Diaphorina citri psyllid: psy17394


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
QLASKIARKDSLAIKLALRPDRQELIDRNILQVQSEKERQETKQVIGARLIRRLSMRPTVEELEDRNILKKQTAAEEKKLKEEKKKMLLRKLSFRPTVDELKEKKIIRFNDYIEVTQAHDYDRRADKPWTRLTPKDKAAIRKELNEFKSSEMEVHQESRHLTR
cHHHHHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEECccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccc
******AR**SL*********************************IGARLI****************************************LSFRPTVDELKEKKIIRFNDYIEVTQAHDYDRRADKPWTRLTPKDKAAIRKELNEFKS**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QLASKIARKDSLAIKLALRPDRQELIDRNILQVQSEKERQETKQVIGARLIRRLSMRPTVEELEDxxxxxxxxxxxxxxxxxxxxxxxxxxLSFRPTVDELKEKKIIRFNDYIEVTQAHDYDRRADKPWTRLTPKDKAAIRKELNEFKSSEMEVHQESRHLTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatase and actin regulator 2 confidentO75167
Phosphatase and actin regulator 2 confidentP62025

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042325 [BP]regulation of phosphorylationprobableGO:0019220, GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0048870 [BP]cell motilityprobableGO:0040011, GO:0009987, GO:0006928, GO:0051674, GO:0008150, GO:0044763, GO:0051179, GO:0044699
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0008157 [MF]protein phosphatase 1 bindingprobableGO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0045202 [CC]synapseprobableGO:0005575
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B1Z, chain M
Confidence level:very confident
Coverage over the Query: 7-115
View the alignment between query and template
View the model in PyMOL