RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17408
         (96 letters)



>gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase D, domain I subgroup.  The
           first carboxypeptidase (CP)-like domain of
           Carboxypeptidase D (CPD; EC 3.4.17.22), domain I. CPD
           differs from all other metallocarboxypeptidases in that
           it contains multiple CP-like domains. CPD belongs to the
           N/E-like subfamily of the M14 family of
           metallocarboxypeptidases (MCPs).The M14 family are
           zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPD is a
           single-chain protein containing a signal peptide, three
           tandem repeats of CP-like domains separated by short
           bridge regions, followed by a transmembrane domain, and
           a C-terminal cytosolic tail. The first two CP-like
           domains of CPD contain all of the essential active site
           and substrate-binding residues, the third CP-like domain
           lacks critical residues necessary for enzymatic activity
           and is inactive towards standard CP substrates. Domain I
           is optimally active at pH 6.3-7.5 and prefers substrates
           with C-terminal Arg, whereas domain II is active at pH
           5.0-6.5 and prefers substrates with C-terminal Lys. This
           Domain I family contains two contiguous surface
           cysteines that may become palmitoylated and target the
           enzyme to membranes, thus regulating intracellular
           trafficking. CPD functions in the processing of proteins
           that transit the secretory pathway, and is present in
           all vertebrates as well as Drosophila. It is broadly
           distributed in all tissue types. Within cells, CPD is
           present in the trans Golgi network and immature
           secretory vesicles, but is excluded from mature
           vesicles. It is thought to play a role in the processing
           of proteins that are initially processed by furin or
           related endopeptidases present in the trans Golgi
           network, such as growth factors and receptors. CPD is
           implicated in the pathogenesis of lupus erythematosus
           (LE), it is regulated by TGF-beta in various cell types
           of murine and human origin and is significantly
           down-regulated in CD14 positive cells isolated from
           patients with LE. As down-regulation of CPD leads to
           down-modulation of TGF-beta, CPD may have a role in a
           positive feedback loop. In D. melanogaster, the CPD
           variant 1B short (DmCPD1Bs) is necessary and sufficient
           for viability of the fruit fly.
          Length = 293

 Score =  118 bits (297), Expect = 4e-34
 Identities = 48/82 (58%), Positives = 60/82 (73%), Gaps = 7/82 (8%)

Query: 15  EGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNP 74
           EG C S   + GR NAN VDLNRNFPDQF+    R       ++ +PETLAMI++I++NP
Sbjct: 114 EGDC-SCGGYGGRGNANNVDLNRNFPDQFEGKHVR------AQERQPETLAMINWIRSNP 166

Query: 75  FVLSGNLHGGAIVASYPFDDSK 96
           FVLS NLHGG++VASYP+DDS 
Sbjct: 167 FVLSANLHGGSVVASYPYDDSS 188


>gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily
           N/E-like.  Carboxypeptidase (CP) N/E-like subfamily of
           the M14 family of metallocarboxypeptidases (MCPs). The
           M14 family are zinc-binding CPs which hydrolyze single,
           C-terminal amino acids from polypeptide chains, and have
           a recognition site for the free C-terminal carboxyl
           group, which is a key determinant of specificity. The
           N/E subfamily includes eight members, of which five
           (CPN, CPE, CPM, CPD, CPZ) are considered enzymatically
           active, while the other three are non-active (CPX1,
           PCX2, ACLP/AEBP1) and lack the critical active site and
           substrate-binding residues considered necessary for CP
           activity. These non-active members may function as
           binding proteins or display catalytic activity towards
           other substrates. Unlike the A/B CP subfamily, enzymes
           belonging to the N/E subfamily are not produced as
           inactive precursors that require proteolysis to produce
           the active form; rather, they rely on their substrate
           specificity and subcellular compartmentalization to
           prevent inappropriate cleavages that would otherwise
           damage the cell. In addition, all members of the N/E
           subfamily contain an extra C-terminal domain that is not
           present in the A/B subfamily. This domain has structural
           homology to transthyretin and other proteins and has
           been proposed to function as a folding domain. The
           active N/E enzymes fulfill a variety of cellular
           functions, including prohormone processing, regulation
           of peptide hormone activity, alteration of
           protein-protein or protein-cell interactions and
           transcriptional regulation.
          Length = 293

 Score =  114 bits (288), Expect = 7e-33
 Identities = 42/83 (50%), Positives = 54/83 (65%), Gaps = 9/83 (10%)

Query: 14  YEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNN 73
            EG C  +    GR NANGVDLNRNFPD F           + +  +PET A++ +IK+ 
Sbjct: 113 QEGDCGGV---TGRANANGVDLNRNFPDLF------ATIYSDNEPRQPETKAVMKWIKSI 163

Query: 74  PFVLSGNLHGGAIVASYPFDDSK 96
           PFVLS NLHGGA+VA+YP+DD+ 
Sbjct: 164 PFVLSANLHGGALVANYPYDDTP 186


>gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase N subgroup.  Peptidase M14
           Carboxypeptidase N (CPN, also known as kininase I,
           creatine kinase conversion factor, plasma
           carboxypeptidase B, arginine carboxypeptidase, and
           protaminase; EC 3.4.17.3) is an extracellular
           glycoprotein synthesized in the liver and released into
           the blood, where it is present in high concentrations.
           CPN belongs to the N/E subfamily of the M14 family of
           metallocarboxypeptidases (MCPs).The M14 family are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. CPN plays an important role in protecting
           the body from excessive buildup of potentially
           deleterious peptides that normally act as local
           autocrine or paracrine hormones. It specifically removes
           C-terminal basic residues. As CPN can cleave lysine more
           avidly than arginine residues it is also called lysine
           carboxypeptidase. CPN substrates include peptides found
           in the bloodstream, such as kinins (e.g. bradykinin,
           kalinin, met-lys-bradykinin), complement anaphylatoxins
           and creatine kinase MM (CK-MM). By removing just one
           amino acid, CPN can alter peptide activity and receptor
           binding. For example Bradykinin, a nine-residue peptide
           released from kiningen in response to tissue injury
           which is inactivated by CPN, anaphylatoxins which are
           regulated by CPN by the cleaving and removal of their
           C-terminal arginines resulting in a reduction in their
           biological activities of 10-100-fold, and creatine
           kinase MM, a cytosolic enzyme that catalyzes the
           reversible transfer of a phosphate group from ATP to
           creatine, and is regulated by CPN by the cleavage of
           C-terminal lysines. Like the other N/E subfamily
           members, two surface loops surrounding the active-site
           groove restrict access to the catalytic center, thus
           restricting larger protein carboxypeptidase inhibitors
           from inhibiting CPN.
          Length = 313

 Score = 87.7 bits (217), Expect = 2e-22
 Identities = 44/83 (53%), Positives = 57/83 (68%), Gaps = 10/83 (12%)

Query: 24  FVGRNNANGVDLNRNFPD---------QFDSSSERREQPLNVK-KLEPETLAMISFIKNN 73
            VGRNNANGVDLNRNFPD         ++   +     P N K ++EPETLA+I +++N 
Sbjct: 124 LVGRNNANGVDLNRNFPDLNTLMYYNEKYGGPNHHLPLPDNWKSQVEPETLAVIQWMQNY 183

Query: 74  PFVLSGNLHGGAIVASYPFDDSK 96
            FVLS NLHGGA+VA+YP+D S+
Sbjct: 184 NFVLSANLHGGAVVANYPYDKSR 206


>gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase M subgroup.  Peptidase M14
           Carboxypeptidase (CP) M (CPM) belongs to the N/E
           subfamily of the M14 family of metallocarboxypeptidases
           (MCPs).The M14 family are zinc-binding CPs which
           hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. CPM is an extracellular
           glycoprotein, bound to cell membranes via a
           glycosyl-phosphatidylinositol on the C-terminus of the
           protein. It specifically removes C-terminal basic
           residues such as lysine and arginine from peptides and
           proteins. The highest levels of CPM have been found in
           human lung and placenta, but significant amounts are
           present in kidney, blood vessels, intestine, brain, and
           peripheral nerves. CPM has also been found in soluble
           form in various body fluids, including amniotic fluid,
           seminal plasma and urine. Due to its wide distribution
           in a variety of tissues, it is believed that it plays an
           important role in the control of peptide hormones and
           growth factor activity on the cell surface and in the
           membrane-localized degradation of extracellular
           proteins, for example it hydrolyses the C-terminal
           arginine of epidermal growth factor (EGF) resulting in
           des-Arg-EGF which binds to the EGF receptor (EGFR) with
           an equal or greater affinity than native EGF.  CPM is a
           required processing enzyme that generates specific
           agonists for the B1 receptor.
          Length = 292

 Score = 86.1 bits (213), Expect = 7e-22
 Identities = 38/71 (53%), Positives = 51/71 (71%), Gaps = 9/71 (12%)

Query: 25  VGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGG 84
           VGR N NG DLNRNFPD F+ ++E+R+         PET A++ ++K+  FVLS NLHGG
Sbjct: 124 VGRYNKNGYDLNRNFPDAFEENNEQRQ---------PETRAVMEWLKSETFVLSANLHGG 174

Query: 85  AIVASYPFDDS 95
           A+VASYP+D+ 
Sbjct: 175 ALVASYPYDNG 185


>gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase D, domain II subgroup.  The
           second carboxypeptidase (CP)-like domain of
           Carboxypeptidase D (CPD; EC 3.4.17.22), domain II. CPD
           differs from all other metallocarboxypeptidases in that
           it contains multiple CP-like domains. CPD belongs to the
           N/E-like subfamily of the M14 family of
           metallocarboxypeptidases (MCPs).The M14 family are
           zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPD is a
           single-chain protein containing a signal peptide, three
           tandem repeats of CP-like domains separated by short
           bridge regions, followed by a transmembrane domain, and
           a C-terminal cytosolic tail. The first two CP-like
           domains of CPD contain all of the essential active site
           and substrate-binding residues, while the third CP-like
           domain lacks critical residues necessary for enzymatic
           activity and is inactive towards standard CP substrates.
           Domain I is optimally active at pH 6.3-7.5 and prefers
           substrates with C-terminal Arg, whereas domain II is
           active at pH 5.0-6.5 and prefers substrates with
           C-terminal Lys. CPD functions in the processing of
           proteins that transit the secretory pathway, and is
           present in all vertebrates as well as Drosophila. It is
           broadly distributed in all tissue types. Within cells,
           CPD is present in the trans-Golgi network and immature
           secretory vesicles, but is excluded from mature
           vesicles. It is thought to play a role in the processing
           of proteins that are initially processed by furin or
           related endopeptidases present in the trans-Golgi
           network, such as growth factors and receptors. CPD is
           implicated in the pathogenesis of lupus erythematosus
           (LE), it is regulated by TGF-beta in various cell types
           of murine and human origin and is significantly
           down-regulated in CD14 positive cells isolated from
           patients with LE. As down -regulation of CPD leads to
           down-modulation of TGF-beta, CPD may have a role in a
           positive feedback loop.
          Length = 296

 Score = 83.1 bits (205), Expect = 1e-20
 Identities = 39/70 (55%), Positives = 50/70 (71%), Gaps = 9/70 (12%)

Query: 25  VGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGG 84
           VGRNN+N  DLNRNFPDQF   ++           +PETLA++S++K  PFVLS NLHGG
Sbjct: 128 VGRNNSNNYDLNRNFPDQFFQITD---------PPQPETLAVMSWLKTYPFVLSANLHGG 178

Query: 85  AIVASYPFDD 94
           ++V +YPFDD
Sbjct: 179 SLVVNYPFDD 188


>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase. 
          Length = 277

 Score = 80.9 bits (200), Expect = 4e-20
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 25  VGRNNANGVDLNRNFPDQFDS-------SSERREQPLNVKKLEPETLAMISFIKNNPFVL 77
             R+NANGVDLNRNFPD ++         SE    P      EPET A+  FI++  F L
Sbjct: 111 KNRSNANGVDLNRNFPDLWNEVGASSNPCSETYRGP--APFSEPETRAVADFIRSYKFKL 168

Query: 78  SGNLHGGAIVASYPFDDSK 96
             +LHG + +  YP+  + 
Sbjct: 169 YIDLHGYSQLILYPYGYTY 187


>gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase E subgroup.  Peptidase M14
           Carboxypeptidase (CP) E (CPE, also known as
           carboxypeptidase H, and enkephalin convertase; EC
           3.4.17.10) belongs to the N/E subfamily of the M14
           family of metallocarboxypeptidases (MCPs).The M14 family
           are zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPE is an
           important enzyme responsible for the proteolytic
           processing of prohormone intermediates (such as
           pro-insulin, pro-opiomelanocortin, or
           pro-gonadotropin-releasing hormone) by specifically
           removing C-terminal basic residues. In addition, it has
           been proposed that the regulated secretory pathway (RSP)
           of the nervous and endocrine systems utilizes
           membrane-bound CPE as a sorting receptor. A naturally
           occurring point mutation in CPE reduces the stability of
           the enzyme and causes its degradation, leading to an
           accumulation of numerous neuroendocrine peptides that
           result in obesity and hyperglycemia. Reduced CPE enzyme
           and receptor activity could underlie abnormal placental
           phenotypes from the observation that CPE is
           down-regulated  in enlarged placentas of interspecific
           hybrid (interspecies hybrid placental dysplasia, IHPD)
           and cloned mice.
          Length = 323

 Score = 75.4 bits (185), Expect = 1e-17
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 14/87 (16%)

Query: 24  FVGRNNANGVDLNRNFPD--QFDSSSERREQPLN------------VKKLEPETLAMISF 69
           FVGR+NA G+DLNRNFPD  +    +ER   P N              KL PET A+I +
Sbjct: 128 FVGRSNAQGIDLNRNFPDLDRIVYVNEREGGPNNHLLKNMKKAVDENTKLAPETKAVIHW 187

Query: 70  IKNNPFVLSGNLHGGAIVASYPFDDSK 96
           I + PFVLS NLHGG +VA+YP+D+++
Sbjct: 188 IMDIPFVLSANLHGGDLVANYPYDETR 214


>gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain. 
          Length = 277

 Score = 73.9 bits (182), Expect = 2e-17
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 11/77 (14%)

Query: 27  RNNANGVDLNRNFPDQFDSSSE------RREQPLNVKKLEPETLAMISFIKNN-PFVLSG 79
            +N  GVDLNRNFP  +  +            P +    EPET A+  FI++N  F L  
Sbjct: 123 NSNCRGVDLNRNFPFHWGETGNPCSETYAGPSPFS----EPETKAVRDFIRSNRRFKLYI 178

Query: 80  NLHGGAIVASYPFDDSK 96
           +LH  + +  YP+  +K
Sbjct: 179 DLHSYSQLILYPYGYTK 195


>gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase Z subgroup.  Peptidase
           M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ
           belongs to the N/E subfamily of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPZ is a
           secreted Zn-dependent enzyme whose biological function
           is largely unknown. Unlike other members of the N/E
           subfamily, CPZ has a bipartite structure, which consists
           of an N-terminal cysteine-rich domain (CRD) whose
           sequence is similar to Wnt-binding proteins, and a
           C-terminal CP catalytic domain that removes C-terminal
           Arg residues from substrates. CPZ is enriched in the
           extracellular matrix and is widely distributed during
           early embryogenesis.  That the CRD of CPZ can bind to
           Wnt4 suggests that CPZ plays a role in Wnt signaling.
          Length = 315

 Score = 74.1 bits (182), Expect = 2e-17
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 12/83 (14%)

Query: 26  GRNNANGVDLNRNFPDQFDSSSERREQPLN------------VKKLEPETLAMISFIKNN 73
           GR NA  +DLNRNFPD       RR Q                 K+ PET A++ ++++ 
Sbjct: 126 GRQNAQNIDLNRNFPDLTSEVYRRRRQRGARTDHIPIPDSYWFGKVAPETKAVMKWMRSI 185

Query: 74  PFVLSGNLHGGAIVASYPFDDSK 96
           PFVLS +LHGG +V SYP+D S+
Sbjct: 186 PFVLSASLHGGDLVVSYPYDFSR 208


>gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases
           and related proteins.  The M14 family of
           metallocarboxypeptidases (MCPs), also known as
           funnelins, are zinc-binding carboxypeptidases (CPs)
           which hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. Two major subfamilies of the
           M14 family, defined based on sequence and structural
           homology, are the A/B and N/E subfamilies. Enzymes
           belonging to the A/B subfamily are normally synthesized
           as inactive precursors containing preceding signal
           peptide, followed by an N-terminal pro-region linked to
           the enzyme; these proenzymes are called
           procarboxypeptidases. The A/B enzymes can be further
           divided based on their substrate specificity;
           Carboxypeptidase A-like (CPA-like) enzymes favor
           hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavage.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers. MCPs can also be classified based on their
           involvement in specific physiological processes; the
           pancreatic MCPs participate only in alimentary digestion
           and include carboxypeptidase A and B (A/B subfamily),
           while others, namely regulatory MCPs or the N/E
           subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.  Another MCP subfamily, is
           that of succinylglutamate desuccinylase /aspartoacylase,
           which hydrolyzes N-acetyl-L-aspartate (NAA), and
           deficiency in which is the established cause of Canavan
           disease. Another subfamily (referred to as subfamily C)
           includes an exceptional type of activity in the MCP
           family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 211

 Score = 65.2 bits (159), Expect = 1e-14
 Identities = 29/69 (42%), Positives = 35/69 (50%)

Query: 27  RNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAI 86
           R NANGVDLNRNFP  +                EPET A+ + IK   F L  NLH G++
Sbjct: 60  RGNANGVDLNRNFPGIWGKRGAPETYGGPAPLSEPETRALAALIKQRKFDLVINLHSGSL 119

Query: 87  VASYPFDDS 95
              YP+  S
Sbjct: 120 AILYPYGHS 128


>gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase X subgroup.  Peptidase
           M14-like domain of carboxypeptidase (CP)-like protein X
           (CPX), CPX forms a distinct subgroup of the N/E
           subfamily of the M14 family of metallocarboxypeptidases
           (MCPs). The M14 family are zinc-binding CPs which
           hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. Proteins belonging to this
           subgroup include CP-like protein X1 (CPX1), CP-like
           protein X2 (CPX2),  and aortic CP-like protein (ACLP)
           and its isoform adipocyte enhancer binding protein-1
           (AEBP1). AEBP1 is a truncated form of ACLP, which may
           arise from alternative splicing of the gene. These
           proteins are inactive towards standard CP substrates
           because they lack one or more critical active site and
           substrate-binding residues that are necessary for
           activity. They may function as binding proteins rather
           than as active CPs or display catalytic activity toward
           other substrates.  Proteins in this subgroup also
           contain an N-terminal discoidin domain. The CP domain is
           important for the function of AEBP1 as a transcriptional
           repressor. AEBP1 is involved in several biological
           processes including adipogenesis, macrophage cholesterol
           homeostasis, and inflammation. In macrophages, AEBP1
           promotes the expression of IL-6, TNF-alpha, MCP-1, and
           iNOS whose expression is tightly regulated by NF-kappaB
           activity. ACLP, a secreted protein that associates with
           the extracellular matrix, is essential for abdominal
           wall development and contributes to dermal wound
           healing.
          Length = 326

 Score = 62.9 bits (153), Expect = 3e-13
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 18/86 (20%)

Query: 26  GRNNANGVDLNRNFPDQFD---SSSERREQPLNVKK---------------LEPETLAMI 67
           GR    G+D+N NFPD       + E++  P  V                 + PET A+I
Sbjct: 130 GRWTEEGIDINHNFPDLNTILWEAEEKKWVPRKVPNHHIPIPEWYLSPNATVAPETRAVI 189

Query: 68  SFIKNNPFVLSGNLHGGAIVASYPFD 93
           ++++  PFVL  NL GG +V SYP+D
Sbjct: 190 AWMEKIPFVLGANLQGGELVVSYPYD 215


>gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily
           N/E-like; Carboxypeptidase D, domain III subgroup.  The
           third carboxypeptidase (CP)-like domain of
           Carboxypeptidase D (CPD; EC 3.4.17.22), domain III. CPD
           differs from all other metallocarboxypeptidases in that
           it contains multiple CP-like domains. CPD belongs to the
           N/E-like subfamily of the M14 family of
           metallocarboxypeptidases (MCPs).The M14 family are
           zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPD is a
           single-chain protein containing a signal peptide, three
           tandem repeats of CP-like domains separated by short
           bridge regions, followed by a transmembrane domain, and
           a C-terminal cytosolic tail. The first two CP-like
           domains of CPD contain all of the essential active site
           and substrate-binding residues, the third CP-like domain
           lacks critical residues necessary for enzymatic activity
           and is inactive towards standard CP substrates. Domain I
           is optimally active at pH 6.3-7.5 and prefers substrates
           with C-terminal Arg, whereas domain II is active at pH
           5.0-6.5 and prefers substrates with C-terminal Lys. CPD
           functions in the processing of proteins that transit the
           secretory pathway, and is present in all vertebrates as
           well as Drosophila. It is broadly distributed in all
           tissue types. Within cells, CPD is present in the
           trans-Golgi network and immature secretory vesicles, but
           is excluded from mature vesicles. It is thought to play
           a role in the processing of proteins that are initially
           processed by furin or related endopeptidases present in
           the trans-Golgi network, such as growth factors and
           receptors. CPD is implicated in the pathogenesis of
           lupus erythematosus (LE), it is regulated by TGF-beta in
           various cell types of murine and human origin and is
           significantly down-regulated in CD14 positive cells
           isolated from patients with LE. As down -regulation of
           CPD leads to down-modulation of TGF-beta, CPD may have a
           role in a positive feedback loop.
          Length = 284

 Score = 51.0 bits (122), Expect = 5e-09
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query: 15  EGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFIKNNP 74
           E  C S     G  NA+G DL+ +F     + S   +         PET A+I  +    
Sbjct: 115 EKQCTSK---EGHTNAHGKDLDTDFTSNASNMSADSQ---------PETKAIIDNLIQKD 162

Query: 75  FVLSGNLHGGAIVASYPFD 93
           F LS  L GG++VA+YP+D
Sbjct: 163 FTLSVALDGGSVVATYPYD 181


>gnl|CDD|199855 cd06229, M14_Endopeptidase_I, Peptidase M14 carboxypeptidase
           family-like domain of Endopeptidase I.  Peptidase
           M14-like domain of Gamma-D-glutamyl-L-diamino acid
           endopeptidase 1 (also known as
           Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and
           Endopeptidase I (ENP1); EC 3.4.19.11). ENP1 is a member
           of the M14 family of metallocarboxypeptidases (MCPs).
           However it has an exceptional type of activity of
           hydrolyzing the gamma-D-Glu-(L)meso-diaminopimelic acid
           (gamma-D-Glu-Dap) bond of
           L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid and
           L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid(L)-D-Ala
           peptides. ENP1has a different substrate specificity and
           cellular role than MpaA (MpaA does not belong to this
           group). ENP1 hydrolyzes the gamma-D-Glu-Dap bond of
           MurNAc-tripeptide and MurNAc-tetrapeptide, as well as
           the amide bond of free tripeptide and tetrapeptide .
           ENP1 is active on spore cortex peptidoglycan, and is
           produced at stage IV of sporulation in forespore and
           spore integuments.
          Length = 256

 Score = 48.8 bits (117), Expect = 3e-08
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 15/58 (25%)

Query: 29  NANGVDLNRNFPDQFDSSSERR-----------EQPLNVKKLEPETLAMISFIKNNPF 75
           NA GVDLNRNFP  ++    R            E PL+    EPET A+  F + N F
Sbjct: 111 NARGVDLNRNFPAGWELEKARGPKAPSPRNYGGEYPLS----EPETKALAEFTRENRF 164


>gnl|CDD|133114 cd06904, M14_MpaA_like, Peptidase M14-like domain of Escherichia
          coli Murein Peptide Amidase A and related proteins.
          Peptidase M14-like domain of Escherichia coli Murein
          Peptide Amidase A (MpaA) and related proteins. MpaA is
          a member of the M14 family of metallocarboxypeptidases
          (MCPs), however it has an exceptional type of activity,
          it hydrolyzes the gamma-D-glutamyl-meso-diaminopimelic
          acid (gamma-D-Glu-Dap) bond in murein peptides. MpaA is
          specific for cleavage of the gamma-D-Glu-Dap bond of
          free murein tripeptide; it may also cleave murein
          tetrapeptide. MpaA has a different substrate
          specificity and cellular role than endopeptidase I,
          ENP1 (ENP1 does not belong to this group). MpaA works
          on free murein peptide in the recycling pathway.
          Length = 178

 Score = 45.0 bits (107), Expect = 4e-07
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 10/52 (19%)

Query: 26 GRNNANGVDLNRNFPDQF---DSSSERRE---QPLNVKKLEPETLAMISFIK 71
           R NANGVDLNRNFP +     +S  RR    +P      EPE+ A++  I+
Sbjct: 50 TRCNANGVDLNRNFPTKDWPPGASRYRRYPGPKPG----SEPESRALMDLIE 97


>gnl|CDD|182582 PRK10602, PRK10602, murein peptide amidase A; Provisional.
          Length = 237

 Score = 44.3 bits (105), Expect = 1e-06
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 23/71 (32%)

Query: 27  RNNANGVDLNRNFPDQ----------FDSSSERR-------EQPLNVKKLEPETLAMISF 69
           R NANGVDLNRNFP            ++S++E R       ++P      EPET A+   
Sbjct: 89  RANANGVDLNRNFPAANWKEGETVYRWNSAAEERDVVLLTGDKP----GSEPETQALCQL 144

Query: 70  IK--NNPFVLS 78
           I      +V+S
Sbjct: 145 IHRLQPAWVVS 155


>gnl|CDD|133073 cd03862, M14-like_7, Peptidase M14-like domain; uncharacterized
           subfamily.  A functionally uncharacterized subgroup of
           the M14 family of metallocarboxypeptidases (MCPs). The
           M14 family are zinc-binding carboxypeptidases (CPs)
           which hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. Two major subfamilies of the
           M14 family, defined based on sequence and structural
           homology, are the A/B and N/E subfamilies. Enzymes
           belonging to the A/B subfamily are normally synthesized
           as inactive precursors containing preceding signal
           peptide, followed by an N-terminal pro-region linked to
           the enzyme; these proenzymes are called
           procarboxypeptidases. The A/B enzymes can be further
           divided based on their substrate specificity;
           Carboxypeptidase A-like (CPA-like) enzymes favor
           hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavages.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 273

 Score = 41.5 bits (98), Expect = 1e-05
 Identities = 21/78 (26%), Positives = 32/78 (41%), Gaps = 24/78 (30%)

Query: 27  RNNANGVDLNRNFPDQFDSSSERREQPL----------------NVKKLEPETLAMISFI 70
           R+N NGVDL RN P      +E +   L                N   +E E  A+  F+
Sbjct: 86  RSNGNGVDLMRNAPVD----AEDKPPFLVGGQRLSPRLPWYRGKNGAGMELEAQALCRFV 141

Query: 71  KN----NPFVLSGNLHGG 84
           +     +PF ++ + H G
Sbjct: 142 RELLFESPFSIALDCHSG 159


>gnl|CDD|199854 cd06227, M14-like_2, Peptidase M14-like domain; uncharacterized
           subfamily.  A functionally uncharacterized subgroup of
           the M14 family of metallocarboxypeptidases (MCPs). The
           M14 family are zinc-binding carboxypeptidases (CPs)
           which hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. Two major subfamilies of the
           M14 family, defined based on sequence and structural
           homology, are the A/B and N/E subfamilies. Enzymes
           belonging to the A/B subfamily are normally synthesized
           as inactive precursors containing preceding signal
           peptide, followed by an N-terminal pro-region linked to
           the enzyme; these proenzymes are called
           procarboxypeptidases. The A/B enzymes can be further
           divided based on their substrate specificity;
           Carboxypeptidase A-like (CPA-like) enzymes favor
           hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavages.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 269

 Score = 41.2 bits (97), Expect = 2e-05
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 27  RNNANGVDLNRNFPDQFD---SSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHG 83
           R N NGVDLNRN+   +          E        EPET A+   +K+    +  ++H 
Sbjct: 122 RENENGVDLNRNYGADWGFKEDDYPDEEYSGPAPFSEPETRAVRDLLKSFSPHVFISVHS 181

Query: 84  GAIVASYPFDDSK 96
           G +    P+   K
Sbjct: 182 GTLALFTPYAYKK 194


>gnl|CDD|199875 cd06905, M14-like_8, Peptidase M14-like domain; uncharacterized
           subfamily.  A functionally uncharacterized subgroup of
           the M14 family of metallocarboxypeptidases (MCPs). The
           M14 family are zinc-binding carboxypeptidases (CPs)
           which hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. Two major subfamilies of the
           M14 family, defined based on sequence and structural
           homology, are the A/B and N/E subfamilies. Enzymes
           belonging to the A/B subfamily are normally synthesized
           as inactive precursors containing preceding signal
           peptide, followed by an N-terminal pro-region linked to
           the enzyme; these proenzymes are called
           procarboxypeptidases. The A/B enzymes can be further
           divided based on their substrate specificity;
           Carboxypeptidase A-like (CPA-like) enzymes favor
           hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavages.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 360

 Score = 37.4 bits (87), Expect = 3e-04
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 14/69 (20%)

Query: 30  ANGVDLNRNFPDQFDSSSERREQ-----PLNVKKLEPETLAMISFIKNNPFV---LSGNL 81
             G+D NRNFP   D   E  +      P +    EPET A++ FI ++P +   +S + 
Sbjct: 207 LQGLDFNRNFP--VDWRPEGEQYGAGPFPFS----EPETRAVVDFITDHPNINGAISYHT 260

Query: 82  HGGAIVASY 90
             G I+  Y
Sbjct: 261 FSGVILRPY 269


>gnl|CDD|199844 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypeptidase subfamily
           A/B-like.  The Peptidase M14 Carboxypeptidase (CP) A/B
           subfamily is one of two main M14 CP subfamilies defined
           by sequence and structural homology, the other being the
           N/E subfamily. CPs hydrolyze single, C-terminal amino
           acids from polypeptide chains. They have a recognition
           site for the free C-terminal carboxyl group, which is a
           key determinant of specificity. Enzymes belonging to the
           A/B subfamily are normally synthesized as inactive
           precursors containing preceding signal peptide, followed
           by a globular N-terminal pro-region linked to the
           enzyme; these proenzymes are called
           procarboxypeptidases. The A/B enzymes can be further
           divided based on their substrate specificity;
           Carboxypeptidase A-like (CPA-like) enzymes favor
           hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. There are nine members in the A/B family:
           CPA1, CPA2, CPA3, CPA4, CPA5, CPA6, CPB, CPO and CPU.
           CPA1, CPA2 and CPB are produced by the pancreas. The A
           forms have slightly different specificities, with CPA1
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulkier aromatic side chains. CPA3
           is found in secretory granules of mast cells and
           functions in inflammatory processes. CPA4 is detected in
           hormone-regulated tissues, and is thought to play a role
           in prostate cancer. CPA5 is present in discrete regions
           of pituitary and other tissues, and cleaves aliphatic
           C-terminal residues. CPA6 is highly expressed in
           embryonic brain and optic muscle, suggesting that it may
           play a specific role in cell migration and axonal
           guidance. CPU (also called CPB2) is produced and
           secreted by the liver as the inactive precursor, PCPU,
           commonly referred to as thrombin-activatable
           fibrinolysis inhibitor (TAFI). Little is known about CPO
           but it has been suggested to have specificity for acidic
           residues.
          Length = 293

 Score = 37.5 bits (88), Expect = 3e-04
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 13/52 (25%)

Query: 32  GVDLNRNFPDQFD---SSSE------RREQPLNVKKLEPETLAMISFIKNNP 74
           GVDLNRNF   +    +SS             +    EPET A+  F+ +  
Sbjct: 127 GVDLNRNFDFHWGGEGASSNPCSETYAGPSAFS----EPETRAVRDFLLSLA 174


>gnl|CDD|220930 pfam10994, DUF2817, Protein of unknown function (DUF2817).  This
           family of proteins has no known function.
          Length = 341

 Score = 33.8 bits (78), Expect = 0.006
 Identities = 11/15 (73%), Positives = 11/15 (73%)

Query: 27  RNNANGVDLNRNFPD 41
           R N N VDLNRNF D
Sbjct: 106 RVNENNVDLNRNFLD 120


>gnl|CDD|133091 cd06233, M14-like_6, Peptidase M14-like domain; uncharacterized
           subfamily.  Peptidase M14-like domain of a functionally
           uncharacterized subgroup of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. Two major subfamilies of the M14 family,
           defined based on sequence and structural homology, are
           the A/B and N/E subfamilies. Enzymes belonging to the
           A/B subfamily are normally synthesized as inactive
           precursors containing preceding signal peptide, followed
           by an N-terminal pro-region linked to the enzyme; these
           proenzymes are called procarboxypeptidases. The A/B
           enzymes can be further divided based on their substrate
           specificity; Carboxypeptidase A-like (CPA-like) enzymes
           favor hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavages.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 283

 Score = 33.8 bits (78), Expect = 0.006
 Identities = 11/15 (73%), Positives = 11/15 (73%)

Query: 27  RNNANGVDLNRNFPD 41
           R N N VDLNRNF D
Sbjct: 106 RVNENNVDLNRNFLD 120


>gnl|CDD|199843 cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T subfamily.
           Peptidase M14-like domain of carboxypeptidase (CP) T
           (CPT), CPT belongs to the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPT has
           moderate similarity to CPA and CPB, and exhibits
           dual-substrate specificity by cleaving C-terminal
           hydrophobic amino acid residues like CPA and C-terminal
           positively charged residues like CPB. CPA and CPB are
           M14 family peptidases but do not belong to this CPT
           group. The substrate specificity difference between CPT
           and CPA and CPB is ascribed to a few amino acid
           substitutions at the substrate-binding pocket while the
           spatial organization of the binding site remains the
           same as in all Zn-CPs. CPT has increased thermal
           stability in presence of Ca2+ ions, and two disulfide
           bridges which give an additional stabilization factor.
          Length = 297

 Score = 32.7 bits (75), Expect = 0.013
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 22/74 (29%)

Query: 27  RNNAN------GVDLNRNFPDQFDSSSE-----------RREQPLNVKKLEPETLAMISF 69
           R N+       GVDLNRN+  ++   S            R     +    EPET A+  F
Sbjct: 128 RPNSGDISSSDGVDLNRNYGYKWGCDSGGSSSDPSSETYRGPSAFS----EPETQAIRDF 183

Query: 70  IKNNP-FVLSGNLH 82
           ++++     + N H
Sbjct: 184 VESHVNIKTAINYH 197


>gnl|CDD|199869 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxypeptidase
           subfamily A/B-like; uncharacterized subgroup.  The
           Peptidase M14 Carboxypeptidase A/B-like subfamily is one
           of two main M14 carboxypeptidase subfamilies, defined by
           sequence and structural homology, the other being N/E.
           Carboxypeptidases (CPs) hydrolyze single, C-terminal
           amino acids from polypeptide chains. They have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. Majority of
           the proteins in this subfamily have not been
           characterized as yet. The A/B enzymes are normally
           synthesized as inactive precursors containing preceding
           signal peptide, followed by a globular N-terminal
           pro-region linked to the enzyme; the proenzymes are
           called procarboxypeptidases. These enzymes exhibit
           distinct substrate specificity pattern; Carboxypeptidase
           A-like (CPA-like) enzymes favor hydrophobic residues
           while carboxypeptidase B-like (CPB-like) enzymes only
           cleave the basic residues lysine or arginine. There are
           nine members in the A/B family: CPA1, CPA2, CPA3, CPA4,
           CPA5, CPA6, CPB, CPO and CPU.  CPA1, CPA2 and CPB are
           produced by the pancreas. The A forms have slightly
           different specificities, with CPA1 preferring aliphatic
           and small aromatic residues, and CPA2 preferring the
           bulkier aromatic side chains. CPA3 is found in secretory
           granules of mast cells and functions in inflammatory
           processes. CPA4, detected in hormone-regulated tissues,
           is thought to play a role in prostate cancer. CPA5 is
           present in discrete regions of pituitary and other
           tissues, and cleaves aliphatic C-terminal residues. CPA6
           is highly expressed in embryonic brain and optic muscle,
           suggesting that it may play a specific role in cell
           migration and axonal guidance. CPU (also called CPB2) is
           produced and secreted by the liver as the inactive
           precursor PCPU, commonly referred to as
           thrombin-activatable fibrinolysis inhibitor (TAFI).
           Little is known about CPO but it has been suggested to
           have specificity for acidic residues.
          Length = 303

 Score = 29.9 bits (68), Expect = 0.14
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 13/50 (26%)

Query: 32  GVDLNRNFPDQFDSS-------SE--RREQPLNVKKLEPETLAMISFIKN 72
           G DLNRN+P Q+D         SE  R E P +     PE  A+ +F+  
Sbjct: 134 GTDLNRNWPYQWDGGGSSTNPCSETYRGESPGDA----PEAKALAAFLNK 179


>gnl|CDD|199863 cd06239, M14-like_1_2, Peptidase M14-like domain; uncharacterized
           subgroup.  Peptidase M14-like domain of a functionally
           uncharacterized subgroup of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. Two major subfamilies of the M14 family,
           defined based on sequence and structural homology, are
           the A/B and N/E subfamilies. Enzymes belonging to the
           A/B subfamily are normally synthesized as inactive
           precursors containing preceding signal peptide, followed
           by an N-terminal pro-region linked to the enzyme; these
           proenzymes are called procarboxypeptidases. The A/B
           enzymes can be further divided based on their substrate
           specificity; Carboxypeptidase A-like (CPA-like) enzymes
           favor hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavage.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 231

 Score = 29.6 bits (67), Expect = 0.16
 Identities = 10/15 (66%), Positives = 12/15 (80%)

Query: 27  RNNANGVDLNRNFPD 41
           R NANG+DLNR+  D
Sbjct: 93  RVNANGIDLNRDAQD 107


>gnl|CDD|199866 cd06244, M14-like_1_7, Peptidase M14-like domain; uncharacterized
           subgroup.  Peptidase M14-like domain of a functionally
           uncharacterized subgroup of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. Two major subfamilies of the M14 family,
           defined based on sequence and structural homology, are
           the A/B and N/E subfamilies. Enzymes belonging to the
           A/B subfamily are normally synthesized as inactive
           precursors containing preceding signal peptide, followed
           by an N-terminal pro-region linked to the enzyme; these
           proenzymes are called procarboxypeptidases. The A/B
           enzymes can be further divided based on their substrate
           specificity; Carboxypeptidase A-like (CPA-like) enzymes
           favor hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavages.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 268

 Score = 29.1 bits (65), Expect = 0.31
 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 19/67 (28%)

Query: 19  NSLARFVG-RNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPETLAMISFI-KNNPFV 76
           N   R    R N+NG DLNR+   Q                 +PET  M++ I + NP  
Sbjct: 119 NPDGRTYLTRENSNGFDLNRDNSFQ----------------TQPETQNMVALIAEWNPMS 162

Query: 77  LSGNLHG 83
              +LHG
Sbjct: 163 FL-DLHG 168


>gnl|CDD|199861 cd06237, M14_Nna1_like_3, Peptidase M14-like domain of ATP/GTP
           binding proteins and cytosolic carboxypeptidases;
           uncharacterized bacterial subgroup.  A bacterial
           subgroup of the Peptidase M14-like domain of Nna-1
           (Nervous system Nuclear protein induced by Axotomy),
           also known as ATP/GTP binding protein (AGTPBP-1) and
           cytosolic carboxypeptidase (CCP),-like proteins. The
           Peptidase M14 family of metallocarboxypeptidases are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. Nna1-like proteins are active
           metallopeptidases that are thought to act on cytosolic
           proteins (such as alpha-tubulin in eukaryotes) to remove
           a C-terminal tyrosine. Nna1-like proteins from the
           different phyla are highly diverse, but they all contain
           a unique N-terminal conserved domain right before the CP
           domain. It has been suggested that this N-terminal
           domain might act as a folding domain.
          Length = 245

 Score = 28.6 bits (64), Expect = 0.45
 Identities = 10/12 (83%), Positives = 12/12 (100%)

Query: 27  RNNANGVDLNRN 38
           R+NANGVDLNR+
Sbjct: 112 RHNANGVDLNRD 123


>gnl|CDD|225421 COG2866, COG2866, Predicted carboxypeptidase [Amino acid transport
           and metabolism].
          Length = 374

 Score = 28.6 bits (64), Expect = 0.47
 Identities = 12/15 (80%), Positives = 12/15 (80%)

Query: 27  RNNANGVDLNRNFPD 41
           R NANGVDLNRNF  
Sbjct: 208 RTNANGVDLNRNFIA 222


>gnl|CDD|199868 cd06246, M14_CPB2, Peptidase M14 carboxypeptidase subfamily
           A/B-like; Carboxypeptidase B2 subgroup.  Peptidase M14
           Carboxypeptidase (CP) B2 (CPB2, also known as plasma
           carboxypeptidase B, carboxypeptidase U, and CPU),
           belongs to the carboxpeptidase A/B subfamily of the M14
           family of metallocarboxypeptidases (MCPs). The M14
           family are zinc-binding CPs which hydrolyze single,
           C-terminal amino acids from polypeptide chains, and have
           a recognition site for the free C-terminal carboxyl
           group, which is a key determinant of specificity. CPB2
           enzyme displays B-like activity; it only cleaves the
           basic residues lysine or arginine. It is produced and
           secreted by the liver as the inactive precursor,
           procarboxypeptidase U or PCPB2, commonly referred to as
           thrombin-activatable fibrinolysis inhibitor (TAFI). It
           circulates in plasma as a zymogen bound to plasminogen,
           and the active enzyme, TAFIa, inhibits fibrinolysis. It
           is highly regulated, increased TAFI concentrations are
           thought to increase the risk of thrombosis and coronary
           artery disease by reducing fibrinolytic activity while
           low TAFI levels have been correlated with chronic liver
           disease.
          Length = 302

 Score = 28.3 bits (63), Expect = 0.61
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 10/55 (18%)

Query: 27  RNNANGVDLNRNFPDQF--------DSSSERREQPLNVKKLEPETLAMISFIKNN 73
            N+  G DLNRNF  +          S SE         + EPE  A+ SF++ N
Sbjct: 129 NNHCIGTDLNRNFASKHWCEEGASSSSCSETYCGLY--PESEPEVKAVASFLRRN 181


>gnl|CDD|133105 cd06247, M14_CPO, Peptidase M14 carboxypeptidase subfamily
           A/B-like; Carboxypeptidase O subgroup.  Peptidase M14
           carboxypeptidase (CP) O (CPO, also known as
           metallocarboxypeptidase C; EC 3.4.17.) belongs to the
           carboxypeptidase A/B subfamily of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding CPs which hydrolyze single, C-terminal
           amino acids from polypeptide chains, and have a
           recognition site for the free C-terminal carboxyl group,
           which is a key determinant of specificity. CPO has not
           been well characterized as yet, and little is known
           about it. Based on modeling studies, CPO has been
           suggested to have specificity for acidic residues rather
           than aliphatic/aromatic residues as in A-like enzymes or
           basic residues as in B-like enzymes. It remains to be
           demonstrated that CPO is functional as an MCP.
          Length = 298

 Score = 27.5 bits (61), Expect = 0.85
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 32  GVDLNRNFPDQFDSSSERREQPLNV-----KKLEPETLAMISFI 70
           GVDLNRNF  Q+ S    R    N+      + EPET A+   I
Sbjct: 133 GVDLNRNFNSQWCSIGASRNCRSNIFCGTGPESEPETKAVARLI 176


>gnl|CDD|199857 cd06231, M14-like_4, Peptidase M14-like domain; uncharacterized
           subfamily.  A functionally uncharacterized subgroup of
           the M14 family of metallocarboxypeptidases (MCPs). The
           M14 family are zinc-binding carboxypeptidases (CPs)
           which hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. Two major subfamilies of the
           M14 family, defined based on sequence and structural
           homology, are the A/B and N/E subfamilies. Enzymes
           belonging to the A/B subfamily are normally synthesized
           as inactive precursors containing preceding signal
           peptide, followed by an N-terminal pro-region linked to
           the enzyme; these proenzymes are called
           procarboxypeptidases. The A/B enzymes can be further
           divided based on their substrate specificity;
           Carboxypeptidase A-like (CPA-like) enzymes favor
           hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavages.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 234

 Score = 27.0 bits (60), Expect = 1.6
 Identities = 7/13 (53%), Positives = 8/13 (61%)

Query: 27  RNNANGVDLNRNF 39
           R N  G D NR+F
Sbjct: 95  RWNPTGEDPNRSF 107


>gnl|CDD|226352 COG3831, COG3831, Uncharacterized conserved protein [Function
          unknown].
          Length = 85

 Score = 25.8 bits (57), Expect = 1.8
 Identities = 13/52 (25%), Positives = 18/52 (34%), Gaps = 7/52 (13%)

Query: 2  FKYCDCKSN-----WLPYEGSCNSLARFVGRNNANGVDLNRNFPDQFDSSSE 48
           +  D K N      +  EG    L R  GR    G    ++F D  D+   
Sbjct: 5  LERIDEKRNMAKFYAVEIEG--AELTRNWGRIGTKGQSQIKSFDDSADAEKA 54


>gnl|CDD|199870 cd06250, M14_PaAOTO_like, Peptidase M14 Succinylglutamate
           desuccinylase (ASTE)/aspartoacylase (ASPA)-like
           subfamily; subgroup includes Pseudomonas aeruginosa
           AotO.  An uncharacterized subgroup of the
           Succinylglutamate desuccinylase (ASTE)/aspartoacylase
           (ASPA) subfamily which is part of the the M14 family of
           metallocarboxypeptidases. This subgroup includes
           Pseudomonas aeruginosa AotO and related proteins. ASTE
           catalyzes the fifth and last step in arginine catabolism
           by the arginine succinyltransferase pathway, and
           aspartoacylase (ASPA, also known as aminoacylase 2, and
           ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid
           (NAA) into aspartate and acetate. NAA is abundant in the
           brain, and hydrolysis of NAA by ASPA may help maintain
           white matter. ASPA is an NAA scavenger in other tissues.
           Mutations in the gene encoding ASPA cause Canavan
           disease (CD), a fatal progressive neurodegenerative
           disorder involving dysmyelination and spongiform
           degeneration of white matter in children. This enzyme
           binds zinc which is necessary for activity. Measurement
           of elevated NAA levels in urine is used in the diagnosis
           of CD. The gene encoding P. aeruginosa AotO was
           characterized as part of an operon encoding an arginine
           and ornithine transport system, however it is not
           essential for arginine and ornithine uptake.
          Length = 359

 Score = 26.8 bits (60), Expect = 1.9
 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 3/22 (13%)

Query: 20  SLARFVGRNNANGVDLNRNFPD 41
            L RF   + A G + NRNFPD
Sbjct: 86  HLGRF---DLATGTNFNRNFPD 104


>gnl|CDD|133084 cd06226, M14_CPT_like, Peptidase M14 Carboxypeptidase T-like
           subfamily.  Peptidase M14-like domain of an
           uncharacterized group of Peptidase M14 Carboxypeptidase
           (CP) T (CPT)-like proteins. This group belongs to the
           M14 family of metallocarboxypeptidases (MCPs). The M14
           family are zinc-binding CPs which hydrolyze single,
           C-terminal amino acids from polypeptide chains, and have
           a recognition site for the free C-terminal carboxyl
           group, which is a key determinant of specificity. CPT
           exhibits dual-substrate specificity by cleaving
           C-terminal hydrophobic amino acid residues and
           C-terminal positively charged residues. However, CPT
           does not belong to this CPT-like group.
          Length = 293

 Score = 26.6 bits (59), Expect = 2.0
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 14/50 (28%)

Query: 32  GVDLNRNFPDQF--------DSSSE--RREQPLNVKKLEPETLAMISFIK 71
           GVDLNRN+   +        D  SE  R   P +    EPET A+  +I+
Sbjct: 126 GVDLNRNYSFGWGGAGASSGDPCSETYRGPAPGS----EPETAALEDYIR 171


>gnl|CDD|199856 cd06230, M14_ASTE_ASPA_like, Peptidase M14 Succinylglutamate
          desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily.
          The Peptidase M14 Succinylglutamate desuccinylase
          (ASTE)/aspartoacylase (ASPA) subfamily belongs to the
          M14 family of metallocarboxypeptidases (MCPs), and
          includes ASTE, which catalyzes the fifth and last step
          in arginine catabolism by the arginine
          succinyltransferase pathway, and aspartoacylase (ASPA,
          also known as aminoacylase 2, and ACY-2; EC:3.5.1.15)
          which cleaves N-acetyl L-aspartic acid (NAA) into
          aspartate and acetate. NAA is abundant in the brain,
          and hydrolysis of NAA by ASPA may help maintain white
          matter. ASPA is an NAA scavenger in other tissues.
          Mutations in the gene encoding ASPA cause Canavan
          disease (CD), a fatal progressive neurodegenerative
          disorder involving dysmyelination and spongiform
          degeneration of white matter in children. This enzyme
          binds zinc which is necessary for activity. Measurement
          of elevated NAA levels in urine is used in the
          diagnosis of CD.
          Length = 254

 Score = 26.6 bits (59), Expect = 2.3
 Identities = 9/20 (45%), Positives = 10/20 (50%), Gaps = 1/20 (5%)

Query: 34 DLNRNFP-DQFDSSSERREQ 52
          DLNR FP D    + E R  
Sbjct: 56 DLNRIFPGDPLSGTPEDRLA 75


>gnl|CDD|133081 cd03870, M14_CPA, Peptidase M14 carboxypeptidase subfamily
           A/B-like; Carboxypeptidase A subgroup.  Peptidase M14
           Carboxypeptidase (CP) A (CPA) belongs to the A/B
           subfamily of the M14 family of metallocarboxypeptidases
           (MCPs). The M14 family are zinc-binding CPs which
           hydrolyze single, C-terminal amino acids from
           polypeptide chains, and have a recognition site for the
           free C-terminal carboxyl group, which is a key
           determinant of specificity. CPA enzymes generally favor
           hydrophobic residues. A/B subfamily enzymes are normally
           synthesized as inactive precursors containing preceding
           signal peptide, followed by a globular N-terminal
           pro-region linked to the enzyme; these proenzymes are
           called procarboxypeptidases. The procarboxypeptidase A
           (PCPA) is produced by the exocrine pancreas and stored
           as a stable zymogen in the pancreatic granules until
           secretion into the digestive tract occurs. This
           subfamily includes CPA1, CPA2 and CPA4 forms. Within
           these A forms, there are slightly different
           specificities, with CPA1 preferring aliphatic and small
           aromatic residues, and CPA2 preferring the bulkier
           aromatic side chains. CPA4, detected in
           hormone-regulated tissues, is thought to play a role in
           prostate cancer.
          Length = 301

 Score = 26.3 bits (58), Expect = 2.4
 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 14/66 (21%)

Query: 32  GVDLNRNFPDQF-------DSSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGG 84
           GVD NRN+   F       +  SE           E E  +++ F+K++     GN    
Sbjct: 134 GVDPNRNWDAGFGGAGASSNPCSETYHGK--YANSEVEVKSIVDFVKSH-----GNFKAF 186

Query: 85  AIVASY 90
             + SY
Sbjct: 187 ISIHSY 192


>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component
           [Posttranslational modification, protein turnover,
           chaperones].
          Length = 926

 Score = 26.5 bits (58), Expect = 2.4
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 45  SSSERREQPLNVKKLEPETLAMISFIKNNPFVLSGNLHGGAIV 87
              ++  +  N+ ++ P+    ISFIK++ FV      GG +V
Sbjct: 843 VKKKKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGGVVV 885


>gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional.
          Length = 593

 Score = 25.7 bits (57), Expect = 4.6
 Identities = 9/17 (52%), Positives = 11/17 (64%)

Query: 23  RFVGRNNANGVDLNRNF 39
           RFV R   NG+D+ R F
Sbjct: 101 RFVERAVKNGMDVFRVF 117


>gnl|CDD|133069 cd03857, M14-like_1, Peptidase M14-like domain; uncharacterized
           subfamily.  Peptidase M14-like domain of a functionally
           uncharacterized subgroup of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. Two major subfamilies of the M14 family,
           defined based on sequence and structural homology, are
           the A/B and N/E subfamilies. Enzymes belonging to the
           A/B subfamily are normally synthesized as inactive
           precursors containing preceding signal peptide, followed
           by an N-terminal pro-region linked to the enzyme; these
           proenzymes are called procarboxypeptidases. The A/B
           enzymes can be further divided based on their substrate
           specificity; Carboxypeptidase A-like (CPA-like) enzymes
           favor hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavage.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 226

 Score = 25.1 bits (55), Expect = 6.8
 Identities = 11/18 (61%), Positives = 13/18 (72%)

Query: 22  ARFVGRNNANGVDLNRNF 39
           A    R NANG+DLNR+F
Sbjct: 85  AALFTRENANGLDLNRDF 102


>gnl|CDD|199873 cd06254, M14_ASTE_ASPA_like_4, Peptidase M14 Succinylglutamate
          desuccinylase (ASTE)/aspartoacylase (ASPA)-like;
          uncharacterized subgroup.  A functionally
          uncharacterized subgroup of the Succinylglutamate
          desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily
          which is part of the M14 family of
          metallocarboxypeptidases. ASTE catalyzes the fifth and
          last step in arginine catabolism by the arginine
          succinyltransferase pathway, and aspartoacylase (ASPA,
          also known as aminoacylase 2, and ACY-2; EC:3.5.1.15)
          cleaves N-acetyl L-aspartic acid (NAA) into aspartate
          and acetate. NAA is abundant in the brain, and
          hydrolysis of NAA by ASPA may help maintain white
          matter. ASPA is an NAA scavenger in other tissues.
          Mutations in the gene encoding ASPA cause Canavan
          disease (CD), a fatal progressive neurodegenerative
          disorder involving dysmyelination and spongiform
          degeneration of white matter in children. This enzyme
          binds zinc which is necessary for activity. Measurement
          of elevated NAA levels in urine is used in the
          diagnosis of CD.
          Length = 291

 Score = 24.9 bits (55), Expect = 7.6
 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 21 LARFVGRNNANGVDLNRNFPDQFDSS-SER 49
           AR       +G +LNR FP   + + +ER
Sbjct: 65 YARTPYLVPEDGKNLNRVFPGDKNGTLTER 94


>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein
           kinase; Provisional.
          Length = 968

 Score = 25.2 bits (55), Expect = 8.2
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 16  GSCNSLARFVGRNNANGVDLNRNFPDQ-----FDSSSERREQPLNVKKLEPETLAMISFI 70
           G+C SL R   ++N+   +L   F         D S+   +  +N +K +  +L M+S  
Sbjct: 401 GACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLA 460

Query: 71  KNNPFVLSGNL 81
           +N      G L
Sbjct: 461 RNK---FFGGL 468


>gnl|CDD|225333 COG2706, COG2706, 3-carboxymuconate cyclase [Carbohydrate transport
           and metabolism].
          Length = 346

 Score = 25.0 bits (55), Expect = 8.2
 Identities = 9/28 (32%), Positives = 13/28 (46%), Gaps = 1/28 (3%)

Query: 67  ISFIKNNPFVLSGNLHGGAIVASYPFDD 94
           +S  ++  FV   N H G  V+ YP   
Sbjct: 94  VSVDEDGRFVFVANYHSG-SVSVYPLQA 120


>gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human
           Nna1/AGTPBP-1, AGBL2 -5, and related proteins.  Subgroup
           of the Peptidase M14-like domain of Nna-1 (Nervous
           system Nuclear protein induced by Axotomy), also known
           as ATP/GTP binding protein (AGTPBP-1) and cytosolic
           carboxypeptidase (CCP), and related proteins. The
           Peptidase M14 family of metallocarboxypeptidases are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. This eukaryotic subgroup includes the human
           Nna1/AGTPBP-1 and AGBL -2, -3, -4, and -5, and the mouse
           Nna1/CCP-1 and CCP -2 through -6. Nna1-like proteins are
           active metallopeptidases that are thought to act on
           cytosolic proteins such as alpha-tubulin, to remove a
           C-terminal tyrosine. Nna1 is widely expressed in the
           developing and adult nervous systems, including
           cerebellar Purkinje and granule neurons, miral cells of
           the olfactory bulb and retinal photoreceptors. Nna1 is
           also induced in axotomized motor neurons. Mutations in
           Nna1 cause Purkinje cell degeneration (pcd). The Nna1 CP
           domain is required to prevent the retinal photoreceptor
           loss and cerebellar ataxia phenotypes of pcd mice, and a
           functional zinc-binding domain is needed for Nna-1 to
           support neuron survival in these mice. Nna1-like
           proteins from the different phyla are highly diverse,
           but they all contain a unique N-terminal conserved
           domain right before the CP domain. It has been suggested
           that this N-terminal domain might act as a folding
           domain.
          Length = 258

 Score = 24.9 bits (55), Expect = 8.3
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 17/61 (27%)

Query: 27  RNNANGVDLNRNFPDQFDSSSERREQPLNVKKLEPE---TLAMIS-FIKNNPFVLSGNLH 82
           R + +G+DLNR +           + P   KKL PE      +I    +    +L  +LH
Sbjct: 105 RCSLSGIDLNRQW-----------KNPD--KKLHPEIYSVKQLIKKLSQERNIILFIDLH 151

Query: 83  G 83
           G
Sbjct: 152 G 152


>gnl|CDD|182458 PRK10435, cadB, lysine/cadaverine antiporter; Provisional.
          Length = 435

 Score = 25.1 bits (55), Expect = 8.4
 Identities = 13/24 (54%), Positives = 13/24 (54%)

Query: 12  LPYEGSCNSLARFVGRNNANGVDL 35
           LPY  SC  L RF G N  N V L
Sbjct: 364 LPYFYSCVDLIRFEGVNIRNFVSL 387


>gnl|CDD|219355 pfam07267, Nucleo_P87, Nucleopolyhedrovirus capsid protein P87.
           This family consists of several Nucleopolyhedrovirus
           capsid protein P87 sequences. P87 is expressed late in
           infection and concentrated in infected cell nuclei.
          Length = 606

 Score = 24.8 bits (54), Expect = 8.6
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 1   MFKYCDCKS--NWLPYEGSCNSLARFVGRNNANGVDLNRNF 39
            + YC+CK+  N  P   +   L + +   N + V++  NF
Sbjct: 430 TYDYCNCKNTINGTPSAANFVKLLKRLNTYNLSHVEMTVNF 470


>gnl|CDD|216480 pfam01403, Sema, Sema domain.  The Sema domain occurs in
           semaphorins, which are a large family of secreted and
           transmembrane proteins, some of which function as
           repellent signals during axon guidance. Sema domains
           also occur in the hepatocyte growth factor receptor and
           human plexin A-3.
          Length = 435

 Score = 25.0 bits (55), Expect = 8.7
 Identities = 13/68 (19%), Positives = 21/68 (30%), Gaps = 11/68 (16%)

Query: 1   MFKYCD-CKSNWLPYE--------GSCNSLARFVGRNNANGVDLNRNFPDQFDSSSERRE 51
            FK+ +   S WLPY         G C + +     ++           D+         
Sbjct: 298 PFKHQEGPNSKWLPYRGKVPYPRPGQCPNASNGDLPDDTLNFIRCHPLMDEVVPPLHNV- 356

Query: 52  QPLNVKKL 59
            PL V + 
Sbjct: 357 -PLFVGQS 363


>gnl|CDD|199865 cd06241, M14-like_1_4, Peptidase M14-like domain; uncharacterized
           subgroup.  Peptidase M14-like domain of a functionally
           uncharacterized subgroup of the M14 family of
           metallocarboxypeptidases (MCPs). The M14 family are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. Two major subfamilies of the M14 family,
           defined based on sequence and structural homology, are
           the A/B and N/E subfamilies. Enzymes belonging to the
           A/B subfamily are normally synthesized as inactive
           precursors containing preceding signal peptide, followed
           by an N-terminal pro-region linked to the enzyme; these
           proenzymes are called procarboxypeptidases. The A/B
           enzymes can be further divided based on their substrate
           specificity; Carboxypeptidase A-like (CPA-like) enzymes
           favor hydrophobic residues while carboxypeptidase B-like
           (CPB-like) enzymes only cleave the basic residues lysine
           or arginine. The A forms have slightly different
           specificities, with Carboxypeptidase A1 (CPA1)
           preferring aliphatic and small aromatic residues, and
           CPA2 preferring the bulky aromatic side chains. Enzymes
           belonging to the N/E subfamily enzymes are not produced
           as inactive precursors and instead rely on their
           substrate specificity and subcellular
           compartmentalization to prevent inappropriate cleavage.
           They contain an extra C-terminal transthyretin-like
           domain, thought to be involved in folding or formation
           of oligomers.  MCPs can also be classified based on
           their involvement in specific physiological processes;
           the pancreatic MCPs participate only in alimentary
           digestion and include carboxypeptidase A and B (A/B
           subfamily), while others, namely regulatory MCPs or the
           N/E subfamily, are involved in more selective reactions,
           mainly in non-digestive tissues and fluids, acting on
           blood coagulation/fibrinolysis, inflammation and local
           anaphylaxis, pro-hormone and neuropeptide processing,
           cellular response and others.   Another MCP subfamily,
           is that of succinylglutamate desuccinylase
           /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate
           (NAA), and deficiency in which is the established cause
           of Canavan disease. Another subfamily (referred to as
           subfamily C) includes an exceptional type of activity in
           the MCP family, that of dipeptidyl-peptidase activity of
           gamma-glutamyl-(L)-meso-diaminopimelate peptidase I
           which is involved in bacterial cell wall metabolism.
          Length = 266

 Score = 24.6 bits (54), Expect = 8.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)

Query: 27  RNNANGVDLNRNF 39
           R NA  ++LNR+F
Sbjct: 120 RGNARNLNLNRDF 132


>gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family
           18) type II chitinases hydrolyze chitin, an abundant
           polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc)
           which is a major component of the cell wall of fungi and
           the exoskeleton of arthropods.  Chitinases have been
           identified in viruses, bacteria, fungi, protozoan
           parasites, insects, and plants. The structure of the
           GH18 domain is an eight-stranded beta/alpha barrel with
           a pronounced active-site cleft at the C-terminal end of
           the beta-barrel.  The GH18 family includes
           chitotriosidase, chitobiase, hevamine, zymocin-alpha,
           narbonin, SI-CLP (stabilin-1 interacting chitinase-like
           protein), IDGF (imaginal disc growth factor), CFLE
           (cortical fragment-lytic enzyme) spore hydrolase, the
           type III and type V plant chitinases, the
           endo-beta-N-acetylglucosaminidases, and the
           chitolectins.  The GH85 (glycosyl hydrolase, family 85)
           ENGases (endo-beta-N-acetylglucosaminidases) are closely
           related to the GH18 chitinases and are included in this
           alignment model.
          Length = 210

 Score = 24.6 bits (54), Expect = 9.3
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 19  NSLARFVGRNNANGVDLNRNFPDQFDSSS 47
           NSL  F+     +GVD++  +P   D+S 
Sbjct: 94  NSLVSFLKTYGFDGVDIDWEYPGAADNSD 122


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0716    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,785,118
Number of extensions: 371185
Number of successful extensions: 414
Number of sequences better than 10.0: 1
Number of HSP's gapped: 396
Number of HSP's successfully gapped: 52
Length of query: 96
Length of database: 10,937,602
Length adjustment: 63
Effective length of query: 33
Effective length of database: 8,143,300
Effective search space: 268728900
Effective search space used: 268728900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.2 bits)