Query         psy17374
Match_columns 71
No_of_seqs    117 out of 657
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:50:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17374.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17374hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03028 Dynein_heavy:  Dynein   99.8 6.7E-20 1.4E-24  137.0   5.3   67    3-71    519-586 (707)
  2 PF03822 NAF:  NAF domain;  Int  43.2     7.4 0.00016   21.5  -0.1   12   47-58     14-25  (63)
  3 PF04062 P21-Arc:  ARP2/3 compl  36.4 1.1E+02  0.0024   20.2   4.5   23   48-70    111-143 (175)
  4 cd08871 START_STARD10-like Lip  36.1      48   0.001   21.6   2.9   38    3-41    172-209 (222)
  5 PF12249 AftA_C:  Arabinofurano  34.6      77  0.0017   21.0   3.6   17   25-41     82-98  (178)
  6 PF09396 Thrombin_light:  Throm  26.1      35 0.00076   18.0   0.7    8   54-61      8-15  (49)
  7 PF03490 Varsurf_PPLC:  Variant  26.0      54  0.0012   17.4   1.5   15   20-34      7-21  (51)
  8 cd08868 START_STARD1_3_like Ch  25.3      39 0.00085   21.8   1.1   31    3-34    177-207 (208)
  9 cd00291 SirA_YedF_YeeD SirA, Y  25.1      66  0.0014   16.7   1.8   19   49-67      1-19  (69)
 10 cd08867 START_STARD4_5_6-like   24.9      59  0.0013   20.9   1.8   29    3-32    177-205 (206)
 11 cd07561 Peptidase_S41_CPP_like  24.3 1.1E+02  0.0023   20.8   3.1   39   21-66      9-47  (256)
 12 PF13817 DDE_Tnp_IS66_C:  IS66   23.9      88  0.0019   15.4   2.0   15   20-34     12-26  (39)
 13 PF01206 TusA:  Sulfurtransfera  22.4      87  0.0019   16.5   1.9   18   49-66      2-19  (70)
 14 cd08818 CARD_MDA5_1 Caspase ac  21.9      64  0.0014   19.0   1.4   17   50-68     63-79  (88)
 15 cd03421 SirA_like_N SirA_like_  21.9      89  0.0019   16.4   1.9   18   50-67      2-19  (67)
 16 KOG2099|consensus               21.8      94   0.002   24.8   2.6   15    4-18    486-500 (843)
 17 TIGR02115 potass_kdpF K+-trans  21.7      26 0.00057   16.1  -0.2    9   54-62     17-25  (26)
 18 PF05209 MinC_N:  Septum format  21.4 1.6E+02  0.0034   16.9   3.0   44   20-68     24-67  (99)
 19 PF06868 DUF1257:  Protein of u  21.3      78  0.0017   18.9   1.7   15   56-70     62-76  (105)
 20 PF12392 DUF3656:  Collagenase   20.8      74  0.0016   18.9   1.6   22   48-69     88-110 (122)

No 1  
>PF03028 Dynein_heavy:  Dynein heavy chain and region D6 of dynein motor;  InterPro: IPR004273 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.  Dynein is composed of a number of ATP-binding large subunits, intermediate size subunits and small subunits (see IPR001372 from INTERPRO). This family represents the C-terminal region of dynein heavy chain. The dynein heavy chain also exhibits ATPase activity and microtubule binding ability and acts as a motor for the movement of organelles and vesicles along microtubules. ; GO: 0003777 microtubule motor activity, 0007018 microtubule-based movement, 0030286 dynein complex; PDB: 3VKG_A 3VKH_C 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=99.79  E-value=6.7e-20  Score=137.00  Aligned_cols=67  Identities=24%  Similarity=0.383  Sum_probs=46.9

Q ss_pred             CCCCCchhhhhhcc-CCCChHHHHHHHHHHHHHHHHHHhhcCCCCCCceecCCCcchhHHHHHHHHHhcC
Q psy17374          3 PNDYTPDDWQSIWS-GSGNPLLYIRSVVSRAVMVHKCYQVSSTYWRSPVDLSGLFHPHAFLSVLKQHTAR   71 (71)
Q Consensus         3 ~~~~vP~~W~~~~~-~~~~~~~w~~~l~~R~~~l~~w~~~~~~~~~~~~wLs~lF~P~~FLtA~~Q~~AR   71 (71)
                      ..|+||..|.+.++ +++.+.+|++||++|++++++|.+..+  .|.+|||||||||++||||+||++||
T Consensus       519 ~~~~VP~~W~~~~~~s~~~l~~Wl~dL~~Rv~~l~~w~~~~~--~p~~~wLs~ff~P~aFLtAlrQ~~AR  586 (707)
T PF03028_consen  519 LKGQVPKSWLRYSYPSPKPLSSWLQDLIKRVEQLQRWASNSG--QPKSFWLSGFFNPQAFLTALRQEYAR  586 (707)
T ss_dssp             HHTS--GGG--S---SS--HHHHHHHHHHHHHHHHHHHH---------B-GGGSS-HHHHHHHHHHHHHH
T ss_pred             HhCCCChhHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHhccC--CceEEecccccChHHHHHHHHHHHHH
Confidence            46899999998644 567779999999999999999998622  47999999999999999999999997


No 2  
>PF03822 NAF:  NAF domain;  InterPro: IPR004041 The NAF domain is a 24 amino acid domain that is found in a plant-specific subgroup of serine-threonine protein kinases (CIPKs), that interact with calcineurin B-like calcium sensor proteins (CBLs). Whereas the N-terminal part of CIPKs comprises a conserved catalytic domain typical of Ser-Thr kinases, the much less conserved C-terminal domain appears to be unique to this subgroup of kinases. The only exception is the NAF domain that forms an 'island of conservation' in this otherwise variable region. The NAF domain has been named after the prominent conserved amino acids Asn-Ala-Phe. It represents a minimum protein interaction module that is both necessary and sufficient to mediate the interaction with the CBL calcium sensor proteins []. The secondary structure of the NAF domain is currently not known, but secondary structure computation of the C-terminal region of Arabidopsis thaliana CBL-interacting protein kinase 1 revealed a long helical structure [].; GO: 0007165 signal transduction; PDB: 2ZFD_B 2EHB_D.
Probab=43.23  E-value=7.4  Score=21.46  Aligned_cols=12  Identities=58%  Similarity=0.802  Sum_probs=10.0

Q ss_pred             CCceecCCCcch
Q psy17374         47 RSPVDLSGLFHP   58 (71)
Q Consensus        47 ~~~~wLs~lF~P   58 (71)
                      +..+||||||--
T Consensus        14 S~G~DLSgLFe~   25 (63)
T PF03822_consen   14 SSGFDLSGLFEE   25 (63)
T ss_dssp             STTTSCGGGGGC
T ss_pred             ccCCChHHhcCc
Confidence            578999999954


No 3  
>PF04062 P21-Arc:  ARP2/3 complex ARPC3 (21 kDa) subunit;  InterPro: IPR007204 The Arp2/3 complex is a seven-protein assembly that is critical for actin nucleation and branching in cells. Arp2/3 nucleates new actin filaments while bound to existing filaments, thus creating a branched network []. The complex consists of Arp2, Arp3, p41, p34, p21, p20 and p16. Subunits p34 and p20 constitute the core of the structure, with the remaining subunits located peripherally []. This entry describes the p21 subunit. Proteins such as WASp and Scar1 may mediate receptor signalling through interactions with p21-Arc, resulting in the activation of Arc2/3 complex activity [].; GO: 0030833 regulation of actin filament polymerization, 0005856 cytoskeleton; PDB: 3DWL_J 2P9P_E 2P9N_E 2P9K_E 1TYQ_E 1U2V_E 3RSE_E 2P9U_E 3DXM_E 2P9S_E ....
Probab=36.41  E-value=1.1e+02  Score=20.21  Aligned_cols=23  Identities=22%  Similarity=0.431  Sum_probs=17.5

Q ss_pred             CceecCCCcch----------hHHHHHHHHHhc
Q psy17374         48 SPVDLSGLFHP----------HAFLSVLKQHTA   70 (71)
Q Consensus        48 ~~~wLs~lF~P----------~~FLtA~~Q~~A   70 (71)
                      ..|-|+++|-+          .+||+.+||+++
T Consensus       111 ~gFpLn~~y~~P~~~~e~d~lR~Yl~QlRqElg  143 (175)
T PF04062_consen  111 PGFPLNSLYAKPANRQEADLLRQYLTQLRQELG  143 (175)
T ss_dssp             TT-TTTTTS---SSHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCCccccccCCCChhHHHHHHHHHHHHHHHHH
Confidence            67899999995          369999999986


No 4  
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins. This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD10 (also known as CGI-52, PTCP-like, and SDCCAG28). The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD10 binds phophatidylcholine and phosphatidylethanolamine. This protein is widely expressed and is synthesized constitutively in many organs. It may function in the liver in the export of phospholipids into bile. It is concentrated in the sperm flagellum, and may play a role in energy metabolism. In the mammary gland it may participate in the enrichment of lipids in milk, and be a potential marker of differentiation. Its expression is induced in this gland during gestation and lactation. It is overe
Probab=36.06  E-value=48  Score=21.61  Aligned_cols=38  Identities=11%  Similarity=0.111  Sum_probs=27.6

Q ss_pred             CCCCCchhhhhhccCCCChHHHHHHHHHHHHHHHHHHhh
Q psy17374          3 PNDYTPDDWQSIWSGSGNPLLYIRSVVSRAVMVHKCYQV   41 (71)
Q Consensus         3 ~~~~vP~~W~~~~~~~~~~~~w~~~l~~R~~~l~~w~~~   41 (71)
                      +.|.+|. |.-.+-....+..++.+|.+-++.+.+|...
T Consensus       172 p~G~IP~-~lvN~~~~~~~~~~l~~l~k~~~~y~~~~~~  209 (222)
T cd08871         172 PKGSLPK-WVVNKATTKLAPKVMKKLHKAALKYPEWKAK  209 (222)
T ss_pred             CCCCcCH-HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHh
Confidence            5677887 4332332334578999999999999999876


No 5  
>PF12249 AftA_C:  Arabinofuranosyltransferase A C terminal;  InterPro: IPR020959 The arabinofuranosyltransferase enzyme AftA is involved in cell wall arabinan biosynthesis in bacteria []. It catalyses the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. As this enzyme is important for cell growth and is found in some important pathogens, such as Mycobacterium tuberculosis, it represents a potential target for the devlopment of new antibacterial drugs. This entry represents the C-terminal domain of AftA.; GO: 0016757 transferase activity, transferring glycosyl groups, 0044038 cell wall macromolecule biosynthetic process, 0005886 plasma membrane, 0016021 integral to membrane
Probab=34.65  E-value=77  Score=21.01  Aligned_cols=17  Identities=6%  Similarity=0.130  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHhh
Q psy17374         25 IRSVVSRAVMVHKCYQV   41 (71)
Q Consensus        25 ~~~l~~R~~~l~~w~~~   41 (71)
                      +.++-+|.+++++|.+.
T Consensus        82 LaeF~~R~~~Ie~Ws~~   98 (178)
T PF12249_consen   82 LAEFDERNAEIESWSEL   98 (178)
T ss_pred             hhhHHHHHHHHHHHhcc
Confidence            56678999999999774


No 6  
>PF09396 Thrombin_light:  Thrombin light chain;  InterPro: IPR018992 Thrombin is a Na+-activated, allosteric serine protease that functions in blood homeostasis, inflammation and wound healing []. Thrombin (or coagulation factor II) is an enzyme that cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, and (in complex with thrombomodulin) protein C []. Sodium binding is the major driving force behind the procoagulant, prothrombotic and signaling functions of the enzyme, but is dispensable for cleavage of the anticoagulant protein C []. Prothrombin is activated on the surface of a phospholipid membrane where factor Xa removes the activation peptide and cleaves the remaining part into light and heavy chains. This domain corresponds to the light chain of thrombin. ; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis, 0007596 blood coagulation, 0005576 extracellular region; PDB: 3HKI_D 2OCV_A 3EDX_A 3HK6_C 2PV9_A 2PUX_A 3HK3_A 1HRT_L 1TOC_G 1ETT_L ....
Probab=26.06  E-value=35  Score=17.98  Aligned_cols=8  Identities=38%  Similarity=1.036  Sum_probs=6.7

Q ss_pred             CCcchhHH
Q psy17374         54 GLFHPHAF   61 (71)
Q Consensus        54 ~lF~P~~F   61 (71)
                      -||+|.+|
T Consensus         8 ~FFn~kTF   15 (49)
T PF09396_consen    8 TFFNPKTF   15 (49)
T ss_dssp             STSTHHHH
T ss_pred             cccCcccc
Confidence            58999988


No 7  
>PF03490 Varsurf_PPLC:  Variant-surface-glycoprotein phospholipase C;  InterPro: IPR003633 Variant-surface-glycoprotein phospholipase C, by hydrolysis of the attached glycolipid, releases soluble variant surface glycoprotein containing phosphoinositol from the cell wall after lysis. It catalyses the conversion of variant-surface-glycoprotein 1,2 didecanoyl-SN-phosphatidylinositol and water to 1,2-didecanoylglycerol and the soluble variant-surface-glycoprotein. It also cleaves similar membrane anchors on some mammalian proteins.; GO: 0047396 glycosylphosphatidylinositol diacylglycerol-lyase activity, 0006650 glycerophospholipid metabolic process
Probab=26.00  E-value=54  Score=17.41  Aligned_cols=15  Identities=13%  Similarity=0.173  Sum_probs=11.2

Q ss_pred             ChHHHHHHHHHHHHH
Q psy17374         20 NPLLYIRSVVSRAVM   34 (71)
Q Consensus        20 ~~~~w~~~l~~R~~~   34 (71)
                      .|.+|+.||...+..
T Consensus         7 ~PqSWM~DLrS~I~~   21 (51)
T PF03490_consen    7 HPQSWMSDLRSSIGE   21 (51)
T ss_pred             CcHHHHHHHHHHHhc
Confidence            578999999766553


No 8  
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins. This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of STARD1 (also known as StAR) and STARD3 (also known as metastatic lymph node 64/MLN64). The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. This STARD1-like subfamily has a high affinity for cholesterol. STARD1/StAR can reduce macrophage lipid content and inflammatory status. It plays an essential role in steroidogenic tissues: transferring the steroid precursor, cholesterol, from the outer to the inner mitochondrial membrane, across the aqueous space. Mutations in the gene encoding STARD1/StAR can cause lipid congenital adrenal hyperplasia (CAH), an autosomal recessive disorder characterized by a steroid synth
Probab=25.31  E-value=39  Score=21.79  Aligned_cols=31  Identities=10%  Similarity=0.131  Sum_probs=16.1

Q ss_pred             CCCCCchhhhhhccCCCChHHHHHHHHHHHHH
Q psy17374          3 PNDYTPDDWQSIWSGSGNPLLYIRSVVSRAVM   34 (71)
Q Consensus         3 ~~~~vP~~W~~~~~~~~~~~~w~~~l~~R~~~   34 (71)
                      +.|.+|. |.-..-.+..+..++.+|.++++.
T Consensus       177 p~G~iP~-~lvN~~~~~~~~~~~~~Lr~~~~~  207 (208)
T cd08868         177 LKGWLPQ-YLVDQALASVLLDFMKHLRKRIAT  207 (208)
T ss_pred             CCCCCcc-eeeehhhHHHHHHHHHHHHHHHhh
Confidence            3455665 433233334456677777666543


No 9  
>cd00291 SirA_YedF_YeeD SirA, YedF, and YeeD. Two-layered alpha/beta sandwich domain.  SirA (also known as UvrY,  and YhhP) belongs to a family of bacterial two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA.  A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium.  Moreover, despite a low primary sequence similarity,  the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.
Probab=25.11  E-value=66  Score=16.74  Aligned_cols=19  Identities=37%  Similarity=0.475  Sum_probs=15.7

Q ss_pred             ceecCCCcchhHHHHHHHH
Q psy17374         49 PVDLSGLFHPHAFLSVLKQ   67 (71)
Q Consensus        49 ~~wLs~lF~P~~FLtA~~Q   67 (71)
                      .+|+.|+-.|.-++.+.+.
T Consensus         1 ~lD~rg~~CP~Pl~~~~~~   19 (69)
T cd00291           1 TLDLRGLPCPLPVLKTKKA   19 (69)
T ss_pred             CccccCCcCCHHHHHHHHH
Confidence            3688999999999988764


No 10 
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins. This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD4, -5, and -6. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD4 plays an important role in steroidogenesis, trafficking cholesterol into mitochondria. It specifically binds cholesterol, and demonstrates limited binding to another sterol, 7a-hydroxycholesterol. STARD4 and STARD5 are ubiquitously expressed, with highest levels in liver and kidney. STRAD5 functions in the kidney within the proximal tubule cells where it is associated with the Endoplasmic Reticulum (ER), and may participate in ER-associated cholesterol transport. It binds cholesterol and 25-hydroxycholesterol. Expression 
Probab=24.85  E-value=59  Score=20.91  Aligned_cols=29  Identities=10%  Similarity=0.022  Sum_probs=14.5

Q ss_pred             CCCCCchhhhhhccCCCChHHHHHHHHHHH
Q psy17374          3 PNDYTPDDWQSIWSGSGNPLLYIRSVVSRA   32 (71)
Q Consensus         3 ~~~~vP~~W~~~~~~~~~~~~w~~~l~~R~   32 (71)
                      +.|.+|. |.-..-....+..|+.+|.+++
T Consensus       177 pkG~iP~-~lvn~~~~~~~~~~~~~lr~~~  205 (206)
T cd08867         177 LRGMIPQ-SLVESAMPSNLVNFYTDLVKGV  205 (206)
T ss_pred             cCCCCcH-HHHHhhhhhhHHHHHHHHHHhc
Confidence            4566665 4332223334566666665543


No 11 
>cd07561 Peptidase_S41_CPP_like C-terminal processing peptidase-like; serine protease family S41. Bacterial protease homologs of the S41 family related to C-terminal processing peptidase (CPP).  CPP-1 is believed to be important for the degradation of incorrectly synthesized proteins as well as protection from thermal and osmotic stresses. CPP is synthesized with an extension on its carboxyl-terminus and specifically recognizes a C-terminal tripeptide, but cleaves at variable distance from the C-terminus. The CPP active site consists of a serine/lysine catalytic dyad. Conservation of these residues is seen in the CPP-like proteins of this group. CPP proteins contain a PDZ domain that promotes protein-protein interactions and is important for substrate recognition however, most of CPP-like proteins only have an internal fragment or lack the PDZ domain.
Probab=24.34  E-value=1.1e+02  Score=20.84  Aligned_cols=39  Identities=23%  Similarity=0.170  Sum_probs=26.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhcCCCCCCceecCCCcchhHHHHHHH
Q psy17374         21 PLLYIRSVVSRAVMVHKCYQVSSTYWRSPVDLSGLFHPHAFLSVLK   66 (71)
Q Consensus        21 ~~~w~~~l~~R~~~l~~w~~~~~~~~~~~~wLs~lF~P~~FLtA~~   66 (71)
                      ...||.++++..-   -|.++    .|..-.|..+.-|++||.+++
T Consensus         9 ~~~~~~~~m~~~Y---lw~~~----~p~~~~~~~~~~p~~~~~~l~   47 (256)
T cd07561           9 VNQWIYDVMREWY---LWYDD----IPALDDLDYFDDPEDFLESLL   47 (256)
T ss_pred             HHHHHHHHHHhhh---ccccc----ccccccccccCCHHHHHHHhh
Confidence            3677766544221   35554    355566999999999999986


No 12 
>PF13817 DDE_Tnp_IS66_C:  IS66 C-terminal element
Probab=23.93  E-value=88  Score=15.38  Aligned_cols=15  Identities=33%  Similarity=0.587  Sum_probs=12.8

Q ss_pred             ChHHHHHHHHHHHHH
Q psy17374         20 NPLLYIRSVVSRAVM   34 (71)
Q Consensus        20 ~~~~w~~~l~~R~~~   34 (71)
                      +|-.|++++..|+..
T Consensus        12 ~P~~yL~~vL~~i~~   26 (39)
T PF13817_consen   12 NPYAYLTDVLERIPN   26 (39)
T ss_pred             CHHHHHHHHHHHHcc
Confidence            578999999998875


No 13 
>PF01206 TusA:  Sulfurtransferase TusA;  InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase. This system increases the expression of virulence genes and decreases the expression of motility genes []. BarA phosphorylates SirA, thereby activating the protein. Phosphorylated SirA directly activates virulence expression by interacting with hilA and hilC promoters, while repressing the flagellar regulon indirectly by binding to the csrB promoter, which in turn affects flagellar gene expression. Orthologues of SirA from Salmonella spp. can be found throughout proteobacteria, such as GacA in Psuedomonas spp., VarA in Vibrio cholerae, ExpA in Erwinia carotovora, LetA in Legionella pneumophila, and UvrY in Escherichia coli []. A sensor kinase for SirA is present in each of these organisms as well; the sensor kinase is known as BarA in E. coli and Salmonella spp., but has different names in other genera. In different species, SirA/BarA orthologues are required for virulence gene expression, exoenzyme and antibiotic production, motility, and biofilm formation. The structure of SirA consists of an alpha/beta sandwich with a beta-alpha-beta-alpha-beta(2) fold, comprising a mixed four-stranded beta-sheet stacked against two alpha-helices, both of which are nearly parallel to the strands of the beta-sheet []. Several uncharacterised bacterial proteins (73 to 81 amino-acid residues in length) that contain a well-conserved region in their N-terminal region show structural similarity to the SirA protein, including the E. coli protein YedF (P0AA31 from SWISSPROT), and other members of the UPF0033 family.; GO: 0016783 sulfurtransferase activity, 0008033 tRNA processing, 0005737 cytoplasm; PDB: 3LVJ_D 3LVK_B 1DCJ_A 3HZ7_A 1JDQ_A 1JE3_A 1PAV_A.
Probab=22.37  E-value=87  Score=16.47  Aligned_cols=18  Identities=39%  Similarity=0.571  Sum_probs=14.5

Q ss_pred             ceecCCCcchhHHHHHHH
Q psy17374         49 PVDLSGLFHPHAFLSVLK   66 (71)
Q Consensus        49 ~~wLs~lF~P~~FLtA~~   66 (71)
                      .+|+.|+..|.-++.+.+
T Consensus         2 ~lD~rg~~CP~Pll~~~~   19 (70)
T PF01206_consen    2 TLDLRGLSCPMPLLKAKK   19 (70)
T ss_dssp             EEECSS-STTHHHHHHHH
T ss_pred             EEeCCCCCCCHHHHHHHH
Confidence            589999999999988765


No 14 
>cd08818 CARD_MDA5_1 Caspase activation and recruitment domain found in MDA5, first repeat. Caspase activation and recruitment domain (CARD) found in MDA5 (melanoma-differentiation-associated gene 5), first repeat.  MDA5, also known as IFIH1, contains two N-terminal CARD domains and a C-terminal RNA helicase domain. MDA5 is a cytoplasmic DEAD box RNA helicase that plays an important role in host antiviral response by sensing incoming viral RNA. Upon activation, the signal is transferred to downstream pathways via the adaptor molecule IPS-1 (MAVS, VISA, CARDIF), leading to the induction of type I interferons. Although very similar in sequence, MDA5 recognizes different sets of viruses compared to RIG-I, a related RNA helicase. MDA5 associates with IPS-1 through a CARD-CARD interaction. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation, and host-defense mechanisms. DDs are protein-
Probab=21.90  E-value=64  Score=18.99  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=12.2

Q ss_pred             eecCCCcchhHHHHHHHHH
Q psy17374         50 VDLSGLFHPHAFLSVLKQH   68 (71)
Q Consensus        50 ~wLs~lF~P~~FLtA~~Q~   68 (71)
                      .|=.|.|  ++||+|+++.
T Consensus        63 ~~~~GWf--~~FldAL~~~   79 (88)
T cd08818          63 TWDPGWF--REFVTALEQG   79 (88)
T ss_pred             ccCCchH--HHHHHHHHhc
Confidence            4455666  6899999874


No 15 
>cd03421 SirA_like_N SirA_like_N, a protein of unknown function with an N-terminal SirA-like domain.  The SirA, YedF, YeeD protein family is present in bacteria as well as archaea. SirA  (also known as UvrY,  and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA.  A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium.  Moreover, despite a low primary sequence similarity,  the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.
Probab=21.86  E-value=89  Score=16.38  Aligned_cols=18  Identities=28%  Similarity=0.490  Sum_probs=15.0

Q ss_pred             eecCCCcchhHHHHHHHH
Q psy17374         50 VDLSGLFHPHAFLSVLKQ   67 (71)
Q Consensus        50 ~wLs~lF~P~~FLtA~~Q   67 (71)
                      +|+.|+..|.-++-+-+.
T Consensus         2 lD~rG~~CP~P~l~~k~a   19 (67)
T cd03421           2 IDARGLACPQPVIKTKKA   19 (67)
T ss_pred             cccCCCCCCHHHHHHHHH
Confidence            688999999999887664


No 16 
>KOG2099|consensus
Probab=21.77  E-value=94  Score=24.80  Aligned_cols=15  Identities=27%  Similarity=0.550  Sum_probs=11.4

Q ss_pred             CCCCchhhhhhccCC
Q psy17374          4 NDYTPDDWQSIWSGS   18 (71)
Q Consensus         4 ~~~vP~~W~~~~~~~   18 (71)
                      +|-+|..|...+.+.
T Consensus       486 NGITPRRWL~~cnP~  500 (843)
T KOG2099|consen  486 NGITPRRWLLLCNPG  500 (843)
T ss_pred             CCcCHHHHHHhcCch
Confidence            688999999865433


No 17 
>TIGR02115 potass_kdpF K+-transporting ATPase, KdpF subunit. This model describes a very small integral membrane peptide KdpF, a subunit of the K(+)-translocating Kdp complex. It is found upstream of the KdpA subunit (TIGR00680). Because of its very small size and highly hydrophobic character, it is sometimes missed in genome annotation.
Probab=21.74  E-value=26  Score=16.08  Aligned_cols=9  Identities=33%  Similarity=0.781  Sum_probs=5.8

Q ss_pred             CCcchhHHH
Q psy17374         54 GLFHPHAFL   62 (71)
Q Consensus        54 ~lF~P~~FL   62 (71)
                      .+++||.|.
T Consensus        17 aLl~PErF~   25 (26)
T TIGR02115        17 ALLRPERFX   25 (26)
T ss_pred             HHhCHHhcC
Confidence            467777763


No 18 
>PF05209 MinC_N:  Septum formation inhibitor MinC, N-terminal domain;  InterPro: IPR007874 In Escherichia coli FtsZ (P0A9A6 from SWISSPROT) assembles into a Z ring at midcell. Its assembly at polar sites is prevented by the min system. MinC P18196 from SWISSPROT, a component of this system, is an inhibitor of FtsZ assembly that is positioned within the cell by interaction with the MinDE proteins. MinC is an oligomer, probably a dimer []. The C-terminal half of MinC is the most conserved and interacts with MinD. The N-terminal half is thought to interact with FtsZ. MinC rapidly oscillates between the poles of the cell to destabilise FtsZ filaments that have formed before they mature into polar Z rings; GO: 0051302 regulation of cell division; PDB: 3GHF_A 1HF2_C.
Probab=21.45  E-value=1.6e+02  Score=16.90  Aligned_cols=44  Identities=14%  Similarity=0.091  Sum_probs=32.1

Q ss_pred             ChHHHHHHHHHHHHHHHHHHhhcCCCCCCceecCCCcchhHHHHHHHHH
Q psy17374         20 NPLLYIRSVVSRAVMVHKCYQVSSTYWRSPVDLSGLFHPHAFLSVLKQH   68 (71)
Q Consensus        20 ~~~~w~~~l~~R~~~l~~w~~~~~~~~~~~~wLs~lF~P~~FLtA~~Q~   68 (71)
                      ++......|..|+.+--+...+    .|-+++++++ ..+-=+.++.+.
T Consensus        24 d~~~l~~~L~~ki~~ap~FF~~----~pvvldl~~l-~~~~dl~~L~~~   67 (99)
T PF05209_consen   24 DLDELLQALDEKIAQAPDFFKN----APVVLDLSNL-PDELDLAALVEL   67 (99)
T ss_dssp             -HHHHHHHHHHHHHHTHHHCTT----TEEEEEEEEE-ETTHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhChHhHcC----CCeEEehhhc-CChhhHHHHHHH
Confidence            5688888899999888887664    2689999999 555455666554


No 19 
>PF06868 DUF1257:  Protein of unknown function (DUF1257);  InterPro: IPR009666 This family represents Ycf35, which is encoded in algal chloroplast and in cyanobacteria. The function of these proteins are unknown. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=21.26  E-value=78  Score=18.85  Aligned_cols=15  Identities=33%  Similarity=0.468  Sum_probs=12.4

Q ss_pred             cchhHHHHHHHHHhc
Q psy17374         56 FHPHAFLSVLKQHTA   70 (71)
Q Consensus        56 F~P~~FLtA~~Q~~A   70 (71)
                      ...+.||.-+.|.||
T Consensus        62 ~~~e~fl~kl~Q~YA   76 (105)
T PF06868_consen   62 YSVERFLNKLTQRYA   76 (105)
T ss_pred             CCHHHHHHHHHHHHH
Confidence            457889999999887


No 20 
>PF12392 DUF3656:  Collagenase ;  InterPro: IPR020988 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This domain is found in a number of proteins belonging to the MEROPS peptidase family U32. Peptidase family U32 contains endopeptidases, including collagenase, from bacteria. 
Probab=20.82  E-value=74  Score=18.89  Aligned_cols=22  Identities=36%  Similarity=0.610  Sum_probs=18.2

Q ss_pred             Cceec-CCCcchhHHHHHHHHHh
Q psy17374         48 SPVDL-SGLFHPHAFLSVLKQHT   69 (71)
Q Consensus        48 ~~~wL-s~lF~P~~FLtA~~Q~~   69 (71)
                      -.+.+ .++|.|-+-|+.+|.+.
T Consensus        88 i~i~~~~~lFlP~s~LN~lRRea  110 (122)
T PF12392_consen   88 IEIDLDEGLFLPISELNELRREA  110 (122)
T ss_pred             EEEEcCCCEEEEHHHHHHHHHHH
Confidence            34565 89999999999999764


Done!