Diaphorina citri psyllid: psy17380


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MAQLLFSLITLGEGLTLLLPYIISTRHSWASCKLRVFALANRKEELEFEQRNIASLLAKFRIDYADLIIITTITRRPHEETVEFYNHLVRPYLAKDEEADCGDAEHI
cHHHHHHHHHccccHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHccccccccccccccc
**QLLFSLITLGEGLTLLLPYIISTRHSWASCKLRVFALANRKEELEFEQRNIASLLAKFRIDYADLIIITTITRRPHEETVEFYNHLVRPYLA*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQLLFSLITLGEGLTLLLPYIISTRHSWASCKLRVFAxxxxxxxxxxxxxxxxxxxxxFRIDYADLIIITTITRRPHEETVEFYNHLVRPYLAKDEEADCGDAEHI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006821 [BP]chloride transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008511 [MF]sodium:potassium:chloride symporter activityprobableGO:0022891, GO:0015294, GO:0015296, GO:0015291, GO:0015293, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015377, GO:0015103, GO:0015108, GO:0022804
GO:0035826 [BP]rubidium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G40, chain A
Confidence level:probable
Coverage over the Query: 2-70
View the alignment between query and template
View the model in PyMOL