|.+
T Consensus        18 eILkgvnL~v~~GEvhaiMGPNGsGKSTLa~~i~G~p   54 (251)
T COG0396          18 EILKGVNLTVKEGEVHAIMGPNGSGKSTLAYTIMGHP   54 (251)
T ss_pred             hhhcCcceeEcCCcEEEEECCCCCCHHHHHHHHhCCC
Confidence            5677777765      34699999996   5778875


No 298
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=37.78  E-value=13  Score=31.78  Aligned_cols=16  Identities=50%  Similarity=0.735  Sum_probs=13.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|.|||||+.+.
T Consensus         2 ~IlllG~tGsGKSs~~   17 (212)
T PF04548_consen    2 RILLLGKTGSGKSSLG   17 (212)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            5778899999999754


No 299
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=37.72  E-value=15  Score=30.34  Aligned_cols=20  Identities=25%  Similarity=0.449  Sum_probs=16.2

Q ss_pred             CCCceeEeeeeccCCCCcee
Q psy17370        170 NGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..++..|+-+|.+|+||+..
T Consensus        19 a~~~~pVlI~GE~GtGK~~l   38 (168)
T PF00158_consen   19 ASSDLPVLITGETGTGKELL   38 (168)
T ss_dssp             TTSTS-EEEECSTTSSHHHH
T ss_pred             hCCCCCEEEEcCCCCcHHHH
Confidence            46778999999999999863


No 300
>PF02367 UPF0079:  Uncharacterised P-loop hydrolase UPF0079;  InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements [].; PDB: 1HTW_A 1FL9_A.
Probab=37.54  E-value=16  Score=28.79  Aligned_cols=24  Identities=17%  Similarity=0.162  Sum_probs=16.9

Q ss_pred             hhhCCCceeEeeeeccCCCCceecC
Q psy17370        167 AAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       167 ~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ..+.+. ..|+-+|.-|+|||+-+.
T Consensus        10 ~~l~~g-~vi~L~GdLGaGKTtf~r   33 (123)
T PF02367_consen   10 QILKPG-DVILLSGDLGAGKTTFVR   33 (123)
T ss_dssp             HHHSS--EEEEEEESTTSSHHHHHH
T ss_pred             HhCCCC-CEEEEECCCCCCHHHHHH
Confidence            334433 457889999999999763


No 301
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional
Probab=37.24  E-value=16  Score=33.42  Aligned_cols=14  Identities=43%  Similarity=0.738  Sum_probs=12.2

Q ss_pred             eEeeeeccCCCCce
Q psy17370        175 CLFAYGQTGSGKSY  188 (262)
Q Consensus       175 ~ifaYG~tgSGKTy  188 (262)
                      .|+-.|+||||||-
T Consensus         6 ii~I~GpTasGKS~   19 (300)
T PRK14729          6 IVFIFGPTAVGKSN   19 (300)
T ss_pred             EEEEECCCccCHHH
Confidence            56778999999997


No 302
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=37.10  E-value=16  Score=31.42  Aligned_cols=20  Identities=25%  Similarity=0.212  Sum_probs=13.8

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +..-.|.--|.+|||||..+
T Consensus        31 ~~~~iigi~G~~GsGKTTl~   50 (229)
T PRK09270         31 QRRTIVGIAGPPGAGKSTLA   50 (229)
T ss_pred             CCCEEEEEECCCCCCHHHHH
Confidence            33334455599999999854


No 303
>PTZ00014 myosin-A; Provisional
Probab=36.88  E-value=17  Score=37.85  Aligned_cols=21  Identities=19%  Similarity=0.317  Sum_probs=18.8

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.|.||+.-|.+|+|||.+.
T Consensus       180 ~~~~QsIiiSGESGAGKTe~t  200 (821)
T PTZ00014        180 VKKSQTIIVSGESGAGKTEAT  200 (821)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            588999999999999999654


No 304
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=36.87  E-value=12  Score=31.30  Aligned_cols=14  Identities=36%  Similarity=0.373  Sum_probs=11.3

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      .--|.+|||||+.+
T Consensus         3 gi~G~~GsGKSTl~   16 (198)
T cd02023           3 GIAGGSGSGKTTVA   16 (198)
T ss_pred             EEECCCCCCHHHHH
Confidence            34599999999876


No 305
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=36.69  E-value=14  Score=30.79  Aligned_cols=15  Identities=33%  Similarity=0.423  Sum_probs=11.7

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.-.|.+|||||+.-
T Consensus         2 IgI~G~sgSGKTTla   16 (194)
T PF00485_consen    2 IGIAGPSGSGKTTLA   16 (194)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            445699999999854


No 306
>PRK14531 adenylate kinase; Provisional
Probab=36.63  E-value=14  Score=30.52  Aligned_cols=15  Identities=33%  Similarity=0.567  Sum_probs=12.5

Q ss_pred             eEeeeeccCCCCcee
Q psy17370        175 CLFAYGQTGSGKSYR  189 (262)
Q Consensus       175 ~ifaYG~tgSGKTyT  189 (262)
                      -|+-.|..|||||.-
T Consensus         4 ~i~i~G~pGsGKsT~   18 (183)
T PRK14531          4 RLLFLGPPGAGKGTQ   18 (183)
T ss_pred             EEEEECCCCCCHHHH
Confidence            367799999999874


No 307
>PRK13873 conjugal transfer ATPase TrbE; Provisional
Probab=36.63  E-value=12  Score=38.76  Aligned_cols=16  Identities=38%  Similarity=0.403  Sum_probs=13.6

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      -.+..|+||||||+.|
T Consensus       443 n~~I~G~tGsGKS~l~  458 (811)
T PRK13873        443 HTLVVGPTGAGKSVLL  458 (811)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4556899999999988


No 308
>PRK13531 regulatory ATPase RavA; Provisional
Probab=36.34  E-value=15  Score=35.84  Aligned_cols=26  Identities=35%  Similarity=0.406  Sum_probs=18.2

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -++..++.|.+  |+-+|..|+|||+..
T Consensus        31 lll~aalag~h--VLL~GpPGTGKT~LA   56 (498)
T PRK13531         31 LCLLAALSGES--VFLLGPPGIAKSLIA   56 (498)
T ss_pred             HHHHHHccCCC--EEEECCCChhHHHHH
Confidence            34444556665  566999999999854


No 309
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=36.34  E-value=15  Score=35.09  Aligned_cols=17  Identities=35%  Similarity=0.538  Sum_probs=13.9

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..|+-+|++|+|||+..
T Consensus       109 ~~iLl~Gp~GtGKT~lA  125 (412)
T PRK05342        109 SNILLIGPTGSGKTLLA  125 (412)
T ss_pred             ceEEEEcCCCCCHHHHH
Confidence            55788999999998643


No 310
>PRK09401 reverse gyrase; Reviewed
Probab=36.15  E-value=21  Score=38.72  Aligned_cols=24  Identities=21%  Similarity=0.320  Sum_probs=18.5

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCce
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTy  188 (262)
                      ..+..++.|.|..+.  .+||||||.
T Consensus        87 ~~i~~il~g~dv~i~--ApTGsGKT~  110 (1176)
T PRK09401         87 TWAKRLLLGESFAII--APTGVGKTT  110 (1176)
T ss_pred             HHHHHHHCCCcEEEE--cCCCCCHHH
Confidence            345667899887665  499999995


No 311
>KOG0745|consensus
Probab=36.11  E-value=16  Score=35.31  Aligned_cols=18  Identities=39%  Similarity=0.654  Sum_probs=13.6

Q ss_pred             hCCCceeEeeeeccCCCCce
Q psy17370        169 FNGYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTy  188 (262)
                      |+..|  |+-.|+||||||+
T Consensus       224 LeKSN--vLllGPtGsGKTl  241 (564)
T KOG0745|consen  224 LEKSN--VLLLGPTGSGKTL  241 (564)
T ss_pred             eeccc--EEEECCCCCchhH
Confidence            44455  5668999999987


No 312
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=36.10  E-value=14  Score=28.36  Aligned_cols=15  Identities=27%  Similarity=0.485  Sum_probs=12.0

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      +.-.|++|||||..+
T Consensus        18 v~I~GpSGsGKSTLl   32 (107)
T cd00820          18 VLITGDSGIGKTELA   32 (107)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            345699999999866


No 313
>PRK06762 hypothetical protein; Provisional
Probab=35.62  E-value=16  Score=29.45  Aligned_cols=14  Identities=36%  Similarity=0.636  Sum_probs=11.3

Q ss_pred             eEeeeeccCCCCce
Q psy17370        175 CLFAYGQTGSGKSY  188 (262)
Q Consensus       175 ~ifaYG~tgSGKTy  188 (262)
                      .|.-.|..|||||+
T Consensus         4 li~i~G~~GsGKST   17 (166)
T PRK06762          4 LIIIRGNSGSGKTT   17 (166)
T ss_pred             EEEEECCCCCCHHH
Confidence            35557999999987


No 314
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=35.42  E-value=52  Score=27.62  Aligned_cols=16  Identities=31%  Similarity=0.459  Sum_probs=12.9

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      -|+--|..|+|||.-+
T Consensus         7 ki~ITG~PGvGKtTl~   22 (179)
T COG1618           7 KIFITGRPGVGKTTLV   22 (179)
T ss_pred             EEEEeCCCCccHHHHH
Confidence            4677899999999743


No 315
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
Probab=34.91  E-value=21  Score=38.89  Aligned_cols=23  Identities=30%  Similarity=0.400  Sum_probs=16.1

Q ss_pred             hhhCCCceeEeeeeccCCCCceec
Q psy17370        167 AAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       167 ~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+++.. .++-.|.||||||.-+
T Consensus        77 ~~l~~~~-vvii~g~TGSGKTTql   99 (1283)
T TIGR01967        77 EAIAENQ-VVIIAGETGSGKTTQL   99 (1283)
T ss_pred             HHHHhCc-eEEEeCCCCCCcHHHH
Confidence            4445544 5566799999999854


No 316
>PRK10865 protein disaggregation chaperone; Provisional
Probab=34.65  E-value=16  Score=38.17  Aligned_cols=17  Identities=29%  Similarity=0.343  Sum_probs=14.4

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      +.++-+|++|+|||++.
T Consensus       599 ~~~Lf~Gp~G~GKT~lA  615 (857)
T PRK10865        599 GSFLFLGPTGVGKTELC  615 (857)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            56777899999999965


No 317
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=34.60  E-value=19  Score=32.06  Aligned_cols=26  Identities=23%  Similarity=0.424  Sum_probs=18.8

Q ss_pred             hhhhCCCcee-EeeeeccCCCCceecC
Q psy17370        166 DAAFNGYNVC-LFAYGQTGSGKSYRGD  191 (262)
Q Consensus       166 ~~~l~G~n~~-ifaYG~tgSGKTyTm~  191 (262)
                      ..+++|..+- ++-||..|+|||.++.
T Consensus        44 ~~Fl~G~pannvLL~G~rGtGKSSlVk   70 (249)
T PF05673_consen   44 EQFLQGLPANNVLLWGARGTGKSSLVK   70 (249)
T ss_pred             HHHHcCCCCcceEEecCCCCCHHHHHH
Confidence            4567766332 5569999999998873


No 318
>PRK13822 conjugal transfer coupling protein TraG; Provisional
Probab=34.56  E-value=23  Score=35.77  Aligned_cols=17  Identities=12%  Similarity=0.073  Sum_probs=14.1

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .=++.+|.||||||..+
T Consensus       225 ~H~Lv~ApTgsGKt~g~  241 (641)
T PRK13822        225 THGLVFAGSGGFKTTSV  241 (641)
T ss_pred             ceEEEEeCCCCCccceE
Confidence            44678899999999965


No 319
>PRK02362 ski2-like helicase; Provisional
Probab=34.54  E-value=20  Score=36.58  Aligned_cols=21  Identities=29%  Similarity=0.287  Sum_probs=15.9

Q ss_pred             hhCCCceeEeeeeccCCCCceec
Q psy17370        168 AFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       168 ~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +++|.|+.+-  .+||||||..-
T Consensus        36 ~~~g~nvlv~--APTGSGKTlia   56 (737)
T PRK02362         36 LLDGKNLLAA--IPTASGKTLIA   56 (737)
T ss_pred             HhCCCcEEEE--CCCcchHHHHH
Confidence            5678876554  59999999863


No 320
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=34.52  E-value=18  Score=31.73  Aligned_cols=16  Identities=38%  Similarity=0.395  Sum_probs=13.0

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .+.-+|++|||||.-+
T Consensus        32 ~~~i~G~nGsGKSTL~   47 (235)
T COG1122          32 RVLLIGPNGSGKSTLL   47 (235)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4567899999999855


No 321
>PRK14532 adenylate kinase; Provisional
Probab=34.39  E-value=17  Score=30.01  Aligned_cols=14  Identities=29%  Similarity=0.639  Sum_probs=12.0

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-.|..|||||.-
T Consensus         3 i~~~G~pGsGKsT~   16 (188)
T PRK14532          3 LILFGPPAAGKGTQ   16 (188)
T ss_pred             EEEECCCCCCHHHH
Confidence            67799999999863


No 322
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=34.37  E-value=18  Score=30.54  Aligned_cols=15  Identities=40%  Similarity=0.392  Sum_probs=11.7

Q ss_pred             eEeeeeccCCCCcee
Q psy17370        175 CLFAYGQTGSGKSYR  189 (262)
Q Consensus       175 ~ifaYG~tgSGKTyT  189 (262)
                      ..+-+|++|||||--
T Consensus        26 ~~~i~G~NGsGKS~i   40 (220)
T PF02463_consen   26 LNVIVGPNGSGKSNI   40 (220)
T ss_dssp             EEEEEESTTSSHHHH
T ss_pred             CEEEEcCCCCCHHHH
Confidence            345689999999853


No 323
>KOG0987|consensus
Probab=33.99  E-value=25  Score=34.68  Aligned_cols=36  Identities=31%  Similarity=0.497  Sum_probs=22.8

Q ss_pred             CCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        150 DTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       150 ~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ...|..||+. +.   ..+.+..-...| ||.-|+||||-.
T Consensus       119 ~~eqk~v~d~-~~---~~v~~~~g~~ff-~g~~gtgKt~l~  154 (540)
T KOG0987|consen  119 TPEQKRVYDA-IL---EAVENNLGGVFF-YGFGGTGKTYLL  154 (540)
T ss_pred             CHHHHHHHHH-HH---HHHhccccceee-eccCCccceeeH
Confidence            3457778872 22   233343444556 999999999944


No 324
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=33.97  E-value=14  Score=28.12  Aligned_cols=15  Identities=27%  Similarity=0.257  Sum_probs=12.6

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.-+|.+|+|||..|
T Consensus         4 i~~~G~~~~GKstl~   18 (161)
T TIGR00231         4 IVIVGDPNVGKSTLL   18 (161)
T ss_pred             EEEECCCCCCHHHHH
Confidence            566899999999866


No 325
>TIGR01587 cas3_core CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.
Probab=33.89  E-value=19  Score=32.93  Aligned_cols=14  Identities=36%  Similarity=0.385  Sum_probs=11.5

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      ++.-++||||||..
T Consensus         2 vvi~apTGsGKT~~   15 (358)
T TIGR01587         2 LVIEAPTGYGKTEA   15 (358)
T ss_pred             EEEEeCCCCCHHHH
Confidence            45678999999975


No 326
>KOG0635|consensus
Probab=33.86  E-value=40  Score=28.10  Aligned_cols=29  Identities=24%  Similarity=0.378  Sum_probs=23.5

Q ss_pred             hhhhCCCceeEeeeeccCCCC-----------------ceecCCCC
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGK-----------------SYRGDSTL  194 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGK-----------------TyTm~G~~  194 (262)
                      +.+++-.-|+|+--|.+||||                 ||.+-|+.
T Consensus        24 q~l~~qkGcviWiTGLSgSGKStlACaL~q~L~qrgkl~Y~LDGDN   69 (207)
T KOG0635|consen   24 QKLLKQKGCVIWITGLSGSGKSTLACALSQALLQRGKLTYILDGDN   69 (207)
T ss_pred             HHHhcCCCcEEEEeccCCCCchhHHHHHHHHHHhcCceEEEecCcc
Confidence            346666678899999999999                 68888876


No 327
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=33.83  E-value=14  Score=32.26  Aligned_cols=14  Identities=29%  Similarity=0.325  Sum_probs=12.5

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      .-+|+.|+|||.|+
T Consensus        36 ~~~GpagtGKteti   49 (231)
T PF12774_consen   36 ALSGPAGTGKTETI   49 (231)
T ss_dssp             EEESSTTSSHHHHH
T ss_pred             CCcCCCCCCchhHH
Confidence            35999999999997


No 328
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=33.76  E-value=24  Score=31.15  Aligned_cols=16  Identities=25%  Similarity=0.310  Sum_probs=13.4

Q ss_pred             ceeEeeeeccCCCCce
Q psy17370        173 NVCLFAYGQTGSGKSY  188 (262)
Q Consensus       173 n~~ifaYG~tgSGKTy  188 (262)
                      ..+++-+|.+|+|||.
T Consensus        36 gs~~lI~G~pGtGKT~   51 (259)
T TIGR03878        36 YSVINITGVSDTGKSL   51 (259)
T ss_pred             CcEEEEEcCCCCCHHH
Confidence            4567789999999986


No 329
>PRK03839 putative kinase; Provisional
Probab=33.70  E-value=16  Score=29.88  Aligned_cols=14  Identities=29%  Similarity=0.418  Sum_probs=11.5

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-.|..|||||+-
T Consensus         3 I~l~G~pGsGKsT~   16 (180)
T PRK03839          3 IAITGTPGVGKTTV   16 (180)
T ss_pred             EEEECCCCCCHHHH
Confidence            56679999999863


No 330
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=33.66  E-value=21  Score=35.90  Aligned_cols=40  Identities=23%  Similarity=0.205  Sum_probs=22.5

Q ss_pred             eCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        147 LGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       147 f~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |.....|+.+...+...    .-.......+..|+||||||...
T Consensus       234 f~lt~~Q~~ai~~I~~~----~~~~~~~~~Ll~g~TGSGKT~va  273 (630)
T TIGR00643       234 FKLTRAQKRVVKEILQD----LKSDVPMNRLLQGDVGSGKTLVA  273 (630)
T ss_pred             CCCCHHHHHHHHHHHHH----hccCCCccEEEECCCCCcHHHHH
Confidence            34444555554443322    22222234677899999999854


No 331
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.64  E-value=23  Score=29.65  Aligned_cols=15  Identities=47%  Similarity=0.488  Sum_probs=11.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+| |..|||||.--
T Consensus         5 ~Iva-G~NGsGKstv~   19 (187)
T COG4185           5 DIVA-GPNGSGKSTVY   19 (187)
T ss_pred             EEEe-cCCCCCceeee
Confidence            4566 99999998643


No 332
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=33.61  E-value=15  Score=38.33  Aligned_cols=18  Identities=28%  Similarity=0.324  Sum_probs=14.9

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      |.-.+-.|.+|||||++|
T Consensus       449 N~N~~I~G~sGsGKS~l~  466 (844)
T PRK13721        449 NYNMAVCGTSGAGKTGLI  466 (844)
T ss_pred             cccEEEEcCCCCCHHHHH
Confidence            445677899999999988


No 333
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=33.59  E-value=20  Score=29.22  Aligned_cols=16  Identities=31%  Similarity=0.351  Sum_probs=12.5

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|.-.|.+|||||.-+
T Consensus         3 ii~l~G~~GsGKsTl~   18 (180)
T TIGR03263         3 LIVISGPSGVGKSTLV   18 (180)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3566799999999843


No 334
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=33.58  E-value=33  Score=31.73  Aligned_cols=30  Identities=30%  Similarity=0.350  Sum_probs=22.1

Q ss_pred             chhhHhhhhC-CC---ceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFN-GY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~-G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+-++.+|. |.   ...+.-||+.|||||.-.
T Consensus        39 Gi~~LD~~Lg~GGlp~G~iteI~Gp~GsGKTtLa   72 (325)
T cd00983          39 GSLSLDIALGIGGYPKGRIIEIYGPESSGKTTLA   72 (325)
T ss_pred             CCHHHHHHhcCCCccCCeEEEEECCCCCCHHHHH
Confidence            4477788887 43   445778999999999643


No 335
>PRK13853 type IV secretion system protein VirB4; Provisional
Probab=33.55  E-value=14  Score=38.09  Aligned_cols=18  Identities=22%  Similarity=0.191  Sum_probs=14.8

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      .+-.+.+|+||||||..|
T Consensus       426 ~g~~~I~G~tGsGKS~l~  443 (789)
T PRK13853        426 VGMTAIFGPIGRGKTTLM  443 (789)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            345678899999999987


No 336
>KOG1547|consensus
Probab=33.53  E-value=28  Score=31.18  Aligned_cols=30  Identities=27%  Similarity=0.540  Sum_probs=22.5

Q ss_pred             ccchhhHhhhh-CCCceeEeeeeccCCCCce
Q psy17370        159 IIAQPLLDAAF-NGYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       159 ~~~~plv~~~l-~G~n~~ifaYG~tgSGKTy  188 (262)
                      .+..++=...+ .|+.--|+.-||+|.||+.
T Consensus        31 tI~~Qm~~k~mk~GF~FNIMVVgqSglgkst   61 (336)
T KOG1547|consen   31 TIIEQMRKKTMKTGFDFNIMVVGQSGLGKST   61 (336)
T ss_pred             HHHHHHHHHHHhccCceEEEEEecCCCCchh
Confidence            33444444444 6999999999999999986


No 337
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=33.39  E-value=16  Score=35.13  Aligned_cols=17  Identities=41%  Similarity=0.513  Sum_probs=14.0

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..++..|.+|+|||.|+
T Consensus       224 ~vi~lvGptGvGKTTta  240 (432)
T PRK12724        224 KVVFFVGPTGSGKTTSI  240 (432)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            34666799999999987


No 338
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=33.36  E-value=17  Score=29.20  Aligned_cols=13  Identities=46%  Similarity=0.736  Sum_probs=10.9

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      |+-.|..|||||.
T Consensus         2 i~i~G~~GsGKST   14 (149)
T cd02027           2 IWLTGLSGSGKST   14 (149)
T ss_pred             EEEEcCCCCCHHH
Confidence            4567999999987


No 339
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=33.36  E-value=21  Score=37.12  Aligned_cols=26  Identities=31%  Similarity=0.247  Sum_probs=18.0

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+++.+.++.+  ++..|+||||||..+
T Consensus        12 ~i~~~l~~~~~--vvv~A~TGSGKTt~~   37 (812)
T PRK11664         12 ELLTALKTAPQ--VLLKAPTGAGKSTWL   37 (812)
T ss_pred             HHHHHHHhCCC--EEEEcCCCCCHHHHH
Confidence            45555544443  566899999999865


No 340
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=33.36  E-value=17  Score=35.76  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=13.2

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-||+.|+|||+..
T Consensus       218 GILLyGPPGTGKT~LA  233 (512)
T TIGR03689       218 GVLLYGPPGCGKTLIA  233 (512)
T ss_pred             ceEEECCCCCcHHHHH
Confidence            3777999999999754


No 341
>KOG1532|consensus
Probab=33.34  E-value=20  Score=32.67  Aligned_cols=19  Identities=32%  Similarity=0.371  Sum_probs=16.3

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      .-+||+..|.-|||||.-|
T Consensus        18 ~p~~ilVvGMAGSGKTTF~   36 (366)
T KOG1532|consen   18 RPVIILVVGMAGSGKTTFM   36 (366)
T ss_pred             CCcEEEEEecCCCCchhHH
Confidence            3579999999999999755


No 342
>CHL00195 ycf46 Ycf46; Provisional
Probab=33.28  E-value=15  Score=35.84  Aligned_cols=17  Identities=35%  Similarity=0.487  Sum_probs=14.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      -.|+-||+.|+|||+..
T Consensus       260 kGILL~GPpGTGKTllA  276 (489)
T CHL00195        260 RGLLLVGIQGTGKSLTA  276 (489)
T ss_pred             ceEEEECCCCCcHHHHH
Confidence            45889999999999755


No 343
>KOG0729|consensus
Probab=33.03  E-value=21  Score=32.47  Aligned_cols=40  Identities=15%  Similarity=0.039  Sum_probs=25.2

Q ss_pred             eEeeeeccCCCCceec--------------CCCC---CCCchHhhhhhccccccCcc
Q psy17370        175 CLFAYGQTGSGKSYRG--------------DSTL---NSSVLRPRVLFYPGFSWSHS  214 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm--------------~G~~---~~~Giipr~~~~lf~~~~~~  214 (262)
                      -|+.||+.|+|||..-              .|+.   ..-|==.|.+.+||+....+
T Consensus       213 gvllygppgtgktl~aravanrtdacfirvigselvqkyvgegarmvrelf~martk  269 (435)
T KOG0729|consen  213 GVLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTK  269 (435)
T ss_pred             ceEEeCCCCCchhHHHHHHhcccCceEEeehhHHHHHHHhhhhHHHHHHHHHHhccc
Confidence            4789999999998643              2332   22333456667777766543


No 344
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=32.77  E-value=24  Score=32.70  Aligned_cols=20  Identities=20%  Similarity=0.223  Sum_probs=16.1

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.-..|+-.|.+|+|||.|+
T Consensus       137 ~~p~Vil~vGVNG~GKTTTI  156 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTI  156 (340)
T ss_pred             CCcEEEEEEecCCCchHhHH
Confidence            33456777799999999998


No 345
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional
Probab=32.60  E-value=14  Score=37.42  Aligned_cols=21  Identities=24%  Similarity=0.438  Sum_probs=16.6

Q ss_pred             CCCceeEeeeeccCCCCceec
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ...+..|+-+|.+|+||++.-
T Consensus       396 a~~~~pVLI~GE~GTGK~~lA  416 (686)
T PRK15429        396 AQSDSTVLILGETGTGKELIA  416 (686)
T ss_pred             hCCCCCEEEECCCCcCHHHHH
Confidence            355667888999999999743


No 346
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=32.50  E-value=21  Score=30.25  Aligned_cols=16  Identities=31%  Similarity=0.362  Sum_probs=13.3

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      +++-+|++|+|||..+
T Consensus        24 ~~~i~G~NGsGKTTLl   39 (204)
T cd03240          24 LTLIVGQNGAGKTTII   39 (204)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            6667899999999765


No 347
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=32.45  E-value=14  Score=37.27  Aligned_cols=16  Identities=38%  Similarity=0.463  Sum_probs=14.0

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-||++|+|||.++
T Consensus       112 illL~GP~GsGKTTl~  127 (637)
T TIGR00602       112 ILLITGPSGCGKSTTI  127 (637)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4677999999999977


No 348
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=32.35  E-value=27  Score=33.93  Aligned_cols=27  Identities=22%  Similarity=0.271  Sum_probs=20.5

Q ss_pred             hhHhhhhCC---CceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNG---YNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G---~n~~ifaYG~tgSGKTyT  189 (262)
                      +-++.+|.|   ....++-+|.+|+|||.-
T Consensus        18 ~~LD~~l~GG~p~Gs~~li~G~pGsGKT~l   47 (509)
T PRK09302         18 EGFDDITHGGLPKGRPTLVSGTAGTGKTLF   47 (509)
T ss_pred             hhHHHhhcCCCCCCcEEEEEeCCCCCHHHH
Confidence            556777764   366788899999999863


No 349
>PTZ00301 uridine kinase; Provisional
Probab=32.32  E-value=14  Score=31.85  Aligned_cols=11  Identities=55%  Similarity=0.688  Sum_probs=9.5

Q ss_pred             eeccCCCCcee
Q psy17370        179 YGQTGSGKSYR  189 (262)
Q Consensus       179 YG~tgSGKTyT  189 (262)
                      -|.+|||||+.
T Consensus         9 aG~SgSGKTTl   19 (210)
T PTZ00301          9 SGASGSGKSSL   19 (210)
T ss_pred             ECCCcCCHHHH
Confidence            49999999984


No 350
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=32.22  E-value=16  Score=34.18  Aligned_cols=20  Identities=35%  Similarity=0.378  Sum_probs=14.3

Q ss_pred             hCCCceeEeeeeccCCCCceec
Q psy17370        169 FNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -.|--.|+  .|++|||||.++
T Consensus        29 ~~Gef~~l--LGPSGcGKTTlL   48 (352)
T COG3842          29 KKGEFVTL--LGPSGCGKTTLL   48 (352)
T ss_pred             cCCcEEEE--ECCCCCCHHHHH
Confidence            34544443  599999999987


No 351
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=32.11  E-value=17  Score=37.90  Aligned_cols=18  Identities=39%  Similarity=0.471  Sum_probs=14.9

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      ++-.+..|+||||||+.|
T Consensus       488 ~gh~~I~G~tGsGKS~l~  505 (852)
T PRK13891        488 LGHTFMFGPTGAGKSTHL  505 (852)
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            344678899999999988


No 352
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=31.90  E-value=12  Score=30.61  Aligned_cols=12  Identities=50%  Similarity=0.653  Sum_probs=10.4

Q ss_pred             eeccCCCCceec
Q psy17370        179 YGQTGSGKSYRG  190 (262)
Q Consensus       179 YG~tgSGKTyTm  190 (262)
                      .|.+|||||+.+
T Consensus         1 ~G~sGsGKSTla   12 (163)
T PRK11545          1 MGVSGSGKSAVA   12 (163)
T ss_pred             CCCCCCcHHHHH
Confidence            489999999876


No 353
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=31.90  E-value=19  Score=34.38  Aligned_cols=17  Identities=35%  Similarity=0.538  Sum_probs=14.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..|+-+|++|+|||+..
T Consensus       117 ~~iLL~GP~GsGKT~lA  133 (413)
T TIGR00382       117 SNILLIGPTGSGKTLLA  133 (413)
T ss_pred             ceEEEECCCCcCHHHHH
Confidence            46888999999998854


No 354
>KOG0652|consensus
Probab=31.79  E-value=21  Score=32.45  Aligned_cols=14  Identities=36%  Similarity=0.828  Sum_probs=12.2

Q ss_pred             eEeeeeccCCCCce
Q psy17370        175 CLFAYGQTGSGKSY  188 (262)
Q Consensus       175 ~ifaYG~tgSGKTy  188 (262)
                      -++.||+.|+|||.
T Consensus       207 GvLmYGPPGTGKTl  220 (424)
T KOG0652|consen  207 GVLMYGPPGTGKTL  220 (424)
T ss_pred             ceEeeCCCCCcHHH
Confidence            37899999999985


No 355
>PF01745 IPT:  Isopentenyl transferase;  InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [].; GO: 0004161 dimethylallyltranstransferase activity, 0009058 biosynthetic process; PDB: 2ZE8_C 2ZE5_A 2ZE7_A 2ZE6_A.
Probab=31.75  E-value=18  Score=31.60  Aligned_cols=15  Identities=33%  Similarity=0.545  Sum_probs=11.0

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      +.-+|+||+|||..-
T Consensus         4 ~~i~GpT~tGKt~~a   18 (233)
T PF01745_consen    4 YLIVGPTGTGKTALA   18 (233)
T ss_dssp             EEEE-STTSSHHHHH
T ss_pred             EEEECCCCCChhHHH
Confidence            455799999999853


No 356
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=31.73  E-value=17  Score=33.76  Aligned_cols=18  Identities=22%  Similarity=0.324  Sum_probs=14.6

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      .-.++-||+.|+|||..+
T Consensus        38 ~h~~L~~Gp~G~GKTtla   55 (363)
T PRK14961         38 HHAWLLSGTRGVGKTTIA   55 (363)
T ss_pred             CeEEEEecCCCCCHHHHH
Confidence            345788999999999855


No 357
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=31.67  E-value=19  Score=30.45  Aligned_cols=16  Identities=31%  Similarity=0.324  Sum_probs=12.2

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|.-.|.+|||||+.+
T Consensus         8 vi~I~G~sGsGKSTl~   23 (207)
T TIGR00235         8 IIGIGGGSGSGKTTVA   23 (207)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3556799999999744


No 358
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=31.39  E-value=21  Score=32.97  Aligned_cols=25  Identities=28%  Similarity=0.312  Sum_probs=17.4

Q ss_pred             hhhhCCC-ceeEeeeeccCCCCceec
Q psy17370        166 DAAFNGY-NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       166 ~~~l~G~-n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+-+|. .-.++-||+.|+|||+..
T Consensus        31 ~~i~~~~~~~~~L~~G~~G~GKt~~a   56 (367)
T PRK14970         31 NAIENNHLAQALLFCGPRGVGKTTCA   56 (367)
T ss_pred             HHHHcCCCCeEEEEECCCCCCHHHHH
Confidence            3333454 336778999999999765


No 359
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional
Probab=31.34  E-value=22  Score=34.55  Aligned_cols=17  Identities=24%  Similarity=0.339  Sum_probs=14.2

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..++-||+.|+|||...
T Consensus        37 ~~~Lf~GPpGtGKTTlA   53 (472)
T PRK14962         37 HAYIFAGPRGTGKTTVA   53 (472)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            34788999999999865


No 360
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=31.26  E-value=23  Score=34.66  Aligned_cols=17  Identities=41%  Similarity=0.499  Sum_probs=13.9

Q ss_pred             eEeeeeccCCCCceecC
Q psy17370        175 CLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm~  191 (262)
                      .++-.|++|||||+-|-
T Consensus        34 iv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        34 LLFLCGSSGDGKSEILA   50 (504)
T ss_pred             EEEEECCCCCCHHHHHh
Confidence            34668999999999775


No 361
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=31.19  E-value=39  Score=30.89  Aligned_cols=28  Identities=21%  Similarity=0.248  Sum_probs=20.2

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...+.-||..|||||.-+
T Consensus        83 ~~LD~lLgGGi~~G~iteI~G~~GsGKTql~  113 (313)
T TIGR02238        83 QALDGILGGGIESMSITEVFGEFRCGKTQLS  113 (313)
T ss_pred             HHHHHHhCCCCcCCeEEEEECCCCCCcCHHH
Confidence            5567778752   344568999999999733


No 362
>PTZ00035 Rad51 protein; Provisional
Probab=31.18  E-value=36  Score=31.45  Aligned_cols=30  Identities=20%  Similarity=0.227  Sum_probs=21.6

Q ss_pred             chhhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+-++.+|.|.   ...+.-||..|+|||.-+
T Consensus       103 G~~~LD~lLgGGi~~G~iteI~G~~GsGKT~l~  135 (337)
T PTZ00035        103 GSTQLDKLLGGGIETGSITELFGEFRTGKTQLC  135 (337)
T ss_pred             CcHHHHHHhCCCCCCCeEEEEECCCCCchhHHH
Confidence            346677888754   445667899999999743


No 363
>TIGR01817 nifA Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.
Probab=31.13  E-value=16  Score=35.73  Aligned_cols=45  Identities=20%  Similarity=0.263  Sum_probs=28.1

Q ss_pred             eeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        140 TFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       140 ~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.|+.+.+....-..+.+.     ++. +...+..|+-+|.+|+||++.-
T Consensus       192 ~~~~~~liG~s~~~~~~~~~-----~~~-~a~~~~pvli~Ge~GtGK~~lA  236 (534)
T TIGR01817       192 SGKEDGIIGKSPAMRQVVDQ-----ARV-VARSNSTVLLRGESGTGKELIA  236 (534)
T ss_pred             cCccCceEECCHHHHHHHHH-----HHH-HhCcCCCEEEECCCCccHHHHH
Confidence            36777777654433333322     222 2356777889999999998854


No 364
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=31.12  E-value=21  Score=28.19  Aligned_cols=13  Identities=38%  Similarity=0.473  Sum_probs=10.4

Q ss_pred             eeeeccCCCCcee
Q psy17370        177 FAYGQTGSGKSYR  189 (262)
Q Consensus       177 faYG~tgSGKTyT  189 (262)
                      .-.|++|||||.-
T Consensus         3 ~i~GpsGsGKstl   15 (137)
T cd00071           3 VLSGPSGVGKSTL   15 (137)
T ss_pred             EEECCCCCCHHHH
Confidence            3469999999973


No 365
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=31.01  E-value=25  Score=36.27  Aligned_cols=18  Identities=28%  Similarity=0.263  Sum_probs=14.9

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.++-+|++|+|||+..
T Consensus       488 ~~~~Lf~GP~GvGKT~lA  505 (758)
T PRK11034        488 VGSFLFAGPTGVGKTEVT  505 (758)
T ss_pred             cceEEEECCCCCCHHHHH
Confidence            357888999999999754


No 366
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=30.79  E-value=24  Score=32.42  Aligned_cols=16  Identities=31%  Similarity=0.364  Sum_probs=13.2

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-+|+|+||||...
T Consensus         5 ~i~I~GPTAsGKT~la   20 (308)
T COG0324           5 LIVIAGPTASGKTALA   20 (308)
T ss_pred             EEEEECCCCcCHHHHH
Confidence            4677899999999854


No 367
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=30.76  E-value=19  Score=30.57  Aligned_cols=16  Identities=38%  Similarity=0.441  Sum_probs=12.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .+.-.|++|||||..|
T Consensus        30 ~~~i~G~NGsGKSTll   45 (213)
T cd03279          30 LFLICGPTGAGKSTIL   45 (213)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3445799999998765


No 368
>PRK14701 reverse gyrase; Provisional
Probab=30.74  E-value=30  Score=38.90  Aligned_cols=24  Identities=25%  Similarity=0.299  Sum_probs=19.0

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCce
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTy  188 (262)
                      ..+..+++|.+..  +.++||||||.
T Consensus        86 ~~i~~il~G~d~l--i~APTGsGKTl  109 (1638)
T PRK14701         86 TWAKRILRGKSFS--IVAPTGMGKST  109 (1638)
T ss_pred             HHHHHHHcCCCEE--EEEcCCCCHHH
Confidence            4566788998865  45799999997


No 369
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=30.73  E-value=18  Score=35.78  Aligned_cols=16  Identities=31%  Similarity=0.407  Sum_probs=12.7

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|.-.|.+|+|||+++
T Consensus       352 vIaLVGPtGvGKTTta  367 (559)
T PRK12727        352 VIALVGPTGAGKTTTI  367 (559)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3444599999999987


No 370
>KOG2035|consensus
Probab=30.64  E-value=31  Score=31.54  Aligned_cols=28  Identities=36%  Similarity=0.483  Sum_probs=18.3

Q ss_pred             hhHhhhh-CCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAF-NGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l-~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.+..+. .|----++.||++|+||-..+
T Consensus        23 ~~Lksl~~~~d~PHll~yGPSGaGKKTri   51 (351)
T KOG2035|consen   23 NLLKSLSSTGDFPHLLVYGPSGAGKKTRI   51 (351)
T ss_pred             HHHHHhcccCCCCeEEEECCCCCCchhhH
Confidence            4444433 354455789999999996544


No 371
>TIGR01074 rep ATP-dependent DNA helicase Rep. Designed to identify rep members of the uvrD/rep subfamily.
Probab=30.63  E-value=20  Score=35.97  Aligned_cols=19  Identities=21%  Similarity=0.125  Sum_probs=15.3

Q ss_pred             eeEeeeeccCCCCceecCC
Q psy17370        174 VCLFAYGQTGSGKSYRGDS  192 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm~G  192 (262)
                      +-++..|.-|||||.||..
T Consensus        15 ~~~~V~Ag~GSGKT~~L~~   33 (664)
T TIGR01074        15 GPCLVLAGAGSGKTRVITN   33 (664)
T ss_pred             CCEEEEecCCCCHHHHHHH
Confidence            4467788999999999853


No 372
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=30.62  E-value=29  Score=37.67  Aligned_cols=25  Identities=20%  Similarity=0.268  Sum_probs=19.1

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      ..+..++.|.+..+  -++||||||+.
T Consensus        85 ~~i~~il~G~d~vi--~ApTGsGKT~f  109 (1171)
T TIGR01054        85 MWAKRVLRGDSFAI--IAPTGVGKTTF  109 (1171)
T ss_pred             HHHHHHhCCCeEEE--ECCCCCCHHHH
Confidence            44567889998664  56999999963


No 373
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=30.51  E-value=38  Score=29.80  Aligned_cols=39  Identities=26%  Similarity=0.028  Sum_probs=26.5

Q ss_pred             eEeee-eccCCCCceecCCCCCCCchHhhhhhccccccCccceEEEEEEEE
Q psy17370        175 CLFAY-GQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVV  224 (262)
Q Consensus       175 ~ifaY-G~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~~~~~~~vS~~E  224 (262)
                      .|.|. |++|+||+.-+           |++..+...+....++-.|-|.-
T Consensus        34 ~VTAlIGPSGcGKST~L-----------R~lNRmndl~~~~r~~G~v~~~g   73 (253)
T COG1117          34 KVTALIGPSGCGKSTLL-----------RCLNRMNDLIPGARVEGEVLLDG   73 (253)
T ss_pred             ceEEEECCCCcCHHHHH-----------HHHHhhcccCcCceEEEEEEECC
Confidence            34454 99999998755           77777766666656665555543


No 374
>PRK09354 recA recombinase A; Provisional
Probab=30.47  E-value=35  Score=31.89  Aligned_cols=30  Identities=30%  Similarity=0.349  Sum_probs=22.2

Q ss_pred             chhhHhhhhC-CC---ceeEeeeeccCCCCceec
Q psy17370        161 AQPLLDAAFN-GY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       161 ~~plv~~~l~-G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+-++.+|. |.   ...+.-||+.|||||.-.
T Consensus        44 Gi~~LD~~LG~GGip~G~IteI~G~~GsGKTtLa   77 (349)
T PRK09354         44 GSLALDIALGIGGLPRGRIVEIYGPESSGKTTLA   77 (349)
T ss_pred             CcHHHHHHhcCCCCcCCeEEEEECCCCCCHHHHH
Confidence            3467788887 43   446778999999999743


No 375
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family. This model detects members of a highly divergent family of the large subunit of phage terminase. All members are encoded by phage genomes or within prophage regions of bacterial genomes. This is a distinct family from pfam03354.
Probab=30.47  E-value=19  Score=33.69  Aligned_cols=16  Identities=31%  Similarity=0.453  Sum_probs=13.9

Q ss_pred             EeeeeccCCCCceecC
Q psy17370        176 LFAYGQTGSGKSYRGD  191 (262)
Q Consensus       176 ifaYG~tgSGKTyTm~  191 (262)
                      ++++|..|||||+.+.
T Consensus         4 ~i~~GgrgSGKS~~~~   19 (396)
T TIGR01547         4 IIAKGGRRSGKTFAIA   19 (396)
T ss_pred             EEEeCCCCcccHHHHH
Confidence            5789999999999874


No 376
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=30.47  E-value=17  Score=35.64  Aligned_cols=47  Identities=15%  Similarity=0.182  Sum_probs=28.6

Q ss_pred             ceeeeeceeeCCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        138 SYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       138 ~~~f~FD~vf~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ...+.||.+.+....-..+.+.     +.. +...+.-|+-+|.+|+||++..
T Consensus       198 ~~~~~f~~~ig~s~~~~~~~~~-----~~~-~A~~~~pvlI~GE~GtGK~~lA  244 (520)
T PRK10820        198 NDDSAFSQIVAVSPKMRQVVEQ-----ARK-LAMLDAPLLITGDTGTGKDLLA  244 (520)
T ss_pred             cccccccceeECCHHHHHHHHH-----HHH-HhCCCCCEEEECCCCccHHHHH
Confidence            3457788877654332222222     222 2345667889999999998754


No 377
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=30.41  E-value=23  Score=32.28  Aligned_cols=22  Identities=27%  Similarity=0.351  Sum_probs=16.4

Q ss_pred             hCCC-ceeEeeeeccCCCCceec
Q psy17370        169 FNGY-NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       169 l~G~-n~~ifaYG~tgSGKTyTm  190 (262)
                      -+|. ...++-||+.|+|||.+.
T Consensus        31 ~~~~~~~~~Ll~G~~G~GKt~~a   53 (355)
T TIGR02397        31 KNGRIAHAYLFSGPRGTGKTSIA   53 (355)
T ss_pred             HcCCCCeEEEEECCCCCCHHHHH
Confidence            3454 346788999999999765


No 378
>PRK13889 conjugal transfer relaxase TraA; Provisional
Probab=30.41  E-value=25  Score=37.43  Aligned_cols=26  Identities=27%  Similarity=0.322  Sum_probs=20.1

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|..++.+.+.+ +-.|.-|+||||+|
T Consensus       354 Av~~il~s~~v~-vv~G~AGTGKTT~l  379 (988)
T PRK13889        354 ALAHVTDGRDLG-VVVGYAGTGKSAML  379 (988)
T ss_pred             HHHHHhcCCCeE-EEEeCCCCCHHHHH
Confidence            456677776654 47799999999986


No 379
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=30.38  E-value=24  Score=36.17  Aligned_cols=17  Identities=29%  Similarity=0.354  Sum_probs=13.9

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      +.++-+|++|+|||+..
T Consensus       485 ~~~lf~Gp~GvGKT~lA  501 (731)
T TIGR02639       485 GSFLFTGPTGVGKTELA  501 (731)
T ss_pred             eeEEEECCCCccHHHHH
Confidence            46778899999999654


No 380
>PRK00300 gmk guanylate kinase; Provisional
Probab=30.35  E-value=24  Score=29.37  Aligned_cols=16  Identities=31%  Similarity=0.387  Sum_probs=12.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|.-.|.+|||||..+
T Consensus         7 ~i~i~G~sGsGKstl~   22 (205)
T PRK00300          7 LIVLSGPSGAGKSTLV   22 (205)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4566799999999743


No 381
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=30.10  E-value=33  Score=29.16  Aligned_cols=25  Identities=28%  Similarity=0.581  Sum_probs=16.7

Q ss_pred             HhhhhC-CC--ceeEeeeeccCCCCcee
Q psy17370        165 LDAAFN-GY--NVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       165 v~~~l~-G~--n~~ifaYG~tgSGKTyT  189 (262)
                      ++.+|. |.  ...+.-+|.+|+|||.-
T Consensus         5 LD~~l~gGi~~g~~~li~G~~G~GKt~~   32 (224)
T TIGR03880         5 LDEMLGGGFPEGHVIVVIGEYGTGKTTF   32 (224)
T ss_pred             hHHHhcCCCCCCeEEEEECCCCCCHHHH
Confidence            455564 32  44556689999999764


No 382
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=30.06  E-value=24  Score=24.33  Aligned_cols=14  Identities=43%  Similarity=0.465  Sum_probs=10.8

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      +--|..|||||..+
T Consensus         3 ~i~G~~gsGKst~~   16 (69)
T cd02019           3 AITGGSGSGKSTVA   16 (69)
T ss_pred             EEECCCCCCHHHHH
Confidence            34599999998754


No 383
>KOG0924|consensus
Probab=30.06  E-value=27  Score=35.66  Aligned_cols=20  Identities=35%  Similarity=0.413  Sum_probs=16.8

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +-|..|.-.|.||||||.-+
T Consensus       369 r~n~vvvivgETGSGKTTQl  388 (1042)
T KOG0924|consen  369 RENQVVVIVGETGSGKTTQL  388 (1042)
T ss_pred             hhCcEEEEEecCCCCchhhh
Confidence            56777888899999999766


No 384
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=29.95  E-value=39  Score=32.78  Aligned_cols=27  Identities=33%  Similarity=0.466  Sum_probs=20.6

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCcee
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyT  189 (262)
                      +-++.+|.|.   ..+++-.|++|+|||.-
T Consensus       250 ~~lD~~lgGG~~~gs~~li~G~~G~GKt~l  279 (484)
T TIGR02655       250 VRLDEMCGGGFFKDSIILATGATGTGKTLL  279 (484)
T ss_pred             HhHHHHhcCCccCCcEEEEECCCCCCHHHH
Confidence            5567778753   55678899999999863


No 385
>KOG1970|consensus
Probab=29.88  E-value=25  Score=34.88  Aligned_cols=19  Identities=37%  Similarity=0.566  Sum_probs=14.3

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |.+. ++-.|++|+|||.|+
T Consensus       109 ~~~i-LLltGPsGcGKSTtv  127 (634)
T KOG1970|consen  109 GSRI-LLLTGPSGCGKSTTV  127 (634)
T ss_pred             CceE-EEEeCCCCCCchhHH
Confidence            3344 445699999999988


No 386
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf4 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies farthest (fourth closest) from the repeats in the A. ferrooxidans genome.
Probab=29.83  E-value=19  Score=36.44  Aligned_cols=17  Identities=24%  Similarity=0.124  Sum_probs=13.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..+++-..||+|||+..
T Consensus        17 ~~lliEA~TGtGKTlAY   33 (636)
T TIGR03117        17 RIGMLEASTGVGKTLAM   33 (636)
T ss_pred             CeEEEEcCCCCcHHHHH
Confidence            45778889999999643


No 387
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=29.79  E-value=27  Score=34.22  Aligned_cols=26  Identities=23%  Similarity=0.355  Sum_probs=18.7

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..|..+|+|.+  |++..+||||||..-
T Consensus        58 ~~IP~~l~g~D--vi~~A~TGsGKT~Af   83 (513)
T COG0513          58 AAIPLILAGRD--VLGQAQTGTGKTAAF   83 (513)
T ss_pred             HHHHHHhCCCC--EEEECCCCChHHHHH
Confidence            33556788866  566779999998643


No 388
>PRK14530 adenylate kinase; Provisional
Probab=29.72  E-value=23  Score=30.09  Aligned_cols=14  Identities=29%  Similarity=0.657  Sum_probs=11.7

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-.|..|||||.-
T Consensus         6 I~i~G~pGsGKsT~   19 (215)
T PRK14530          6 ILLLGAPGAGKGTQ   19 (215)
T ss_pred             EEEECCCCCCHHHH
Confidence            66789999999863


No 389
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=29.69  E-value=22  Score=30.09  Aligned_cols=13  Identities=46%  Similarity=0.680  Sum_probs=11.3

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      |+-+|..|||||.
T Consensus         2 I~i~G~pGsGKsT   14 (210)
T TIGR01351         2 LVLLGPPGSGKGT   14 (210)
T ss_pred             EEEECCCCCCHHH
Confidence            5678999999976


No 390
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage.  When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task.  This CD represents the nucleotide binding domain of RecF.  RecF  belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=29.55  E-value=19  Score=31.85  Aligned_cols=14  Identities=21%  Similarity=0.254  Sum_probs=11.4

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      +-+|++|+|||--|
T Consensus        25 ~i~G~NGsGKS~ll   38 (270)
T cd03242          25 VLVGENAQGKTNLL   38 (270)
T ss_pred             EEECCCCCCHHHHH
Confidence            35799999998755


No 391
>COG1204 Superfamily II helicase [General function prediction only]
Probab=29.55  E-value=26  Score=36.25  Aligned_cols=20  Identities=35%  Similarity=0.423  Sum_probs=13.9

Q ss_pred             hhCCCceeEeeeeccCCCCcee
Q psy17370        168 AFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       168 ~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      +++|.|+.|-  -+||||||-.
T Consensus        44 ~~~~~N~li~--aPTgsGKTlI   63 (766)
T COG1204          44 LLSDENVLIS--APTGSGKTLI   63 (766)
T ss_pred             ccCCCcEEEE--cCCCCchHHH
Confidence            3446676554  4999999963


No 392
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=29.52  E-value=23  Score=30.99  Aligned_cols=14  Identities=43%  Similarity=0.382  Sum_probs=11.5

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      .-.|++|||||.-|
T Consensus        35 aI~GpSGSGKSTLL   48 (226)
T COG1136          35 AIVGPSGSGKSTLL   48 (226)
T ss_pred             EEECCCCCCHHHHH
Confidence            44699999999855


No 393
>KOG0739|consensus
Probab=29.44  E-value=23  Score=32.81  Aligned_cols=44  Identities=25%  Similarity=0.456  Sum_probs=26.5

Q ss_pred             eeCCCCCcchhhcccchhhH-hhhhCCC---ceeEeeeeccCCCCcee
Q psy17370        146 CLGQDTDQTSVFTIIAQPLL-DAAFNGY---NVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       146 vf~~~~~q~~vy~~~~~plv-~~~l~G~---n~~ifaYG~tgSGKTyT  189 (262)
                      |-+-+...+-+-+.++.|+- -.+|.|.   -..|+-||+.|+||+|-
T Consensus       135 VAGLE~AKeALKEAVILPIKFPqlFtGkR~PwrgiLLyGPPGTGKSYL  182 (439)
T KOG0739|consen  135 VAGLEGAKEALKEAVILPIKFPQLFTGKRKPWRGILLYGPPGTGKSYL  182 (439)
T ss_pred             hccchhHHHHHHhheeecccchhhhcCCCCcceeEEEeCCCCCcHHHH
Confidence            33333334444444444542 3455555   35689999999999984


No 394
>PRK13850 type IV secretion system protein VirD4; Provisional
Probab=29.30  E-value=40  Score=34.30  Aligned_cols=28  Identities=21%  Similarity=0.283  Sum_probs=20.4

Q ss_pred             CCceeEeeeeccCCCCceecCCCCCCCchHhhhhhc
Q psy17370        171 GYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFY  206 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~  206 (262)
                      +.+.-++.+|.||||||..+        +||..+.+
T Consensus       137 ~~~~hvlviApTgSGKgvg~--------VIPnLL~~  164 (670)
T PRK13850        137 GEQPHSLVVAPTRAGKGVGV--------VIPTLLTF  164 (670)
T ss_pred             CCCceEEEEecCCCCceeee--------hHhHHhcC
Confidence            33445778899999999877        46666654


No 395
>PRK14527 adenylate kinase; Provisional
Probab=29.27  E-value=26  Score=29.08  Aligned_cols=16  Identities=25%  Similarity=0.476  Sum_probs=13.2

Q ss_pred             eeEeeeeccCCCCcee
Q psy17370        174 VCLFAYGQTGSGKSYR  189 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyT  189 (262)
                      -.|+-+|..|||||..
T Consensus         7 ~~i~i~G~pGsGKsT~   22 (191)
T PRK14527          7 KVVIFLGPPGAGKGTQ   22 (191)
T ss_pred             cEEEEECCCCCCHHHH
Confidence            3578899999999874


No 396
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=29.27  E-value=18  Score=35.38  Aligned_cols=14  Identities=43%  Similarity=0.451  Sum_probs=11.3

Q ss_pred             eeeccCCCCceecC
Q psy17370        178 AYGQTGSGKSYRGD  191 (262)
Q Consensus       178 aYG~tgSGKTyTm~  191 (262)
                      -+|.||||||-..+
T Consensus         2 L~g~TGsGKT~v~l   15 (505)
T TIGR00595         2 LFGVTGSGKTEVYL   15 (505)
T ss_pred             ccCCCCCCHHHHHH
Confidence            37999999997653


No 397
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=29.20  E-value=23  Score=36.19  Aligned_cols=16  Identities=31%  Similarity=0.679  Sum_probs=13.7

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-||+.|+|||+.+
T Consensus       214 giLL~GppGtGKT~la  229 (733)
T TIGR01243       214 GVLLYGPPGTGKTLLA  229 (733)
T ss_pred             eEEEECCCCCChHHHH
Confidence            4778999999999864


No 398
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=29.18  E-value=24  Score=32.28  Aligned_cols=15  Identities=33%  Similarity=0.434  Sum_probs=12.4

Q ss_pred             eEeeeeccCCCCcee
Q psy17370        175 CLFAYGQTGSGKSYR  189 (262)
Q Consensus       175 ~ifaYG~tgSGKTyT  189 (262)
                      .|+-.|+||||||.-
T Consensus         6 ~i~i~GptgsGKt~l   20 (307)
T PRK00091          6 VIVIVGPTASGKTAL   20 (307)
T ss_pred             EEEEECCCCcCHHHH
Confidence            467789999999973


No 399
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=29.11  E-value=26  Score=26.27  Aligned_cols=15  Identities=27%  Similarity=0.202  Sum_probs=11.9

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.-.|.+|+|||.-+
T Consensus         2 V~iiG~~~~GKSTli   16 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLI   16 (116)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            345799999999854


No 400
>PRK13880 conjugal transfer coupling protein TraG; Provisional
Probab=29.03  E-value=31  Score=34.88  Aligned_cols=17  Identities=29%  Similarity=0.329  Sum_probs=14.3

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .-++.+|.||||||..+
T Consensus       176 ~HvlviapTgSGKgvg~  192 (636)
T PRK13880        176 EHVLTYAPTRSGKGVGL  192 (636)
T ss_pred             ceEEEEecCCCCCceEE
Confidence            34678899999999977


No 401
>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family. Members of this family include the predicted ATPase, TraG, encoded by transfer region genes of conjugative transposons of Bacteroides, such as CTnDOT, found on the main chromosome. Members also include TraG homologs borne on plasmids in Bacteroides. The protein family is related to the conjugative transfer system ATPase VirB4.
Probab=28.92  E-value=19  Score=37.61  Aligned_cols=18  Identities=44%  Similarity=0.623  Sum_probs=15.6

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      |.-.+..|++|+|||..|
T Consensus       438 n~N~~I~G~sGsGKS~l~  455 (829)
T TIGR03783       438 NRNKFILGPSGSGKSFFT  455 (829)
T ss_pred             cCceEEECCCCCCHHHHH
Confidence            566788899999999987


No 402
>PRK13830 conjugal transfer protein TrbE; Provisional
Probab=28.84  E-value=18  Score=37.56  Aligned_cols=19  Identities=37%  Similarity=0.293  Sum_probs=15.9

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      -++-.+..|+||+|||..|
T Consensus       455 d~g~~~i~G~tGsGKS~l~  473 (818)
T PRK13830        455 DVGHTLIFGPTGSGKSTLL  473 (818)
T ss_pred             CCCEEEEECCCCCCHHHHH
Confidence            3555788999999999988


No 403
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM).
Probab=28.84  E-value=19  Score=35.74  Aligned_cols=15  Identities=47%  Similarity=0.567  Sum_probs=12.3

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      ++.+|.||||||..|
T Consensus       179 ~li~G~tGsGKs~~i  193 (566)
T TIGR02759       179 ILIHGTTGSGKSVAI  193 (566)
T ss_pred             eEEEcCCCCCHHHHH
Confidence            567899999999644


No 404
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=28.70  E-value=23  Score=34.05  Aligned_cols=17  Identities=29%  Similarity=0.415  Sum_probs=13.7

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .-|+-+|++|+|||+..
T Consensus        48 ~~ILLiGppG~GKT~lA   64 (441)
T TIGR00390        48 KNILMIGPTGVGKTEIA   64 (441)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            34778999999998744


No 405
>PRK10689 transcription-repair coupling factor; Provisional
Probab=28.66  E-value=24  Score=38.15  Aligned_cols=38  Identities=16%  Similarity=0.201  Sum_probs=21.9

Q ss_pred             CCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCcee
Q psy17370        148 GQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       148 ~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      .+...|.+++..+...    +-.+..--++..|+||+|||-.
T Consensus       600 ~~T~~Q~~aI~~il~d----~~~~~~~d~Ll~a~TGsGKT~v  637 (1147)
T PRK10689        600 ETTPDQAQAINAVLSD----MCQPLAMDRLVCGDVGFGKTEV  637 (1147)
T ss_pred             CCCHHHHHHHHHHHHH----hhcCCCCCEEEEcCCCcCHHHH
Confidence            4555565555443322    1122233477889999999964


No 406
>KOG0925|consensus
Probab=28.63  E-value=33  Score=33.71  Aligned_cols=20  Identities=35%  Similarity=0.368  Sum_probs=17.0

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.|.+|.--|.||||||.-+
T Consensus        60 ~~nQ~~v~vGetgsGKttQi   79 (699)
T KOG0925|consen   60 LNNQIIVLVGETGSGKTTQI   79 (699)
T ss_pred             hcCceEEEEecCCCCccccC
Confidence            56788888999999999755


No 407
>PRK10867 signal recognition particle protein; Provisional
Probab=28.60  E-value=27  Score=33.56  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=14.5

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      -..|+..|.+|+|||.|.
T Consensus       100 p~vI~~vG~~GsGKTTta  117 (433)
T PRK10867        100 PTVIMMVGLQGAGKTTTA  117 (433)
T ss_pred             CEEEEEECCCCCcHHHHH
Confidence            345667799999999876


No 408
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=28.58  E-value=42  Score=31.23  Aligned_cols=28  Identities=29%  Similarity=0.361  Sum_probs=20.4

Q ss_pred             chhhHhhhhCCC---ceeEeeeeccCCCCce
Q psy17370        161 AQPLLDAAFNGY---NVCLFAYGQTGSGKSY  188 (262)
Q Consensus       161 ~~plv~~~l~G~---n~~ifaYG~tgSGKTy  188 (262)
                      ..+-++.+|.|.   .....-||..|||||.
T Consensus       111 G~~~LD~lLgGGi~~G~ItEI~G~~GsGKTq  141 (344)
T PLN03187        111 GSQALDELLGGGIETRCITEAFGEFRSGKTQ  141 (344)
T ss_pred             CcHhHHhhcCCCCCCCeEEEEecCCCCChhH
Confidence            346677888753   3345689999999997


No 409
>PF14553 YqbF:  YqbF, hypothetical protein domain; PDB: 2HJQ_A.
Probab=28.45  E-value=25  Score=22.51  Aligned_cols=9  Identities=33%  Similarity=0.552  Sum_probs=6.9

Q ss_pred             CCceecCCC
Q psy17370        185 GKSYRGDST  193 (262)
Q Consensus       185 GKTyTm~G~  193 (262)
                      ||||+.+|-
T Consensus         3 GktY~~~g~   11 (43)
T PF14553_consen    3 GKTYYAMGH   11 (43)
T ss_dssp             -SEEEETTE
T ss_pred             CcEEEEeee
Confidence            899999884


No 410
>TIGR02688 conserved hypothetical protein TIGR02688. Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687.
Probab=28.43  E-value=22  Score=34.21  Aligned_cols=20  Identities=40%  Similarity=0.700  Sum_probs=15.1

Q ss_pred             CCCceeEeeeeccCCCCceecC
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      .++|.+  -.|++|+||||.-.
T Consensus       208 ~~~Nli--~lGp~GTGKThla~  227 (449)
T TIGR02688       208 PNYNLI--ELGPKGTGKSYIYN  227 (449)
T ss_pred             cCCcEE--EECCCCCCHHHHHH
Confidence            566654  57999999998653


No 411
>COG1162 Predicted GTPases [General function prediction only]
Probab=28.40  E-value=33  Score=31.33  Aligned_cols=26  Identities=31%  Similarity=0.391  Sum_probs=19.1

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      ..+...|.|. .++|+ ||+|-||+.-+
T Consensus       156 ~~l~~~l~~~-~svl~-GqSGVGKSSLi  181 (301)
T COG1162         156 EELAELLAGK-ITVLL-GQSGVGKSTLI  181 (301)
T ss_pred             HHHHHHhcCC-eEEEE-CCCCCcHHHHH
Confidence            3455677777 56665 99999999855


No 412
>TIGR00174 miaA tRNA isopentenyltransferase (miaA). Catalyzes the first step in the modification of an adenosine near the anticodon to 2-methylthio-N6-isopentyladenosine.
Probab=28.38  E-value=25  Score=31.84  Aligned_cols=15  Identities=40%  Similarity=0.574  Sum_probs=12.1

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|+||||||.-.
T Consensus         2 i~i~G~t~~GKs~la   16 (287)
T TIGR00174         2 IFIMGPTAVGKSQLA   16 (287)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567799999999743


No 413
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=28.25  E-value=28  Score=28.66  Aligned_cols=16  Identities=44%  Similarity=0.698  Sum_probs=13.6

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|..|+|||...
T Consensus         6 ~I~liG~~GaGKStl~   21 (172)
T PRK05057          6 NIFLVGPMGAGKSTIG   21 (172)
T ss_pred             EEEEECCCCcCHHHHH
Confidence            5788899999998754


No 414
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=28.20  E-value=23  Score=29.36  Aligned_cols=15  Identities=33%  Similarity=0.379  Sum_probs=11.8

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.--|.+|||||+..
T Consensus         2 i~i~G~sgsGKttla   16 (179)
T cd02028           2 VGIAGPSGSGKTTFA   16 (179)
T ss_pred             EEEECCCCCCHHHHH
Confidence            445699999999855


No 415
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=28.10  E-value=15  Score=38.85  Aligned_cols=13  Identities=31%  Similarity=0.376  Sum_probs=11.5

Q ss_pred             eeccCCCCceecC
Q psy17370        179 YGQTGSGKSYRGD  191 (262)
Q Consensus       179 YG~tgSGKTyTm~  191 (262)
                      +--+|||||.||+
T Consensus       279 WHtqGSGKTlTm~  291 (962)
T COG0610         279 WHTQGSGKTLTMF  291 (962)
T ss_pred             EeecCCchHHHHH
Confidence            5679999999996


No 416
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=28.03  E-value=16  Score=33.23  Aligned_cols=16  Identities=25%  Similarity=0.264  Sum_probs=12.8

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|.--|.+|||||.++
T Consensus        64 IIGIaG~~GSGKSTla   79 (290)
T TIGR00554        64 IISIAGSVAVGKSTTA   79 (290)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3445599999999987


No 417
>PF05872 DUF853:  Bacterial protein of unknown function (DUF853);  InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold. This family is restricted to bacterial proteins, none of which have currently been characterised.
Probab=28.03  E-value=22  Score=34.47  Aligned_cols=12  Identities=42%  Similarity=0.567  Sum_probs=11.0

Q ss_pred             eeccCCCCceec
Q psy17370        179 YGQTGSGKSYRG  190 (262)
Q Consensus       179 YG~tgSGKTyTm  190 (262)
                      -|.||+|||-|+
T Consensus        25 aGATGTGKTvTL   36 (502)
T PF05872_consen   25 AGATGTGKTVTL   36 (502)
T ss_pred             eccCCCCceehH
Confidence            499999999998


No 418
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=27.98  E-value=21  Score=33.22  Aligned_cols=13  Identities=38%  Similarity=0.434  Sum_probs=11.4

Q ss_pred             eeeccCCCCceec
Q psy17370        178 AYGQTGSGKSYRG  190 (262)
Q Consensus       178 aYG~tgSGKTyTm  190 (262)
                      -.|++|+|||.++
T Consensus        34 llGPSGcGKSTlL   46 (338)
T COG3839          34 LLGPSGCGKSTLL   46 (338)
T ss_pred             EECCCCCCHHHHH
Confidence            3599999999987


No 419
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=27.96  E-value=23  Score=36.36  Aligned_cols=37  Identities=27%  Similarity=0.171  Sum_probs=24.5

Q ss_pred             CCceeEeeeeccCCCCceecC---------CCC-----CCCchHhhhhhcc
Q psy17370        171 GYNVCLFAYGQTGSGKSYRGD---------STL-----NSSVLRPRVLFYP  207 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm~---------G~~-----~~~Giipr~~~~l  207 (262)
                      |.....+-+|.||||||---+         |..     .+-++.|+.++.+
T Consensus       215 ~~~~~~Ll~GvTGSGKTEvYl~~i~~~L~~GkqvLvLVPEI~Ltpq~~~rf  265 (730)
T COG1198         215 GGFAPFLLDGVTGSGKTEVYLEAIAKVLAQGKQVLVLVPEIALTPQLLARF  265 (730)
T ss_pred             ccccceeEeCCCCCcHHHHHHHHHHHHHHcCCEEEEEeccccchHHHHHHH
Confidence            334455667999999995332         222     5677778777765


No 420
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=27.90  E-value=22  Score=35.45  Aligned_cols=28  Identities=25%  Similarity=0.318  Sum_probs=18.2

Q ss_pred             hhHhhhh-CCCc-eeEeeeeccCCCCceec
Q psy17370        163 PLLDAAF-NGYN-VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l-~G~n-~~ifaYG~tgSGKTyTm  190 (262)
                      ..+...+ .|.- -.++-||+.|+|||...
T Consensus        26 ~~L~~~i~~~~i~~a~Lf~Gp~G~GKTtlA   55 (585)
T PRK14950         26 QTLRNAIAEGRVAHAYLFTGPRGVGKTSTA   55 (585)
T ss_pred             HHHHHHHHhCCCceEEEEECCCCCCHHHHH
Confidence            3334433 3442 34678999999999765


No 421
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=27.84  E-value=26  Score=34.07  Aligned_cols=28  Identities=32%  Similarity=0.484  Sum_probs=19.5

Q ss_pred             CCCceeEeeeeccCCCCceecCCCCCCCchHhh
Q psy17370        170 NGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPR  202 (262)
Q Consensus       170 ~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr  202 (262)
                      -|+|  ++-||+.|||||....   .-+||+|-
T Consensus       197 GgHn--Ll~~GpPGtGKTmla~---Rl~~lLPp  224 (490)
T COG0606         197 GGHN--LLLVGPPGTGKTMLAS---RLPGLLPP  224 (490)
T ss_pred             cCCc--EEEecCCCCchHHhhh---hhcccCCC
Confidence            3555  6789999999998663   23566554


No 422
>TIGR02239 recomb_RAD51 DNA repair protein RAD51. This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
Probab=27.79  E-value=46  Score=30.44  Aligned_cols=28  Identities=21%  Similarity=0.217  Sum_probs=19.7

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...+..||..|+|||.-+
T Consensus        83 ~~lD~ll~gGi~~g~i~~i~G~~g~GKT~l~  113 (316)
T TIGR02239        83 KELDKLLGGGIETGSITEIFGEFRTGKTQLC  113 (316)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCcCHHH
Confidence            4566766643   344678999999998644


No 423
>KOG0344|consensus
Probab=27.72  E-value=28  Score=34.50  Aligned_cols=26  Identities=23%  Similarity=0.303  Sum_probs=18.3

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +.+-.++++-+  ++|.++||||||+.-
T Consensus       165 ~aipvfl~~r~--~lAcapTGsgKtlaf  190 (593)
T KOG0344|consen  165 QAIPVFLEKRD--VLACAPTGSGKTLAF  190 (593)
T ss_pred             hhhhhhhcccc--eEEeccCCCcchhhh
Confidence            33444555555  689999999998754


No 424
>PF05707 Zot:  Zonular occludens toxin (Zot);  InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophage present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers.; PDB: 2R2A_B.
Probab=27.65  E-value=23  Score=29.63  Aligned_cols=14  Identities=50%  Similarity=0.828  Sum_probs=9.7

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      +-.|..||||||.+
T Consensus         4 ~~~G~pGsGKS~~a   17 (193)
T PF05707_consen    4 LITGKPGSGKSYYA   17 (193)
T ss_dssp             EEE--TTSSHHHHH
T ss_pred             EEEcCCCCcHhHHH
Confidence            45699999999955


No 425
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=27.62  E-value=26  Score=31.21  Aligned_cols=15  Identities=40%  Similarity=0.572  Sum_probs=12.5

Q ss_pred             eEeeeeccCCCCcee
Q psy17370        175 CLFAYGQTGSGKSYR  189 (262)
Q Consensus       175 ~ifaYG~tgSGKTyT  189 (262)
                      .|+-.|..|||||+-
T Consensus         4 liil~G~pGSGKSTl   18 (300)
T PHA02530          4 IILTVGVPGSGKSTW   18 (300)
T ss_pred             EEEEEcCCCCCHHHH
Confidence            467789999999874


No 426
>KOG0742|consensus
Probab=27.55  E-value=28  Score=33.55  Aligned_cols=13  Identities=38%  Similarity=0.882  Sum_probs=11.7

Q ss_pred             eEeeeeccCCCCc
Q psy17370        175 CLFAYGQTGSGKS  187 (262)
Q Consensus       175 ~ifaYG~tgSGKT  187 (262)
                      -|+-||+.|+|||
T Consensus       386 NilfyGPPGTGKT  398 (630)
T KOG0742|consen  386 NILFYGPPGTGKT  398 (630)
T ss_pred             heeeeCCCCCCch
Confidence            4789999999997


No 427
>COG3587 Restriction endonuclease [Defense mechanisms]
Probab=27.55  E-value=36  Score=35.53  Aligned_cols=18  Identities=33%  Similarity=0.628  Sum_probs=14.0

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -.|+-|..  .||+|||||-
T Consensus        74 ~lNiDI~M--ETGTGKTy~Y   91 (985)
T COG3587          74 KLNIDILM--ETGTGKTYTY   91 (985)
T ss_pred             cceeeEEE--ecCCCceeeH
Confidence            45666766  8999999975


No 428
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=27.37  E-value=24  Score=30.27  Aligned_cols=13  Identities=46%  Similarity=0.478  Sum_probs=11.3

Q ss_pred             eeeccCCCCceec
Q psy17370        178 AYGQTGSGKSYRG  190 (262)
Q Consensus       178 aYG~tgSGKTyTm  190 (262)
                      -.|++|+|||..|
T Consensus        28 i~GpNGsGKStll   40 (243)
T cd03272          28 VVGRNGSGKSNFF   40 (243)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999876


No 429
>PRK06851 hypothetical protein; Provisional
Probab=27.37  E-value=42  Score=31.55  Aligned_cols=28  Identities=32%  Similarity=0.425  Sum_probs=21.9

Q ss_pred             hhHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .+.+.++++.+-.++--|..|+|||++|
T Consensus        20 s~~~~~~~~~~~~~il~G~pGtGKStl~   47 (367)
T PRK06851         20 SLYDSIIDGANRIFILKGGPGTGKSTLM   47 (367)
T ss_pred             hhhhhhccccceEEEEECCCCCCHHHHH
Confidence            3445566677777888899999999988


No 430
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]
Probab=27.34  E-value=42  Score=31.36  Aligned_cols=31  Identities=32%  Similarity=0.476  Sum_probs=21.7

Q ss_pred             ccchhhHhhhh-CCCceeEeeeeccCCCCceecC
Q psy17370        159 IIAQPLLDAAF-NGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       159 ~~~~plv~~~l-~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      +..-.+|+.++ +|+.  .|-||..|.|||+-+.
T Consensus        76 s~~P~lId~~fr~g~~--~~~~gdsg~GKttllL  107 (402)
T COG3598          76 SNSPQLIDEFFRKGYV--SILYGDSGVGKTTLLL  107 (402)
T ss_pred             ccChhhhhHHhhcCee--EEEecCCcccHhHHHH
Confidence            33446666665 4664  4679999999998653


No 431
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=27.34  E-value=23  Score=34.70  Aligned_cols=22  Identities=23%  Similarity=0.262  Sum_probs=16.4

Q ss_pred             hCCC-ceeEeeeeccCCCCceec
Q psy17370        169 FNGY-NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       169 l~G~-n~~ifaYG~tgSGKTyTm  190 (262)
                      ..|. .-.++-||+.|+|||.+.
T Consensus        38 ~~~ri~~a~Lf~Gp~G~GKTT~A   60 (507)
T PRK06645         38 LNDRLAGGYLLTGIRGVGKTTSA   60 (507)
T ss_pred             HcCCCCceEEEECCCCCCHHHHH
Confidence            3443 246788999999999865


No 432
>PHA02774 E1; Provisional
Probab=27.26  E-value=33  Score=34.33  Aligned_cols=25  Identities=36%  Similarity=0.647  Sum_probs=18.6

Q ss_pred             HhhhhCCC--ceeEeeeeccCCCCcee
Q psy17370        165 LDAAFNGY--NVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       165 v~~~l~G~--n~~ifaYG~tgSGKTyT  189 (262)
                      +..++.|.  ..|++-||+.|+||||-
T Consensus       424 lk~~l~~~PKknciv~~GPP~TGKS~f  450 (613)
T PHA02774        424 LKDFLKGIPKKNCLVIYGPPDTGKSMF  450 (613)
T ss_pred             HHHHHhcCCcccEEEEECCCCCCHHHH
Confidence            34455553  35889999999999984


No 433
>PRK00279 adk adenylate kinase; Reviewed
Probab=27.26  E-value=28  Score=29.56  Aligned_cols=13  Identities=38%  Similarity=0.675  Sum_probs=11.7

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      |+-+|..|||||.
T Consensus         3 I~v~G~pGsGKsT   15 (215)
T PRK00279          3 LILLGPPGAGKGT   15 (215)
T ss_pred             EEEECCCCCCHHH
Confidence            6789999999986


No 434
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=27.24  E-value=24  Score=28.67  Aligned_cols=15  Identities=27%  Similarity=0.508  Sum_probs=11.9

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      +.-.|..|+|||.+.
T Consensus         3 ~~~~G~~G~GKTt~~   17 (173)
T cd03115           3 ILLVGLQGVGKTTTA   17 (173)
T ss_pred             EEEECCCCCCHHHHH
Confidence            344599999999875


No 435
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=27.16  E-value=29  Score=28.72  Aligned_cols=15  Identities=33%  Similarity=0.523  Sum_probs=12.0

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|++|||||..+
T Consensus         5 i~l~G~sGsGKsTl~   19 (186)
T PRK10078          5 IWLMGPSGSGKDSLL   19 (186)
T ss_pred             EEEECCCCCCHHHHH
Confidence            455799999999854


No 436
>TIGR00959 ffh signal recognition particle protein. This model represents Ffh (Fifty-Four Homolog), the protein component that forms the bacterial (and organellar) signal recognition particle together with a 4.5S RNA. Ffh is a GTPase homologous to eukaryotic SRP54 and also to the GTPase FtsY (TIGR00064) that is the receptor for the signal recognition particle.
Probab=27.09  E-value=29  Score=33.31  Aligned_cols=18  Identities=28%  Similarity=0.429  Sum_probs=14.7

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      -..++..|.+|+|||.|.
T Consensus        99 p~vi~~vG~~GsGKTTta  116 (428)
T TIGR00959        99 PTVILMVGLQGSGKTTTC  116 (428)
T ss_pred             CEEEEEECCCCCcHHHHH
Confidence            346777799999999885


No 437
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=27.02  E-value=21  Score=32.31  Aligned_cols=16  Identities=31%  Similarity=0.409  Sum_probs=13.7

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|.+|||||..+
T Consensus         8 ~i~i~G~~GsGKtt~~   23 (288)
T PRK05416          8 LVIVTGLSGAGKSVAL   23 (288)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            4677899999999877


No 438
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=27.02  E-value=21  Score=29.43  Aligned_cols=12  Identities=50%  Similarity=0.523  Sum_probs=0.0

Q ss_pred             eeccCCCCceec
Q psy17370        179 YGQTGSGKSYRG  190 (262)
Q Consensus       179 YG~tgSGKTyTm  190 (262)
                      +|..|||||.-+
T Consensus         5 iG~N~sGKS~il   16 (303)
T PF13304_consen    5 IGPNGSGKSNIL   16 (303)
T ss_dssp             ------------
T ss_pred             cccccccccccc
Confidence            699999999876


No 439
>PRK13946 shikimate kinase; Provisional
Probab=26.92  E-value=26  Score=28.98  Aligned_cols=16  Identities=38%  Similarity=0.540  Sum_probs=13.5

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|..|||||..-
T Consensus        12 ~I~l~G~~GsGKsti~   27 (184)
T PRK13946         12 TVVLVGLMGAGKSTVG   27 (184)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            5888899999999843


No 440
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU). CobU is bifunctional cobalbumin biosynthesis enzymes which display adenosylcobinamide kinase and adenosylcobinamide phosphate guanyltransferase activity. This enzyme is a homotrimer with a propeller-like shape.
Probab=26.77  E-value=29  Score=28.73  Aligned_cols=13  Identities=38%  Similarity=0.529  Sum_probs=11.0

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      +|-.|.+|||||.
T Consensus         2 ~li~G~~~sGKS~   14 (169)
T cd00544           2 ILVTGGARSGKSR   14 (169)
T ss_pred             EEEECCCCCCHHH
Confidence            5678999999975


No 441
>KOG0735|consensus
Probab=26.77  E-value=26  Score=35.95  Aligned_cols=17  Identities=29%  Similarity=0.632  Sum_probs=14.2

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      .-|+-||+.|+||||-.
T Consensus       702 ~giLLyGppGcGKT~la  718 (952)
T KOG0735|consen  702 TGILLYGPPGCGKTLLA  718 (952)
T ss_pred             cceEEECCCCCcHHHHH
Confidence            44789999999999954


No 442
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=26.71  E-value=27  Score=35.70  Aligned_cols=16  Identities=25%  Similarity=0.623  Sum_probs=13.0

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-||+.|+|||+..
T Consensus       489 giLL~GppGtGKT~la  504 (733)
T TIGR01243       489 GVLLFGPPGTGKTLLA  504 (733)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3666999999999854


No 443
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=26.68  E-value=20  Score=32.17  Aligned_cols=17  Identities=29%  Similarity=0.313  Sum_probs=14.2

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      -.+.-+|++|+|||.++
T Consensus        76 ~~i~~~G~~g~GKTtl~   92 (270)
T PRK06731         76 QTIALIGPTGVGKTTTL   92 (270)
T ss_pred             CEEEEECCCCCcHHHHH
Confidence            45677899999999976


No 444
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=26.66  E-value=32  Score=26.43  Aligned_cols=15  Identities=40%  Similarity=0.375  Sum_probs=11.7

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      +.-.|.+|||||.-+
T Consensus        14 ~~i~G~nGsGKStLl   28 (137)
T PF00005_consen   14 VAIVGPNGSGKSTLL   28 (137)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEEccCCCccccce
Confidence            345699999999854


No 445
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=26.56  E-value=28  Score=33.42  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.1

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      ...|.-.|.+|+|||.|.
T Consensus       100 ~~vi~lvG~~GvGKTTta  117 (429)
T TIGR01425       100 QNVIMFVGLQGSGKTTTC  117 (429)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            456777899999999987


No 446
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=26.56  E-value=26  Score=30.52  Aligned_cols=15  Identities=33%  Similarity=0.417  Sum_probs=12.4

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|..|||||+..
T Consensus         2 Ivl~G~pGSGKST~a   16 (249)
T TIGR03574         2 IILTGLPGVGKSTFS   16 (249)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            567799999999855


No 447
>PLN02165 adenylate isopentenyltransferase
Probab=26.55  E-value=27  Score=32.39  Aligned_cols=16  Identities=44%  Similarity=0.563  Sum_probs=12.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|+||||||...
T Consensus        45 iivIiGPTGSGKStLA   60 (334)
T PLN02165         45 VVVIMGATGSGKSRLS   60 (334)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            3455799999999754


No 448
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=26.40  E-value=27  Score=28.18  Aligned_cols=16  Identities=44%  Similarity=0.677  Sum_probs=12.6

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|..|||||+.-
T Consensus         4 ~i~~~G~~GsGKst~~   19 (171)
T PRK03731          4 PLFLVGARGCGKTTVG   19 (171)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3666799999999853


No 449
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB. This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.
Probab=26.39  E-value=22  Score=28.86  Aligned_cols=13  Identities=31%  Similarity=0.256  Sum_probs=10.5

Q ss_pred             eeeccCCCCceec
Q psy17370        178 AYGQTGSGKSYRG  190 (262)
Q Consensus       178 aYG~tgSGKTyTm  190 (262)
                      -.|.+|||||..+
T Consensus         4 i~G~~gsGKTtl~   16 (155)
T TIGR00176         4 IVGPKNSGKTTLI   16 (155)
T ss_pred             EECCCCCCHHHHH
Confidence            3499999999865


No 450
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=26.10  E-value=27  Score=30.86  Aligned_cols=19  Identities=32%  Similarity=0.593  Sum_probs=15.6

Q ss_pred             CceeEeeeeccCCCCceec
Q psy17370        172 YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       172 ~n~~ifaYG~tgSGKTyTm  190 (262)
                      ....|.-.|.+|+||+.++
T Consensus        30 ~~~~IllvG~tGvGKSSli   48 (249)
T cd01853          30 FSLTILVLGKTGVGKSSTI   48 (249)
T ss_pred             CCeEEEEECCCCCcHHHHH
Confidence            4456788999999999975


No 451
>KOG0922|consensus
Probab=26.05  E-value=37  Score=34.26  Aligned_cols=18  Identities=50%  Similarity=0.619  Sum_probs=13.7

Q ss_pred             ceeEeeeeccCCCCceec
Q psy17370        173 NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       173 n~~ifaYG~tgSGKTyTm  190 (262)
                      |..+.--|.||||||.-+
T Consensus        66 nqvlIviGeTGsGKSTQi   83 (674)
T KOG0922|consen   66 NQVLIVIGETGSGKSTQI   83 (674)
T ss_pred             CCEEEEEcCCCCCccccH
Confidence            444556699999999766


No 452
>PRK00254 ski2-like helicase; Provisional
Probab=26.03  E-value=30  Score=35.28  Aligned_cols=21  Identities=33%  Similarity=0.401  Sum_probs=16.1

Q ss_pred             hhCCCceeEeeeeccCCCCceec
Q psy17370        168 AFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       168 ~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +++|.|+.+  ..+||||||..-
T Consensus        36 ~~~g~nvlv--~apTGsGKT~~~   56 (720)
T PRK00254         36 VLEGKNLVL--AIPTASGKTLVA   56 (720)
T ss_pred             HhCCCcEEE--ECCCCcHHHHHH
Confidence            578888654  459999999854


No 453
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=25.99  E-value=36  Score=35.63  Aligned_cols=17  Identities=24%  Similarity=0.409  Sum_probs=14.0

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      +.++-.|++|+|||+..
T Consensus       597 ~~~lf~Gp~GvGKT~lA  613 (852)
T TIGR03345       597 GVFLLVGPSGVGKTETA  613 (852)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            46778899999999854


No 454
>TIGR00618 sbcc exonuclease SbcC. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.88  E-value=61  Score=34.60  Aligned_cols=21  Identities=29%  Similarity=0.385  Sum_probs=14.8

Q ss_pred             eeEeeeeccCCCCce-------ecCCCC
Q psy17370        174 VCLFAYGQTGSGKSY-------RGDSTL  194 (262)
Q Consensus       174 ~~ifaYG~tgSGKTy-------Tm~G~~  194 (262)
                      +.+.-+|+||+|||.       .+||..
T Consensus        27 gl~~I~G~nGaGKSTildAI~~aL~G~~   54 (1042)
T TIGR00618        27 PIFLICGKTGAGKTTLLDAITYALYGKL   54 (1042)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHhcCCC
Confidence            344457999999964       557764


No 455
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional
Probab=25.87  E-value=24  Score=34.84  Aligned_cols=21  Identities=24%  Similarity=0.525  Sum_probs=17.1

Q ss_pred             hCCCceeEeeeeccCCCCcee
Q psy17370        169 FNGYNVCLFAYGQTGSGKSYR  189 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTyT  189 (262)
                      +...+..|+-+|.+|+||++.
T Consensus       238 ~A~s~~pVLI~GE~GTGKe~~  258 (538)
T PRK15424        238 YARSSAAVLIQGETGTGKELA  258 (538)
T ss_pred             HhCCCCcEEEECCCCCCHHHH
Confidence            346678899999999999763


No 456
>PHA02558 uvsW UvsW helicase; Provisional
Probab=25.84  E-value=40  Score=32.80  Aligned_cols=25  Identities=16%  Similarity=0.080  Sum_probs=17.8

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      .|..++.+.++  +...+||+|||.++
T Consensus       122 av~~~l~~~~~--il~apTGsGKT~i~  146 (501)
T PHA02558        122 AVYEGLKNNRR--LLNLPTSAGKSLIQ  146 (501)
T ss_pred             HHHHHHhcCce--EEEeCCCCCHHHHH
Confidence            34566676665  44679999999865


No 457
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
Probab=25.83  E-value=30  Score=36.08  Aligned_cols=17  Identities=24%  Similarity=0.161  Sum_probs=13.5

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      ..++..|+||||||..+
T Consensus        18 ~~vIi~a~TGSGKTT~v   34 (819)
T TIGR01970        18 PQVVLEAPPGAGKSTAV   34 (819)
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            35667899999999854


No 458
>PRK02496 adk adenylate kinase; Provisional
Probab=25.77  E-value=31  Score=28.32  Aligned_cols=14  Identities=36%  Similarity=0.636  Sum_probs=11.6

Q ss_pred             EeeeeccCCCCcee
Q psy17370        176 LFAYGQTGSGKSYR  189 (262)
Q Consensus       176 ifaYG~tgSGKTyT  189 (262)
                      |+-.|..|||||..
T Consensus         4 i~i~G~pGsGKst~   17 (184)
T PRK02496          4 LIFLGPPGAGKGTQ   17 (184)
T ss_pred             EEEECCCCCCHHHH
Confidence            56689999999874


No 459
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.
Probab=25.74  E-value=33  Score=35.27  Aligned_cols=26  Identities=19%  Similarity=0.203  Sum_probs=18.2

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      |..++.+.. .++-.|..|+||||+|-
T Consensus       361 v~~i~~s~~-~~il~G~aGTGKTtll~  386 (744)
T TIGR02768       361 VRHVTGSGD-IAVVVGRAGTGKSTMLK  386 (744)
T ss_pred             HHHHhcCCC-EEEEEecCCCCHHHHHH
Confidence            444555433 45567999999999884


No 460
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR. At least five distinct pathways exists for the catabolism of propionate by way of propionyl-CoA. Members of this family represent the transcriptional regulatory protein PrpR, whose gene is found in most cases divergently transcribed from an operon for the methylcitric acid cycle of propionate catabolism. 2-methylcitric acid, a catabolite by this pathway, is a coactivator of PrpR.
Probab=25.74  E-value=23  Score=34.93  Aligned_cols=22  Identities=18%  Similarity=0.502  Sum_probs=17.6

Q ss_pred             hCCCceeEeeeeccCCCCceec
Q psy17370        169 FNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       169 l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +...+..|+-+|.+|+||++..
T Consensus       231 ~A~~~~pVLI~GE~GTGKe~lA  252 (526)
T TIGR02329       231 YARSDATVLILGESGTGKELVA  252 (526)
T ss_pred             HhCCCCcEEEECCCCcCHHHHH
Confidence            3456788999999999997743


No 461
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=25.60  E-value=29  Score=28.69  Aligned_cols=16  Identities=44%  Similarity=0.652  Sum_probs=12.6

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .+.-.|.+|||||+.+
T Consensus         5 ~i~l~G~sGsGKSTl~   20 (176)
T PRK09825          5 SYILMGVSGSGKSLIG   20 (176)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3556899999999854


No 462
>PRK05480 uridine/cytidine kinase; Provisional
Probab=25.56  E-value=36  Score=28.57  Aligned_cols=16  Identities=31%  Similarity=0.362  Sum_probs=12.4

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|.--|.+|||||+..
T Consensus         8 iI~I~G~sGsGKTTl~   23 (209)
T PRK05480          8 IIGIAGGSGSGKTTVA   23 (209)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4555699999999754


No 463
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain. This model represents a clade within a larger family of proteins from viruses of bacteria and animals. Members of this family are found in phage and plasmids of bacteria and archaea only. The model describes a domain of about 300 residues, found generally toward the protein C-terminus.
Probab=25.49  E-value=21  Score=32.20  Aligned_cols=27  Identities=30%  Similarity=0.528  Sum_probs=18.9

Q ss_pred             hHhhhhCC---CceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNG---YNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G---~n~~ifaYG~tgSGKTyTm  190 (262)
                      ++..+|.|   ....++.||..|+||+..+
T Consensus        64 ~lg~~L~~~~~~~~~~~l~G~g~nGKStl~   93 (304)
T TIGR01613        64 VIGYSLTGNYTEQKLFFLYGNGGNGKSTFQ   93 (304)
T ss_pred             HHhHHhcCCCCceEEEEEECCCCCcHHHHH
Confidence            33444444   3567899999999998754


No 464
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated
Probab=25.49  E-value=31  Score=28.54  Aligned_cols=14  Identities=36%  Similarity=0.456  Sum_probs=11.9

Q ss_pred             eEeeeeccCCCCce
Q psy17370        175 CLFAYGQTGSGKSY  188 (262)
Q Consensus       175 ~ifaYG~tgSGKTy  188 (262)
                      .++-.|.+|||||.
T Consensus         3 ~ili~G~~~sGKS~   16 (170)
T PRK05800          3 LILVTGGARSGKSR   16 (170)
T ss_pred             EEEEECCCCccHHH
Confidence            36788999999975


No 465
>PRK05541 adenylylsulfate kinase; Provisional
Probab=25.46  E-value=32  Score=27.95  Aligned_cols=16  Identities=31%  Similarity=0.534  Sum_probs=12.7

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|..|||||...
T Consensus         9 ~I~i~G~~GsGKst~a   24 (176)
T PRK05541          9 VIWITGLAGSGKTTIA   24 (176)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            5666899999998754


No 466
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms.  SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes.  The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge.  SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=25.39  E-value=30  Score=28.74  Aligned_cols=14  Identities=43%  Similarity=0.392  Sum_probs=11.1

Q ss_pred             eeeeccCCCCceec
Q psy17370        177 FAYGQTGSGKSYRG  190 (262)
Q Consensus       177 faYG~tgSGKTyTm  190 (262)
                      +-+|.+|||||--+
T Consensus        26 ~i~G~NGsGKSnil   39 (178)
T cd03239          26 AIVGPNGSGKSNIV   39 (178)
T ss_pred             EEECCCCCCHHHHH
Confidence            46799999998644


No 467
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=25.12  E-value=32  Score=29.81  Aligned_cols=16  Identities=25%  Similarity=0.360  Sum_probs=13.7

Q ss_pred             eeEeeeeccCCCCcee
Q psy17370        174 VCLFAYGQTGSGKSYR  189 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyT  189 (262)
                      ..+.-+|.+|+|||..
T Consensus        25 ~~~~i~G~~G~GKTtl   40 (230)
T PRK08533         25 SLILIEGDESTGKSIL   40 (230)
T ss_pred             cEEEEECCCCCCHHHH
Confidence            3677889999999987


No 468
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=25.11  E-value=30  Score=28.37  Aligned_cols=16  Identities=31%  Similarity=0.401  Sum_probs=12.5

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      ..+-+|++|+|||+-+
T Consensus        34 l~~i~g~~g~GKT~~~   49 (193)
T PF13481_consen   34 LTLIAGPPGSGKTTLA   49 (193)
T ss_dssp             EEEEEECSTSSHHHHH
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            3456799999999855


No 469
>PRK14528 adenylate kinase; Provisional
Probab=25.11  E-value=30  Score=28.83  Aligned_cols=15  Identities=27%  Similarity=0.574  Sum_probs=12.3

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |+-.|..|||||...
T Consensus         4 i~i~G~pGsGKtt~a   18 (186)
T PRK14528          4 IIFMGPPGAGKGTQA   18 (186)
T ss_pred             EEEECCCCCCHHHHH
Confidence            677899999998753


No 470
>PLN02200 adenylate kinase family protein
Probab=25.08  E-value=31  Score=30.02  Aligned_cols=16  Identities=38%  Similarity=0.607  Sum_probs=13.5

Q ss_pred             eeEeeeeccCCCCcee
Q psy17370        174 VCLFAYGQTGSGKSYR  189 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyT  189 (262)
                      ..|+-.|..|||||.-
T Consensus        44 ~ii~I~G~PGSGKsT~   59 (234)
T PLN02200         44 FITFVLGGPGSGKGTQ   59 (234)
T ss_pred             EEEEEECCCCCCHHHH
Confidence            4678899999999874


No 471
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional
Probab=24.90  E-value=36  Score=32.07  Aligned_cols=26  Identities=19%  Similarity=0.259  Sum_probs=17.0

Q ss_pred             hHhhhhC-CCc-eeEeeeeccCCCCcee
Q psy17370        164 LLDAAFN-GYN-VCLFAYGQTGSGKSYR  189 (262)
Q Consensus       164 lv~~~l~-G~n-~~ifaYG~tgSGKTyT  189 (262)
                      .+...++ |.- -.++-||+.|+|||..
T Consensus        27 ~L~~~~~~~~~~ha~lf~Gp~G~GKtt~   54 (397)
T PRK14955         27 TIQNSLRMGRVGHGYIFSGLRGVGKTTA   54 (397)
T ss_pred             HHHHHHHhCCcceeEEEECCCCCCHHHH
Confidence            4445554 432 2366799999999964


No 472
>TIGR00763 lon ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock.
Probab=24.86  E-value=22  Score=36.67  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=13.1

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-||++|+|||+..
T Consensus       349 ~lll~GppG~GKT~lA  364 (775)
T TIGR00763       349 ILCLVGPPGVGKTSLG  364 (775)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4666999999999754


No 473
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional
Probab=24.82  E-value=28  Score=35.08  Aligned_cols=17  Identities=24%  Similarity=0.317  Sum_probs=14.1

Q ss_pred             eeEeeeeccCCCCceec
Q psy17370        174 VCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       174 ~~ifaYG~tgSGKTyTm  190 (262)
                      -.++-||..|+|||.+.
T Consensus        39 ha~Lf~Gp~GvGKTtlA   55 (618)
T PRK14951         39 HAYLFTGTRGVGKTTVS   55 (618)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            35688999999999865


No 474
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=24.73  E-value=34  Score=36.21  Aligned_cols=20  Identities=20%  Similarity=0.200  Sum_probs=14.7

Q ss_pred             CCceeEeeeeccCCCCceec
Q psy17370        171 GYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +...-++..|+||||||...
T Consensus       470 ~~~~d~Ll~adTGsGKT~va  489 (926)
T TIGR00580       470 PRPMDRLVCGDVGFGKTEVA  489 (926)
T ss_pred             cCcCCEEEECCCCccHHHHH
Confidence            33344678899999999754


No 475
>PRK13949 shikimate kinase; Provisional
Probab=24.70  E-value=33  Score=28.15  Aligned_cols=16  Identities=38%  Similarity=0.648  Sum_probs=13.0

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-.|+.|||||...
T Consensus         3 ~I~liG~~GsGKstl~   18 (169)
T PRK13949          3 RIFLVGYMGAGKTTLG   18 (169)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3778899999999743


No 476
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=24.68  E-value=32  Score=28.75  Aligned_cols=13  Identities=38%  Similarity=0.726  Sum_probs=10.6

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      |+-.|++||||+.
T Consensus         3 iiilG~pGaGK~T   15 (178)
T COG0563           3 ILILGPPGAGKST   15 (178)
T ss_pred             EEEECCCCCCHHH
Confidence            4567999999975


No 477
>PRK11823 DNA repair protein RadA; Provisional
Probab=24.63  E-value=46  Score=32.02  Aligned_cols=28  Identities=29%  Similarity=0.277  Sum_probs=20.9

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...++-+|..|+|||.-+
T Consensus        67 ~~LD~~LgGGi~~Gs~~lI~G~pG~GKTtL~   97 (446)
T PRK11823         67 GELDRVLGGGLVPGSVVLIGGDPGIGKSTLL   97 (446)
T ss_pred             HHHHHHhcCCccCCEEEEEECCCCCCHHHHH
Confidence            4566777643   556788999999999844


No 478
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]
Probab=24.53  E-value=39  Score=35.31  Aligned_cols=25  Identities=32%  Similarity=0.444  Sum_probs=16.6

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceec
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      |-.+++-..++|+ -|.||||||.-+
T Consensus        58 i~~ai~~~~vvii-~getGsGKTTql   82 (845)
T COG1643          58 ILKAIEQNQVVII-VGETGSGKTTQL   82 (845)
T ss_pred             HHHHHHhCCEEEE-eCCCCCChHHHH
Confidence            3444555555554 599999999754


No 479
>PRK04182 cytidylate kinase; Provisional
Probab=24.50  E-value=32  Score=27.64  Aligned_cols=13  Identities=38%  Similarity=0.580  Sum_probs=11.1

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      |+-.|..|||||.
T Consensus         3 I~i~G~~GsGKst   15 (180)
T PRK04182          3 ITISGPPGSGKTT   15 (180)
T ss_pred             EEEECCCCCCHHH
Confidence            5567999999987


No 480
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=24.39  E-value=48  Score=31.11  Aligned_cols=46  Identities=22%  Similarity=0.413  Sum_probs=25.8

Q ss_pred             ceeee-ec-eeeCCCCCcchhhcccchhhHhhhhCC---CceeEeeeeccCCCCce
Q psy17370        138 SYTFK-LD-HCLGQDTDQTSVFTIIAQPLLDAAFNG---YNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       138 ~~~f~-FD-~vf~~~~~q~~vy~~~~~plv~~~l~G---~n~~ifaYG~tgSGKTy  188 (262)
                      .+.|. |+ .+|+.    ++.-+..+. .+.....|   .+-.+.-.|+.|+|||.
T Consensus        43 ~~~y~~F~~~~~G~----~~~i~~lv~-~l~~~a~g~~~~r~il~L~GPPGsGKSt   93 (361)
T smart00763       43 IKRYRFFDHDFFGM----EEAIERFVN-YFKSAAQGLEERKQILYLLGPVGGGKSS   93 (361)
T ss_pred             eeeccccchhccCc----HHHHHHHHH-HHHHHHhcCCCCCcEEEEECCCCCCHHH
Confidence            35565 45 56654    444444342 23333333   34556777999999973


No 481
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=24.37  E-value=33  Score=28.02  Aligned_cols=15  Identities=27%  Similarity=0.366  Sum_probs=12.3

Q ss_pred             eEeeeeccCCCCcee
Q psy17370        175 CLFAYGQTGSGKSYR  189 (262)
Q Consensus       175 ~ifaYG~tgSGKTyT  189 (262)
                      .|+--|..|||||.-
T Consensus         4 ~i~l~G~~gsGKst~   18 (175)
T cd00227           4 IIILNGGSSAGKSSI   18 (175)
T ss_pred             EEEEECCCCCCHHHH
Confidence            467789999999864


No 482
>PRK07667 uridine kinase; Provisional
Probab=24.22  E-value=40  Score=28.16  Aligned_cols=18  Identities=28%  Similarity=0.176  Sum_probs=14.0

Q ss_pred             CCceeEeeeeccCCCCce
Q psy17370        171 GYNVCLFAYGQTGSGKSY  188 (262)
Q Consensus       171 G~n~~ifaYG~tgSGKTy  188 (262)
                      |.-.-|.-.|..|||||+
T Consensus        15 ~~~~iIgI~G~~gsGKSt   32 (193)
T PRK07667         15 ENRFILGIDGLSRSGKTT   32 (193)
T ss_pred             CCCEEEEEECCCCCCHHH
Confidence            444556667999999998


No 483
>KOG0328|consensus
Probab=24.14  E-value=55  Score=30.02  Aligned_cols=25  Identities=28%  Similarity=0.418  Sum_probs=19.5

Q ss_pred             hHhhhhCCCceeEeeeeccCCCCceec
Q psy17370        164 LLDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      -|..++.|.++  .|-.|+|+|||-|.
T Consensus        57 Ai~~IlkGrdV--iaQaqSGTGKTa~~   81 (400)
T KOG0328|consen   57 AIPQILKGRDV--IAQAQSGTGKTATF   81 (400)
T ss_pred             hhhhhhcccce--EEEecCCCCceEEE
Confidence            35567899986  56669999998776


No 484
>PRK13909 putative recombination protein RecB; Provisional
Probab=23.94  E-value=22  Score=37.34  Aligned_cols=11  Identities=36%  Similarity=0.652  Sum_probs=8.7

Q ss_pred             ccCCCCceecC
Q psy17370        181 QTGSGKSYRGD  191 (262)
Q Consensus       181 ~tgSGKTyTm~  191 (262)
                      .-||||||||.
T Consensus         6 sAGsGKT~~L~   16 (910)
T PRK13909          6 SAGSGKTFALS   16 (910)
T ss_pred             CCCCchhHHHH
Confidence            45899999883


No 485
>CHL00176 ftsH cell division protein; Validated
Probab=23.93  E-value=31  Score=34.87  Aligned_cols=16  Identities=25%  Similarity=0.495  Sum_probs=13.9

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .|+-||+.|+|||+..
T Consensus       218 gVLL~GPpGTGKT~LA  233 (638)
T CHL00176        218 GVLLVGPPGTGKTLLA  233 (638)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4788999999999865


No 486
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=23.93  E-value=36  Score=28.68  Aligned_cols=14  Identities=36%  Similarity=0.638  Sum_probs=10.7

Q ss_pred             eEeeeeccCCCCce
Q psy17370        175 CLFAYGQTGSGKSY  188 (262)
Q Consensus       175 ~ifaYG~tgSGKTy  188 (262)
                      +|+=.|+.|||||.
T Consensus         5 ~vlL~Gps~SGKTa   18 (181)
T PF09439_consen    5 TVLLVGPSGSGKTA   18 (181)
T ss_dssp             EEEEE-STTSSHHH
T ss_pred             eEEEEcCCCCCHHH
Confidence            56667999999986


No 487
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=23.92  E-value=30  Score=33.30  Aligned_cols=15  Identities=33%  Similarity=0.512  Sum_probs=13.2

Q ss_pred             eeEeeeeccCCCCce
Q psy17370        174 VCLFAYGQTGSGKSY  188 (262)
Q Consensus       174 ~~ifaYG~tgSGKTy  188 (262)
                      ..|+-+|++|+|||.
T Consensus        51 ~~ILliGp~G~GKT~   65 (443)
T PRK05201         51 KNILMIGPTGVGKTE   65 (443)
T ss_pred             ceEEEECCCCCCHHH
Confidence            568899999999985


No 488
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=23.91  E-value=34  Score=26.66  Aligned_cols=15  Identities=33%  Similarity=0.428  Sum_probs=11.9

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.-+|..|+|||.-+
T Consensus         3 i~~~G~~~~GKTsl~   17 (164)
T cd04139           3 VIVVGAGGVGKSALT   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            556899999999743


No 489
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional
Probab=23.86  E-value=32  Score=33.66  Aligned_cols=27  Identities=26%  Similarity=0.373  Sum_probs=18.4

Q ss_pred             hHhhhh-CCCce-eEeeeeccCCCCceec
Q psy17370        164 LLDAAF-NGYNV-CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       164 lv~~~l-~G~n~-~ifaYG~tgSGKTyTm  190 (262)
                      .+..++ .|.-. .++-||..|+|||.+.
T Consensus        24 ~L~~a~~~~ri~ha~Lf~Gp~G~GKTT~A   52 (491)
T PRK14964         24 ILRNAFTLNKIPQSILLVGASGVGKTTCA   52 (491)
T ss_pred             HHHHHHHcCCCCceEEEECCCCccHHHHH
Confidence            344444 35433 6888999999999843


No 490
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=23.85  E-value=52  Score=30.31  Aligned_cols=29  Identities=31%  Similarity=0.398  Sum_probs=21.4

Q ss_pred             hhhHhhhhC--CC--ceeEeeeeccCCCCceec
Q psy17370        162 QPLLDAAFN--GY--NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~~l~--G~--n~~ifaYG~tgSGKTyTm  190 (262)
                      .+-++.+|.  |+  ...+.-||+.|||||.-.
T Consensus        40 i~~LD~~Lg~GGlp~G~iteI~G~~GsGKTtLa   72 (321)
T TIGR02012        40 SLSLDLALGVGGLPRGRIIEIYGPESSGKTTLA   72 (321)
T ss_pred             CHHHHHHhcCCCCcCCeEEEEECCCCCCHHHHH
Confidence            366777886  44  345778999999999753


No 491
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional
Probab=23.69  E-value=31  Score=33.64  Aligned_cols=16  Identities=25%  Similarity=0.493  Sum_probs=13.7

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      .++-||+.|+|||.+.
T Consensus        42 a~Lf~GP~GtGKTTlA   57 (484)
T PRK14956         42 AYIFFGPRGVGKTTIA   57 (484)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            5788999999999755


No 492
>PF13166 AAA_13:  AAA domain
Probab=23.68  E-value=40  Score=34.05  Aligned_cols=13  Identities=54%  Similarity=0.859  Sum_probs=11.3

Q ss_pred             EeeeeccCCCCce
Q psy17370        176 LFAYGQTGSGKSY  188 (262)
Q Consensus       176 ifaYG~tgSGKTy  188 (262)
                      -+-||..|||||.
T Consensus        19 n~IYG~NGsGKSt   31 (712)
T PF13166_consen   19 NLIYGRNGSGKST   31 (712)
T ss_pred             EEEECCCCCCHHH
Confidence            4679999999986


No 493
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=23.66  E-value=40  Score=26.40  Aligned_cols=16  Identities=31%  Similarity=0.275  Sum_probs=13.0

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      -|...|..|+|||.-+
T Consensus         3 ki~v~G~~~~GKSsli   18 (163)
T cd01860           3 KLVLLGDSSVGKSSLV   18 (163)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4667899999999754


No 494
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=23.61  E-value=24  Score=32.60  Aligned_cols=13  Identities=38%  Similarity=0.460  Sum_probs=11.1

Q ss_pred             eeeccCCCCceec
Q psy17370        178 AYGQTGSGKSYRG  190 (262)
Q Consensus       178 aYG~tgSGKTyTm  190 (262)
                      -+|++|||||..+
T Consensus        33 LlGpSGaGKsTlL   45 (345)
T COG1118          33 LLGPSGAGKSTLL   45 (345)
T ss_pred             EECCCCCcHHHHH
Confidence            3799999999865


No 495
>PLN03186 DNA repair protein RAD51 homolog; Provisional
Probab=23.60  E-value=63  Score=30.01  Aligned_cols=29  Identities=24%  Similarity=0.250  Sum_probs=20.6

Q ss_pred             hhhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        162 QPLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       162 ~plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      .+-++.+|.|.   ...+.-||..|+|||.-+
T Consensus       109 ~~~LD~lL~GG~~~g~i~~i~G~~g~GKT~l~  140 (342)
T PLN03186        109 SRELDKILEGGIETGSITEIYGEFRTGKTQLC  140 (342)
T ss_pred             CHHHHHhhcCCCcCceEEEEECCCCCCccHHH
Confidence            35567777653   334668999999999743


No 496
>PF03969 AFG1_ATPase:  AFG1-like ATPase;  InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP. AFG1 also has substantial homology to these proteins outside the ATPase domain []. This family of proteins contains a P-loop motif.; GO: 0005524 ATP binding
Probab=23.59  E-value=31  Score=32.33  Aligned_cols=16  Identities=31%  Similarity=0.588  Sum_probs=14.1

Q ss_pred             eEeeeeccCCCCceec
Q psy17370        175 CLFAYGQTGSGKSYRG  190 (262)
Q Consensus       175 ~ifaYG~tgSGKTyTm  190 (262)
                      -|.-||.-|.|||+-|
T Consensus        64 GlYl~G~vG~GKT~Lm   79 (362)
T PF03969_consen   64 GLYLWGPVGRGKTMLM   79 (362)
T ss_pred             eEEEECCCCCchhHHH
Confidence            3678999999999988


No 497
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=23.56  E-value=41  Score=31.62  Aligned_cols=28  Identities=29%  Similarity=0.302  Sum_probs=20.3

Q ss_pred             hhHhhhhCCC---ceeEeeeeccCCCCceec
Q psy17370        163 PLLDAAFNGY---NVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       163 plv~~~l~G~---n~~ifaYG~tgSGKTyTm  190 (262)
                      +-++.+|.|.   ...++-+|..|+|||.-+
T Consensus        69 ~eLD~vLgGGi~~GslvLI~G~pG~GKStLl   99 (372)
T cd01121          69 EELDRVLGGGLVPGSVILIGGDPGIGKSTLL   99 (372)
T ss_pred             HHHHHhhcCCccCCeEEEEEeCCCCCHHHHH
Confidence            4455666542   456788999999999865


No 498
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit. This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.
Probab=23.46  E-value=28  Score=34.75  Aligned_cols=24  Identities=21%  Similarity=0.277  Sum_probs=16.3

Q ss_pred             HhhhhCCCceeEeeeeccCCCCceec
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRG  190 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm  190 (262)
                      +..++..  ..++-.|..|+|||||+
T Consensus       154 ~~~al~~--~~~vitGgpGTGKTt~v  177 (586)
T TIGR01447       154 VALALKS--NFSLITGGPGTGKTTTV  177 (586)
T ss_pred             HHHHhhC--CeEEEEcCCCCCHHHHH
Confidence            3445553  33445689999999986


No 499
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=23.44  E-value=35  Score=34.93  Aligned_cols=40  Identities=10%  Similarity=0.104  Sum_probs=24.5

Q ss_pred             CCCCCcchhhcccchhhHhhhhCCCceeEeeeeccCCCCceecC
Q psy17370        148 GQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGD  191 (262)
Q Consensus       148 ~~~~~q~~vy~~~~~plv~~~l~G~n~~ifaYG~tgSGKTyTm~  191 (262)
                      ++-..|++..+    .+++-+..+....++-||..|+|||....
T Consensus       182 ~~~igr~~ei~----~~~~~L~~~~~~n~lL~G~pG~GKT~l~~  221 (731)
T TIGR02639       182 DPLIGREDELE----RTIQVLCRRKKNNPLLVGEPGVGKTAIAE  221 (731)
T ss_pred             CcccCcHHHHH----HHHHHHhcCCCCceEEECCCCCCHHHHHH
Confidence            34444544443    34443444444456789999999999774


No 500
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.
Probab=23.40  E-value=32  Score=28.32  Aligned_cols=15  Identities=40%  Similarity=0.377  Sum_probs=11.8

Q ss_pred             EeeeeccCCCCceec
Q psy17370        176 LFAYGQTGSGKSYRG  190 (262)
Q Consensus       176 ifaYG~tgSGKTyTm  190 (262)
                      |.-.|..|||||+-.
T Consensus         2 i~itG~~gsGKst~~   16 (179)
T cd02022           2 IGLTGGIGSGKSTVA   16 (179)
T ss_pred             EEEECCCCCCHHHHH
Confidence            456799999998743


Done!