Diaphorina citri psyllid: psy17399


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MFKHLAQTYANGNPVMKTGTNCDDHFPNGITNGAYWYDVKGGMQDFNYVYSNCFEVTFELSCCKFPRASQMPKFWKDNKEALLAFMEQTHLGVKGGMQDFNYVYSNCFEVTFELSCCKFPRASQMPKFWKDNKEALLAFMEQTHLGVKGRME
cHHHHHHHHHHcccccccccccccccccccccccCEECcccccccEEEEEEcEEEEEEEccccccccccccHHHHHHcHHHHHHHHHHHHcccccEEEEccccccccEEEEEECccccccccccccHHHHHcHHHHHHHHHHHHcccccEEc
MFKHLAQTYANGNPVMKTGTNCDDHFPNGITNGAYWYDVKGGMQDFNYVYSNCFEVTFELSCCKFPRASQMPKFWKDNKEALLAFMEQTHLGVKGGMQDFNYVYSNCFEVTFELSCCKFPRASQMPKFWKDNKEALLAFMEQTHLGVKGRM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKHLAQTYANGNPVMKTGTNCDDHFPNGITNGAYWYDVKGGMQDFNYVYSNCFEVTFELSCCKFPRASQMPKFWKDNKEALLAFMEQTHLGVKGGMQDFNYVYSNCFEVTFELSCCKFPRASQMPKFWKDNKEALLAFMEQTHLGVKGRME

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carboxypeptidase D confidentO89001
Carboxypeptidase D confidentQ9JHW1
Carboxypeptidase D confidentO75976

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051384 [BP]response to glucocorticoid stimulusprobableGO:0009719, GO:0033993, GO:0031960, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0004181 [MF]metallocarboxypeptidase activityprobableGO:0016787, GO:0003824, GO:0004180, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MN8, chain A
Confidence level:very confident
Coverage over the Query: 1-131
View the alignment between query and template
View the model in PyMOL
Template: 3MN8, chain A
Confidence level:very confident
Coverage over the Query: 93-152
View the alignment between query and template
View the model in PyMOL