RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17425
         (84 letters)



>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 39.4 bits (93), Expect = 4e-05
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           + KDL+ K+L+ D  KRL   +AL HPF 
Sbjct: 226 EAKDLIRKLLVKDPEKRLTAEEALQHPFF 254


>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 1.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates. JNK1
           specifically binds with JAMP (JNK1-associated membrane
           protein), which regulates the duration of JNK1 activity
           in response to stimuli. Specific JNK1 substrates include
           Itch and SG10, which are implicated in Th2 responses and
           airway inflammation, and microtubule dynamics and
           axodendritic length, respectively. Mice deficient in
           Jnk1 are protected against arthritis, obesity, type 2
           diabetes, cardiac cell death, and non-alcoholic liver
           disease, suggesting that JNK1 may play roles in the
           pathogenesis of these diseases.
          Length = 364

 Score = 38.9 bits (90), Expect = 7e-05
 Identities = 16/32 (50%), Positives = 25/32 (78%)

Query: 49  KVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           K  Q +DLL K+L++D SKR+ +++AL HP+I
Sbjct: 290 KASQARDLLSKMLVIDASKRISVDEALQHPYI 321


>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase,
           c-Jun N-terminal Kinase.  Serine/Threonine Kinases
           (STKs), c-Jun N-terminal kinase (JNK) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The JNK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. JNKs are
           mitogen-activated protein kinases (MAPKs) that are
           involved in many stress-activated responses including
           those during inflammation, neurodegeneration, apoptosis,
           and persistent pain sensitization, among others. They
           are also essential regulators of physiological and
           pathological processes and are involved in the
           pathogenesis of several diseases such as diabetes,
           atherosclerosis, stroke, Parkinson's and Alzheimer's.
           Vetebrates harbor three different JNK genes (Jnk1, Jnk2,
           and Jnk3) that are alternatively spliced to produce at
           least 10 isoforms. JNKs are specifically activated by
           the MAPK kinases MKK4 and MKK7, which are in turn
           activated by upstream MAPK kinase kinases as a result of
           different stimuli including stresses such as ultraviolet
           (UV) irradiation, hyperosmolarity, heat shock, or
           cytokines. JNKs activate a large number of different
           substrates based on specific stimulus, cell type, and
           cellular condition, and may be implicated in seemingly
           contradictory functions.
          Length = 353

 Score = 38.5 bits (90), Expect = 1e-04
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 43  PDDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
                 K  Q +DLL K+L++D  KR+ ++ AL HP+I
Sbjct: 277 ESHNKLKASQARDLLSKMLVIDPEKRISVDDALQHPYI 314


>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 2.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates.  JNK2
           is specifically translocated to the mitochondria during
           dopaminergic cell death. Specific substrates include the
           microtubule-associated proteins DCX and Tau, as well as
           TIF-IA which is involved in ribosomal RNA synthesis
           regulation. Mice deficient in Jnk2 show protection
           against arthritis, type 1 diabetes, atherosclerosis,
           abdominal aortic aneurysm, cardiac cell death,
           TNF-induced liver damage, and tumor growth, indicating
           that JNK2 may play roles in the pathogenesis of these
           diseases.
          Length = 359

 Score = 38.1 bits (88), Expect = 1e-04
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 34  SELVGNQHLPDDQAR---KVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
            EL  +   P +  R   K  Q +DLL K+L++D  KR+ +++AL HP+I
Sbjct: 269 EELFPDWIFPSESERDKLKTSQARDLLSKMLVIDPDKRISVDEALRHPYI 318


>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 9.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 9 (CDK9) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK9 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK9
           together with a cyclin partner (cyclin T1, T2a, T2b, or
           K) is the main component of distinct positive
           transcription elongation factors (P-TEFb), which
           function as Ser2 C-terminal domain kinases of RNA
           polymerase II. P-TEFb participates in multiple steps of
           gene expression including transcription elongation, mRNA
           synthesis, processing, export, and translation. It also
           plays a role in mediating cytokine induced transcription
           networks such as IL6-induced STAT3 signaling. In
           addition, the CDK9/cyclin T2a complex promotes muscle
           differentiation and enhances the function of some
           myogenic regulatory factors.
          Length = 310

 Score = 37.4 bits (87), Expect = 2e-04
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 10/55 (18%)

Query: 35  ELVGNQHLPDDQARKV-LQLK---------DLLDKILMLDTSKRLPINQALTHPF 79
           EL     LP  Q RKV  +LK         DL+DK+L+LD +KR+  + AL H F
Sbjct: 255 ELFKKMELPQGQKRKVKERLKPYVKDPHALDLIDKLLVLDPAKRIDADTALNHDF 309


>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
           Serine/Threonine Kinase, p38delta Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38delta subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38delta subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38delta, also called MAPK13, is found in
           skeletal muscle, heart, lung, testis, pancreas, and
           small intestine. It regulates microtubule function by
           phosphorylating Tau. It activates the c-jun promoter and
           plays a role in G2 cell cycle arrest. It also controls
           the degration of c-Myb, which is associated with myeloid
           leukemia and poor prognosis in colorectal cancer.
           p38delta is the main isoform involved in regulating the
           differentiation and apoptosis of keratinocytes.
          Length = 342

 Score = 37.2 bits (86), Expect = 3e-04
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL+K+L LD  KRL   +AL HP+
Sbjct: 275 DLLEKMLELDVDKRLTATEALEHPY 299


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
           Kinase,  Extracellular signal-Regulated Kinase 5.
           Serine/Threonine Kinases (STKs), Extracellular
           signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ERK5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. ERK5, also called Big MAPK1
           (BMK1) or MAPK7, has a unique C-terminal extension,
           making it approximately twice as big as other MAPKs.
           This extension contains transcriptional activation
           capability which is inhibited by the N-terminal half.
           ERK5 is activated in response to growth factors and
           stress by a cascade that leads to its phosphorylation by
           the MAP2K MEK5, which in turn is regulated by the MAP3Ks
           MEKK2 and MEKK3. Activated ERK5 phosphorylates its
           targets including myocyte enhancer factor 2 (MEF2),
           Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
           cell proliferation during the G1/S phase transition.
           Studies on knockout mice revealed that ERK5 is essential
           for cardiovascular development and plays an important
           role in angiogenesis. It is also critical for neural
           differentiation and survival. The ERK5 pathway has been
           implicated in the pathogenesis of many diseases
           including cancer, cardiac hypertrophy, and
           atherosclerosis.
          Length = 334

 Score = 37.3 bits (87), Expect = 3e-04
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           +  DLL ++L  D  +R+ + QAL HPF+
Sbjct: 269 EALDLLSQMLQFDPEERITVEQALQHPFL 297


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase,
           p38 Mitogen-Activated Protein Kinase.  Serine/Threonine
           Kinases (STKs), p38 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The p38 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. p38 kinases are
           mitogen-activated protein kinases (MAPKs), serving as
           important mediators of cellular responses to
           extracellular signals. They function in the regulation
           of the cell cycle, cell development, cell
           differentiation, senescence, tumorigenesis, apoptosis,
           pain development and pain progression, and immune
           responses. p38 kinases are activated by the MAPK kinases
           MKK3 and MKK6, which in turn are activated by upstream
           MAPK kinase kinases including TAK1, ASK1, and MLK3, in
           response to cellular stresses or inflammatory cytokines.
           p38 substrates include other protein kinases and factors
           that regulate transcription, nuclear export, mRNA
           stability and translation. p38 kinases are drug targets
           for the inflammatory diseases psoriasis, rheumatoid
           arthritis, and chronic pulmonary disease. Vertebrates
           contain four isoforms of p38, named alpha, beta, gamma,
           and delta, which show varying substrate specificity and
           expression patterns. p38alpha and p38beta are
           ubiquitously expressed, p38gamma is predominantly found
           in skeletal muscle, and p38delta is found in the heart,
           lung, testis, pancreas, and small intestine.
          Length = 343

 Score = 36.5 bits (85), Expect = 5e-04
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFILE 82
           DLL+K+L+LD  KR+   +AL HP++ E
Sbjct: 276 DLLEKMLVLDPDKRITAAEALAHPYLAE 303


>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 3.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is
           expressed primarily in the brain, and to a lesser extent
           in the heart and testis. Mice deficient in Jnk3 are
           protected against kainic acid-induced seizures, stroke,
           sciatic axotomy neural death, and neuronal death due to
           NGF deprivation, oxidative stress, or exposure to
           beta-amyloid peptide. This suggests that JNK3 may play
           roles in the pathogenesis of these diseases.
          Length = 355

 Score = 36.6 bits (84), Expect = 5e-04
 Identities = 15/32 (46%), Positives = 25/32 (78%)

Query: 49  KVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           K  Q +DLL K+L++D +KR+ +++AL HP+I
Sbjct: 283 KASQARDLLSKMLVIDPAKRISVDEALQHPYI 314


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase (MAPK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The MAPK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAPKs serve as important
           mediators of cellular responses to extracellular
           signals. They control critical cellular functions
           including differentiation, proliferation, migration, and
           apoptosis. They are also implicated in the pathogenesis
           of many diseases including multiple types of cancer,
           stroke, diabetes, and chronic inflammation. Typical MAPK
           pathways involve a triple kinase core cascade comprising
           of the MAPK, which is phosphorylated and activated by a
           MAPK kinase (MAP2K or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAP3K or MKKK). Each cascade is activated either by a
           small GTP-binding protein or by an adaptor protein,
           which transmits the signal either directly to a MAP3K to
           start the triple kinase core cascade or indirectly
           through a mediator kinase, a MAP4K. There are three main
           typical MAPK subfamilies: Extracellular signal-Regulated
           Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
           Some MAPKs are atypical in that they are not regulated
           by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 35.6 bits (83), Expect = 0.001
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL+K+L+ D  KR+  ++AL HP+
Sbjct: 267 DLLEKMLVFDPKKRITADEALAHPY 291


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TEY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TEY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TEY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. There are two subtypes
           of plant MAPKs based on the conserved phosphorylation
           motif present in the activation loop, TEY and TDY. This
           subfamily represents the TEY subtype and is further
           subdivided into three groups (A, B, and C). Group A is
           represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
           (NtNTF4), among others. They are mostly involved in
           environmental and hormonal responses. AtMPK3 and  AtMPK6
           are also key regulators for stomatal development and
           patterning. Group B is represented by AtMPK4, AtMPK13,
           and NtNTF6, among others. They may be involved in both
           cell division and environmental stress response. AtMPK4
           also participates in regulating innate immunity. Group C
           is represented by AtMPK1, AtMPK2, NtNTF3, Oryza sativa
           MAPK4 (OsMAPK4), among others. They may also be involved
           in stress responses. AtMPK1 and AtMPK2 are activated
           following mechanical injury and in the presence of
           stress chemicals such as jasmonic acid, hydrogen
           peroxide and abscisic acid. OsMAPK4 is also called
           OsMSRMK3 for Multiple Stress-Responsive MAPK3.
          Length = 337

 Score = 35.4 bits (82), Expect = 0.001
 Identities = 13/26 (50%), Positives = 21/26 (80%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
           DLL+K+L+ D SKR+ + +AL HP++
Sbjct: 269 DLLEKMLVFDPSKRITVEEALAHPYL 294


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 9-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK9-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK9 and CDK12 from higher eukaryotes, yeast
           BUR1, C-type plant CDKs (CdkC), and similar proteins.
           CDK9, BUR1, and CdkC are functionally equivalent. They
           act as a kinase for the C-terminal domain of RNA
           polymerase II and participate in regulating mutliple
           steps of gene expression including transcription
           elongation and RNA processing. CDK9 and CdkC associate
           with T-type cyclins while BUR1 associates with the
           cyclin BUR2. CDK12 is a unique CDK that contains an
           arginine/serine-rich (RS) domain, which is predominantly
           found in splicing factors. CDK12 interacts with cyclins
           L1 and L2, and participates in regulating transcription
           and alternative splicing.
          Length = 287

 Score = 34.8 bits (81), Expect = 0.002
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
           DLLDK+L LD  KR+  +QAL H + 
Sbjct: 262 DLLDKLLTLDPKKRISADQALQHEYF 287


>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
           Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MPK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of the MAPKs MPK1 from Saccharomyces
           cerevisiae, Pmk1 from Schizosaccharomyces pombe, and
           similar proteins. MAPKs are important mediators of
           cellular responses to extracellular signals. MPK1 (also
           called Slt2) and Pmk1 (also called Spm1) are
           stress-activated MAPKs that regulate the cell wall
           integrity (CWI) pathway, and are therefore important in
           the maintainance of cell shape, cell wall construction,
           morphogenesis, and ion homeostasis. MPK1 is activated in
           response to cell wall stress including heat stimulation,
           osmotic shock, UV irradiation, and any agents that
           interfere with cell wall biogenesis such as chitin
           antagonists, caffeine, or zymolase. MPK1 is regulated by
           the MAP2Ks Mkk1/2, which are regulated by the MAP3K
           Bck1. Pmk1 is also activated by multiple stresses
           including elevated temperatures, hyper- or hypotonic
           stress, glucose deprivation, exposure to cell-wall
           damaging compounds, and oxidative stress. It is
           regulated by the MAP2K Pek1, which is regulated by the
           MAP3K Mkh1.
          Length = 332

 Score = 35.1 bits (81), Expect = 0.002
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
           DLL+K+L  D +KR+ + +AL HP++
Sbjct: 270 DLLEKLLAFDPTKRISVEEALEHPYL 295


>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 12.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 12 (CDK12) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK12 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK12 is also called Cdc2-related protein
           kinase 7 (CRK7) or Cdc2-related kinase
           arginine/serine-rich (CrkRS). It is a unique CDK that
           contains an arginine/serine-rich (RS) domain, which is
           predominantly found in splicing factors. CDK12 is widely
           expressed in tissues. It interacts with cyclins L1 and
           L2, and plays roles in regulating transcription and
           alternative splicing.
          Length = 302

 Score = 34.8 bits (80), Expect = 0.002
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 8/67 (11%)

Query: 15  PSQEKIVTMSTIHPTRDLHSELVGN-QHLPDDQARKVLQLKDLLDKILMLDTSKRLPINQ 73
           P   K+   +T+ P +     L      +P           DLLD +L LD SKR    +
Sbjct: 243 PDVIKLPYFNTMKPKKQYRRRLREEFSFIPTPAL-------DLLDHMLTLDPSKRCTAEE 295

Query: 74  ALTHPFI 80
           AL  P++
Sbjct: 296 ALNSPWL 302


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
           signal-Regulated Kinase 1 and 2-like Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), Extracellular
           signal-regulated kinases 1 and 2 (ERK1/2) and Fus3
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. This
           ERK1/2-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           the mitogen-activated protein kinases (MAPKs) ERK1,
           ERK2, baker's yeast Fus3, and similar proteins. MAPK
           pathways are important mediators of cellular responses
           to extracellular signals. ERK1/2 activation is
           preferentially by mitogenic factors, differentiation
           stimuli, and cytokines, through a kinase cascade
           involving the MAPK kinases MEK1/2 and a MAPK kinase
           kinase from the Raf family. ERK1/2 have numerous
           substrates, many of which are nuclear and participate in
           transcriptional regulation of many cellular processes.
           They regulate cell growth, cell proliferation, and cell
           cycle progression from G1 to S phase. Although the
           distinct roles of ERK1 and ERK2 have not been fully
           determined, it is known that ERK2 can maintain most
           functions in the absence of ERK1, and that the deletion
           of ERK2 is embryonically lethal. The MAPK, Fus3,
           regulates yeast mating processes including
           mating-specific gene expression, G1 arrest, mating
           projection, and cell fusion.
          Length = 336

 Score = 35.0 bits (81), Expect = 0.002
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
           DLLDK+L  +  KR+ + +AL HP++
Sbjct: 270 DLLDKMLTFNPHKRITVEEALAHPYL 295


>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the
           Serine/Threonine Kinase, p38beta Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38beta subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38beta subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38beta, also called MAPK11, is widely expressed
           in tissues and shows more similarity with p38alpha than
           with the other isoforms. Both are sensitive to
           pyridinylimidazoles and share some common substrates
           such as MAPK activated protein kinase 2 (MK2) and the
           transcription factors ATF2, c-Fos and, ELK-1. p38beta is
           involved in regulating the activation of the
           cyclooxygenase-2 promoter and the expression of
           TGFbeta-induced alpha-smooth muscle cell actin.
          Length = 343

 Score = 34.6 bits (79), Expect = 0.002
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 15  PSQEKIVTMSTIHPTRDLHSELVGNQHLPDDQARKVLQ-----LKDLLDKILMLDTSKRL 69
           PS E +  +S+ H  + + S      H+P    +K+ +       DLL+K+L+LD+ KR+
Sbjct: 235 PSPEVLKKISSEHARKYIQSL----PHMPQQDLKKIFRGANPLAIDLLEKMLVLDSDKRI 290

Query: 70  PINQALTHPFILE 82
             ++AL HP+  +
Sbjct: 291 SASEALAHPYFSQ 303


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
           Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
           Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CCRK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CCRK was previously called p42. It is a
           Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
           which is essential for the activation of CDK2. It is
           indispensable for cell growth and has been implicated in
           the progression of glioblastoma multiforme. In the
           heart, a splice variant of CCRK with a different
           C-terminal half is expressed, this variant promotes
           cardiac cell growth and survival and is significantly
           down-regulated during the development of heart failure.
          Length = 286

 Score = 34.6 bits (80), Expect = 0.002
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%)

Query: 39  NQHLPDDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPF 79
            +  PD     +    DLL  +L+ D SKRL   +AL HP+
Sbjct: 248 EEIFPDASPEAL----DLLKGLLVYDPSKRLSAAEALRHPY 284


>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the
           Serine/Threonine Kinase, p38alpha Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38alpha subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38alpha subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38alpha, also called MAPK14, is expressed in
           most tissues and is the major isoform involved in the
           immune and inflammatory response. It is the central p38
           MAPK involved in myogenesis. It plays a role in
           regulating cell cycle check-point transition and
           promoting cell differentiation. p38alpha also regulates
           cell proliferation and death through crosstalk with the
           JNK pathway. Its substrates include MAPK activated
           protein kinase 2 (MK2), MK5, and the transcription
           factors ATF2 and Mitf.
          Length = 345

 Score = 33.5 bits (76), Expect = 0.005
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPF 79
              DLL+K+L+LD+ KR+   QAL H +
Sbjct: 275 LAVDLLEKMLVLDSDKRITAAQALAHAY 302


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase 15.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK15 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. Human MAPK15 is also called
           Extracellular signal Regulated Kinase 8 (ERK8) while the
           rat protein is called ERK7. ERK7 and ERK8 display both
           similar and different biochemical properties. They
           autophosphorylate and activate themselves and do not
           require upstream activating kinases. ERK7 is
           constitutively active and is not affected by
           extracellular stimuli whereas ERK8 shows low basal
           activity and is activated by DNA-damaging agents. ERK7
           and ERK8 also have different substrate profiles. Genome
           analysis shows that they are orthologs with similar gene
           structures. ERK7 and ERK 8 may be involved in the
           signaling of some nuclear receptor transcription
           factors. ERK7 regulates hormone-dependent degradation of
           estrogen receptor alpha while ERK8 down-regulates the
           transcriptional co-activation androgen and
           glucocorticoid receptors.
          Length = 337

 Score = 33.3 bits (77), Expect = 0.005
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 19/84 (22%)

Query: 7   KIINFHFPPSQEKIVTMSTIHPTRDLHSELVGN--QHLPDDQARKVLQL--------KDL 56
           KII    PPS E I           + S         LP    + + +L         DL
Sbjct: 224 KIIEVIGPPSAEDI---------ESIKSPFAATMLDSLPSRPRKPLDELLPKASDDALDL 274

Query: 57  LDKILMLDTSKRLPINQALTHPFI 80
           L K+L+ + +KRL   +AL HP++
Sbjct: 275 LKKLLVFNPNKRLTAEEALEHPYV 298


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
           UAS Requirement 1 and similar proteins.
           Serine/Threonine Kinases (STKs), Bypass UAS Requirement
           1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           BUR1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. BUR1, also called
           SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK)
           that is functionally equivalent to mammalian CDK9. It
           associates with the cyclin BUR2. BUR genes were
           orginally identified in a genetic screen as factors
           involved in general transcription. The BUR1/BUR2 complex
           phosphorylates the C-terminal domain of RNA polymerase
           II. In addition, this complex regulates histone
           modification by phosporylating Rad6 and mediating the
           association of the Paf1 complex with chromatin.
          Length = 311

 Score = 33.1 bits (76), Expect = 0.007
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL K+L LD  KRL  + AL HP+
Sbjct: 286 DLLSKLLSLDPYKRLTASDALEHPY 310


>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine
           Kinase, Plant B-type Cyclin-Dependent protein Kinase.
           Serine/Threonine Kinases (STKs), Plant B-type
           Cyclin-Dependent protein Kinase (CdkB) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CdkB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. The plant-specific B-type CDKs are expressed
           from the late S to the M phase of the cell cycle. They
           are characterized by the cyclin binding motif
           PPT[A/T]LRE. They play a role in controlling mitosis and
           integrating developmental pathways, such as stomata and
           leaf development. CdkB has been shown to associate with
           both cyclin B, which controls G2/M transition, and
           cyclin D, which acts as a mediator in linking
           extracellular signals to the cell cycle.
          Length = 295

 Score = 32.9 bits (75), Expect = 0.008
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 43  PDDQARKVLQLK----DLLDKILMLDTSKRLPINQALTHPF 79
           P D +R V  L     DLL K+L  D +KR+    ALTHP+
Sbjct: 253 PQDLSRAVPDLSPEGLDLLQKMLRYDPAKRISAKAALTHPY 293


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 32.6 bits (75), Expect = 0.009
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFI 80
            KDL+ K L  D SKR    + L HP+ 
Sbjct: 233 AKDLIKKCLNKDPSKRPTAEEILQHPWF 260


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 32.5 bits (75), Expect = 0.010
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           +  DLL K+L  + +KR+   +AL HP+ 
Sbjct: 254 EGIDLLSKMLQYNPAKRISAKEALKHPYF 282


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), CMGC family, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CMGC family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The CMGC family consists of Cyclin-Dependent
           protein Kinases (CDKs), Mitogen-activated protein
           kinases (MAPKs) such as Extracellular signal-regulated
           kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
           and similar proteins. CDKs belong to a large subfamily
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. MAPKs
           serve as important mediators of cellular responses to
           extracellular signals. They control critical cellular
           functions including differentiation, proliferation,
           migration, and apoptosis. They are also implicated in
           the pathogenesis of many diseases including multiple
           types of cancer, stroke, diabetes, and chronic
           inflammation.
          Length = 283

 Score = 31.9 bits (73), Expect = 0.019
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           Q  DLL ++L  D  KR+   QAL HP+ 
Sbjct: 255 QALDLLSQMLHYDPHKRITAEQALAHPYF 283


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 31.0 bits (71), Expect = 0.034
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           + KD L K L  D  KR   ++ L HPF+
Sbjct: 232 EAKDFLRKCLRRDPKKRPTADELLQHPFL 260


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 31.0 bits (71), Expect = 0.037
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           + KD L+K L+ D  KR    + L HPF+
Sbjct: 245 EFKDFLNKCLVKDPEKRPSAEELLQHPFL 273


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 30.3 bits (68), Expect = 0.087
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 27  HPTRDLHSELVGNQHLPDDQARKVLQL--KDLLDKILMLDTSKRLPINQALTHPFI 80
           +P R L+  L+     P+ Q  + L    +D L++ L +D  KR    + L HPF+
Sbjct: 219 NPLRALY--LIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHPFL 272


>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK2/3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK2 is regulated by cyclin E or cyclin A.
           Upon activation by cyclin E, it phosphorylates the
           retinoblastoma (pRb) protein which activates E2F
           mediated transcription and allows cells to move into S
           phase. The CDK2/cyclin A complex plays a role in
           regulating DNA replication. CDK2, together with CDK4,
           also regulates embryonic cell proliferation. Despite
           these important roles, mice deleted for the cdk2 gene
           are viable and normal except for being sterile. This may
           be due to compensation provided by CDK1 (also called
           Cdc2), which can also bind cyclin E and drive the G1 to
           S phase transition. CDK3 is regulated by cyclin C and it
           phosphorylates pRB specifically during the G0/G1
           transition. This phosphorylation is required for cells
           to exit G0 efficiently and enter the G1 phase.
          Length = 284

 Score = 30.2 bits (68), Expect = 0.088
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 54  KDLLDKILMLDTSKRLPINQALTHPF 79
           +DLL ++L  D +KR+    AL HPF
Sbjct: 258 RDLLSQMLHYDPNKRISAKAALAHPF 283


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
           Serine/Threonine Kinase, p38gamma Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38gamma subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38gamma subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38gamma, also called MAPK12, is predominantly
           expressed in skeletal muscle. Unlike p38alpha and
           p38beta, p38gamma is insensitive to pyridinylimidazoles.
           It displays an antagonizing function compared to
           p38alpha. p38gamma inhibits, while p38alpha stimulates,
           c-Jun phosphorylation and AP-1 mediated transcription.
           p38gamma also plays a role in the signaling between Ras
           and the estrogen receptor and has been implicated to
           increase cell invasion and breast cancer progression. In
           Xenopus, p38gamma is critical in the meiotic maturation
           of oocytes.
          Length = 343

 Score = 29.9 bits (67), Expect = 0.096
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           ++L+K+L+LD   R+   +AL HP+
Sbjct: 276 NVLEKMLVLDAESRITAAEALAHPY 300


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 4 and 6-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) and CDK6-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK4/6-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDK4 and CDK6
           partner with D-type cyclins to regulate the early G1
           phase of the cell cycle. They are the first kinase
           activated by mitogenic signals to release cells from the
           G0 arrested state. CDK4 and CDK6 are both expressed
           ubiquitously, associate with all three D cyclins (D1, D2
           and D3), and phosphorylate the retinoblastoma (pRb)
           protein. They are also regulated by the INK4 family of
           inhibitors which associate with either the CDK alone or
           the CDK/cyclin complex. CDK4 and CDK6 show differences
           in subcellular localization, sensitivity to some
           inhibitors, timing in activation, tumor selectivity, and
           possibly substrate profiles. Although CDK4 and CDK6 seem
           to show some redundancy, they also have discrete,
           nonoverlapping functions. CDK6 plays an important role
           in cell differentiation.
          Length = 287

 Score = 29.9 bits (68), Expect = 0.11
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 54  KDLLDKILMLDTSKRLPINQALTHPF 79
            DLL K+L  +  KR+   +AL HP+
Sbjct: 261 LDLLKKMLTFNPHKRISAFEALQHPY 286


>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 1 from higher
           eukaryotes-like.  Serine/Threonine Kinases (STKs),
           Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes. CDK1 is also called Cell division control
           protein 2 (Cdc2) or p34 protein kinase, and is regulated
           by cyclins A, B, and E. The CDK1/cyclin A complex
           controls G2 phase entry and progression. CDK1/cyclin A2
           has also been implicated as an important regulator of S
           phase events. The CDK1/cyclin B complex is critical for
           G2 to M phase transition. It induces mitosis by
           activating nuclear enzymes that regulate chromatin
           condensation, nuclear membrane degradation,
           mitosis-specific microtubule and cytoskeletal
           reorganization. CDK1 also associates with cyclin E and
           plays a role in the entry into S phase. CDK1
           transcription is stable throughout the cell cycle but is
           modulated in some pathological conditions. It may play a
           role in regulating apoptosis under these conditions. In
           breast cancer cells, HER2 can mediate apoptosis by
           inactivating CDK1. Activation of CDK1 may contribute to
           HIV-1 induced apoptosis and neuronal apoptosis in
           neurodegenerative diseases.
          Length = 285

 Score = 29.7 bits (67), Expect = 0.13
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL+K+L+ D +KR+   +AL HP+
Sbjct: 260 DLLEKMLIYDPAKRISAKKALNHPY 284


>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 8-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK8-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK8, CDC2L6, and similar proteins. CDK8
           functions as a negative or positive regulator of
           transcription, depending on the scenario. Together with
           its regulator, cyclin C, it reversibly associates with
           the multi-subunit core Mediator complex, a cofactor that
           is involved in regulating RNA polymerase II (RNAP
           II)-dependent transcription. CDC2L6 also associates with
           Mediator in complexes lacking CDK8. In VP16-dependent
           transcriptional activation, CDK8 and CDC2L6 exerts
           opposing effects by positive and negative regulation,
           respectively, in similar conditions.
          Length = 316

 Score = 29.6 bits (67), Expect = 0.15
 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 3/47 (6%)

Query: 33  HSELVGNQHLPDDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPF 79
            + L            +     DLL K+L  D +KR+   +AL HP+
Sbjct: 272 SNSLAKWMEKHKKPDSQGF---DLLRKLLEYDPTKRITAEEALEHPY 315


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
           Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
           and Hog1.  Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Sty1/Hog1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of the MAPKs Sty1
           from Schizosaccharomyces pombe, Hog1 from Saccharomyces
           cerevisiae, and similar proteins. MAPKs are important
           mediators of cellular responses to extracellular
           signals. Sty1 and Hog1 are stress-activated MAPKs that
           partipate in transcriptional regulation in response to
           stress. Sty1 is activated in response to oxidative
           stress, osmotic stress, and UV radiation. Sty1 is
           regulated by the MAP2K Wis1, which is activated by the
           MAP3Ks Wis4 and Win1, which receive signals of the
           stress condition from membrane-spanning histidine
           kinases Mak1-3. Activated Sty1 stabilizes the Atf1
           transcription factor and induces transcription of
           Atf1-dependent genes of the core environmetal stress
           response (CESR). Hog1 is the key element in the high
           osmolarity glycerol (HOG) pathway and is activated upon
           hyperosmotic stress. Activated Hog1 accumulates in the
           nucleus and regulates stress-induced transcription. The
           HOG pathway is mediated by two transmembrane
           osmosensors, Sln1 and Sho1.
          Length = 328

 Score = 29.4 bits (66), Expect = 0.17
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 6/37 (16%)

Query: 44  DDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           D  A       DLL+K+L+ D  KR+   +AL HP++
Sbjct: 261 DPSAI------DLLEKMLVFDPQKRISAAEALAHPYL 291


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 1-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes, plants, and yeasts, as well as CDK2 and
           CDK3. CDK1 is also called Cell division control protein
           2 (Cdc2) or p34 protein kinase, and is regulated by
           cyclins A, B, and E. The CDK1/cyclin A complex controls
           G2 phase entry and progression while the CDK1/cyclin B
           complex is critical for G2 to M phase transition. CDK2
           is regulated by cyclin E or cyclin A. Upon activation by
           cyclin E, it phosphorylates the retinoblastoma (pRb)
           protein which activates E2F mediated transcription and
           allows cells to move into S phase. The CDK2/cyclin A
           complex plays a role in regulating DNA replication.
           Studies in knockout mice revealed that CDK1 can
           compensate for the loss of the cdk2 gene as it can also
           bind cyclin E and drive G1 to S phase transition. CDK3
           is regulated by cyclin C and it phosphorylates pRB
           specifically during the G0/G1 transition. This
           phosphorylation is required for cells to exit G0
           efficiently and enter the G1 phase.
          Length = 283

 Score = 29.2 bits (66), Expect = 0.18
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL K+L+ D +KR+    AL HP+
Sbjct: 258 DLLSKMLVYDPAKRISAKAALQHPY 282


>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
          Length = 294

 Score = 28.6 bits (64), Expect = 0.26
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL K+L LD SKR+    AL H +
Sbjct: 262 DLLSKMLRLDPSKRITARAALEHEY 286


>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
           Kinase, Cell Division Cycle 2-like 1.  Serine/Threonine
           Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDC2L1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDC2L1, also
           called PITSLRE, exists in different isoforms which are
           named using the alias CDK11(p). The CDC2L1 gene produces
           two protein products, CDK11(p110) and CDK11(p58). CDC2L1
           is also represented by the caspase-processed CDK11(p46).
           CDK11(p110), the major isoform, associates with cyclin L
           and is expressed throughout the cell cycle. It is
           involved in RNA processing and the regulation of
           transcription. CDK11(p58) associates with cyclin D3 and
           is expressed during the G2/M phase of the cell cycle. It
           plays roles in spindle morphogenesis, centrosome
           maturation, sister chromatid cohesion, and the
           completion of mitosis. CDK11(p46) is formed from the
           larger isoforms by caspases during TNFalpha- and
           Fas-induced apoptosis. It functions as a downstream
           effector kinase in apoptotic signaling pathways and
           interacts with eukaryotic initiation factor 3f (eIF3f), 
           p21-activated kinase (PAK1), and Ran-binding protein
           (RanBPM).
          Length = 293

 Score = 28.7 bits (65), Expect = 0.28
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
           DLL+++L  D +KR+    AL HP+ 
Sbjct: 268 DLLNRLLTYDPAKRISAEDALKHPYF 293


>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 4.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 4, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK4 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK4 regulates cell morphology and
           cytoskeletal organization. It is essential for embryonic
           viability and proper neural development. Mice lacking
           PAK4 die due to defects in the fetal heart. In addition,
           their spinal cord motor neurons showed failure to
           differentiate and migrate. PAK4 also plays a role in
           cell survival and tumorigenesis. It is overexpressed in
           many primary tumors including colon, esophageal, and
           mammary tumors. PAK4 has also been implicated in viral
           and bacterial infection pathways.
          Length = 292

 Score = 28.5 bits (63), Expect = 0.29
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFI 80
           LK  LD++L+ D ++R    + L HPF+
Sbjct: 246 LKGFLDRLLVRDPAQRATAAELLKHPFL 273


>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 3.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK3
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK3 (also known as beta-adrenergic
           receptor kinase 2) is widely expressed in many tissues.
           GRK3-deficient mice show a lack of olfactory receptor
           desensitization and altered regulation of the M2
           muscarinic airway. GRK3 is involved in modulating the
           cholinergic response of airway smooth muscles. It also
           plays a role in dopamine receptor regulation. GRK3
           promoter polymorphisms may be associated with bipolar
           disorder.
          Length = 279

 Score = 28.4 bits (63), Expect = 0.33
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 16/68 (23%)

Query: 6   FKIINFHFPPSQEKIVTMSTIHPTRDLHS----ELVGNQHLPDDQARKVLQLKDLLDKIL 61
           FK++  H P  Q         H T+D H      L  N  LPD  +    +LK LL+ +L
Sbjct: 187 FKLLRGHSPFRQ---------HKTKDKHEIDRMTLTVNVELPDSFSP---ELKSLLEGLL 234

Query: 62  MLDTSKRL 69
             D SKRL
Sbjct: 235 QRDVSKRL 242


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
           MAPK/MAK/MRK Overlapping Kinase.  Serine/Threonine
           Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MOK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MOK, also called Renal tumor antigen 1
           (RAGE-1), is widely expressed and is enriched in testis,
           kidney, lung, and brain. It is expressed in
           approximately 50% of renal cell carcinomas (RCC) and is
           a potential target for immunotherapy. MOK is stabilized
           by its association with the HSP90 molecular chaperone.
           It is induced by the transcription factor Cdx2 and may
           be involved in regulating intestinal epithelial
           development and differentiation.
          Length = 282

 Score = 28.4 bits (64), Expect = 0.38
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL K+L  D  +R+   QAL HP+
Sbjct: 257 DLLKKLLAYDPDERITAKQALRHPY 281


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 5.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 5 (CDK5) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK5 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK5
           is unusual in that it is regulated by non-cyclin
           proteins, p35 and p39. It is highly expressed in the
           nervous system and is critical in normal neural
           development and function. It plays a role in neuronal
           migration and differentiation, and is also important in
           synaptic plasticity and learning. CDK5 also participates
           in protecting against cell death and promoting
           angiogenesis. Impaired CDK5 activity is implicated in
           Alzheimer's disease, amyotrophic lateral sclerosis,
           Parkinson's disease, Huntington's disease and acute
           neuronal injury.
          Length = 284

 Score = 28.2 bits (63), Expect = 0.40
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 54  KDLLDKILMLDTSKRLPINQALTHPF 79
           +DLL  +L+ +  +R+   +AL HP+
Sbjct: 258 RDLLQNLLVCNPVQRISAEEALQHPY 283


>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 8.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek8 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek8 contains an
           N-terminal kinase catalytic domain and a C-terminal RCC1
           (regulator of chromosome condensation) domain. A double
           point mutation in Nek8 causes cystic kidney disease in
           mice that genetically resembles human autosomal
           recessive polycystic kidney disease (ARPKD). Nek8 is
           also associated with a rare form of juvenile renal
           cystic disease, nephronophthisis type 9. It has been
           suggested that a defect in the ciliary localization of
           Nek8 contributes to the development of cysts manifested
           by these diseases.
          Length = 256

 Score = 28.3 bits (63), Expect = 0.43
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
            L+ L+  +L LD SKR  ++Q +  P  
Sbjct: 228 DLRQLILSMLNLDPSKRPQLSQIMAQPIC 256


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group II p21-activated kinase. 
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group II, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group II PAKs, also called non-conventional PAKs,
           include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
           (p21-binding domain) and catalytic domains, but lack
           other motifs found in group I PAKs, such as an AID
           (autoinhibitory domain) and SH3 binding sites. Since
           group II PAKs do not contain an obvious AID, they may be
           regulated differently from group I PAKs. While group I
           PAKs interact with the SH3 containing proteins Nck, Grb2
           and PIX, no such binding has been demonstrated for group
           II PAKs. Some known substrates of group II PAKs are also
           substrates of group I PAKs such as Raf, BAD, LIMK and
           GEFH1. Unique group II substrates include MARK/Par-1 and
           PDZ-RhoGEF. Group II PAKs play important roles in
           filopodia formation, neuron extension, cytoskeletal
           organization, and cell survival.
          Length = 285

 Score = 28.2 bits (63), Expect = 0.44
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFILE 82
           L+  LD++L+ D ++R    + L HPF+ +
Sbjct: 245 LRSFLDRMLVRDPAQRATAAELLNHPFLAK 274


>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
           Serine/Threonine Kinase, beta-adrenergic receptor
           kinase.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily,
           beta-adrenergic receptor kinase (beta-ARK) group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. The beta-ARK
           group is composed of GRK2, GRK3, and similar proteins.
           GRK2 and GRK3 are both widely expressed in many tissues,
           although GRK2 is present at higher levels. They contain
           an N-terminal RGS homology (RH) domain, a central
           catalytic domain, and C-terminal pleckstrin homology
           (PH) domain that mediates PIP2 and G protein
           betagamma-subunit translocation to the membrane. GRK2
           (also called beta-ARK or beta-ARK1) is important in
           regulating several cardiac receptor responses. It plays
           a role in cardiac development and in hypertension.
           Deletion of GRK2 in mice results in embryonic lethality,
           caused by hypoplasia of the ventricular myocardium. GRK2
           also plays important roles in the liver (as a regulator
           of portal blood pressure), in immune cells, and in the
           nervous system. Altered GRK2 expression has been
           reported in several disorders including major
           depression, schizophrenia, bipolar disorder, and
           Parkinsonism.
          Length = 278

 Score = 28.0 bits (62), Expect = 0.53
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 16/68 (23%)

Query: 6   FKIINFHFPPSQEKIVTMSTIHPTRDLHS----ELVGNQHLPDDQARKVLQLKDLLDKIL 61
           FK++  H P  Q         H T+D H      L     LPD  +    +L+ LL+ +L
Sbjct: 187 FKLLRGHSPFRQ---------HKTKDKHEIDRMTLTMAVELPDSFS---PELRSLLEGLL 234

Query: 62  MLDTSKRL 69
             D ++RL
Sbjct: 235 QRDVNRRL 242


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 27.8 bits (62), Expect = 0.56
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 42  LPDDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           +PD  +    + KD + K L  D S R    + L HPF+
Sbjct: 223 IPDHLSD---EAKDFILKCLQRDPSLRPTAAELLEHPFV 258


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 7.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 7 (CDK7) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK7 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK7
           plays essential roles in the cell cycle and in
           transcription. It associates with cyclin H and MAT1 and
           acts as a CDK-Activating Kinase (CAK) by phosphorylating
           and activating cell cycle CDKs (CDK1/2/4/6). In the
           brain, it activates CDK5. CDK7 is also a component of
           the general transcription factor TFIIH, which
           phosphorylates the C-terminal domain (CTD) of RNA
           polymerase II when it is bound with unphosphorylated
           DNA, as present in the pre-initiation complex. Following
           phosphorylation, the CTD dissociates from the DNA which
           allows transcription initiation.
          Length = 298

 Score = 27.5 bits (62), Expect = 0.59
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL ++L L+ +KR+   QAL HP+
Sbjct: 260 DLLQRLLTLNPNKRITARQALEHPY 284


>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 6.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 6, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK6 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK6 may play a role in stress responses
           through its activation by the mitogen-activated protein
           kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
           is highly expressed in the brain. It is not required for
           viability, but together with PAK5, it is required for
           normal levels of locomotion and activity, and for
           learning and memory. Increased expression of PAK6 is
           found in primary and metastatic prostate cancer. PAK6
           may play a role in the regulation of motility.
          Length = 297

 Score = 27.7 bits (61), Expect = 0.65
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFILE 82
           L+D L+++L  +  +R    + L HPF+L+
Sbjct: 247 LRDFLERMLTREPQERATAQELLDHPFLLQ 276


>gnl|CDD|184974 PRK15012, PRK15012, menaquinone-specific isochorismate synthase;
           Provisional.
          Length = 431

 Score = 27.5 bits (61), Expect = 0.70
 Identities = 9/25 (36%), Positives = 12/25 (48%)

Query: 20  IVTMSTIHPTRDLHSELVGNQHLPD 44
           + T+ +I P   LH      QH PD
Sbjct: 144 LATLVSIKPLPGLHLTTTREQHWPD 168


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 27.3 bits (61), Expect = 0.74
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           D L   L +D  +RL  ++ L HP+
Sbjct: 263 DFLKACLRMDPKERLTCDELLQHPY 287


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
           Serine/Threonine Kinases (STKs), Pho85 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Pho85 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Pho85 is a
           multifunctional Cyclin-Dependent protein Kinase (CDK) in
           yeast. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. Pho85 is regulated
           by 10 different cyclins (Pcls) and plays a role in G1
           progression, cell polarity, phosphate and glycogen
           metabolism, gene expression, and in signaling changes in
           the environment. It is not essential for yeast viability
           and is the functional homolog of mammalian CDK5, which
           plays a role in central nervous system development.
          Length = 284

 Score = 27.4 bits (61), Expect = 0.78
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DLL ++L L+   R+  + AL HP+
Sbjct: 259 DLLHRLLQLNPELRISAHDALQHPW 283


>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 10.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein Kinase 10 (CDK10) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK10 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK10, also called PISSLRE, is essential for
           cell growth and proliferation, and acts through the G2/M
           phase of the cell cycle. CDK10 has also been identified
           as an important factor in endocrine therapy resistance
           in breast cancer. CDK10 silencing increases the
           transcription of c-RAF and the activation of the p42/p44
           MAPK pathway, which leads to antiestrogen resistance.
           Patients who express low levels of CDK10 relapse early
           on tamoxifen.
          Length = 309

 Score = 27.3 bits (61), Expect = 0.78
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFILEK 83
            LL+ +LM D  KR    +AL   +  EK
Sbjct: 268 RLLNFLLMYDPKKRATAEEALESSYFKEK 296


>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-1 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-1 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-1 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-1 is
           expressed ubiquitously and is localized in the
           cytoplasm. Its kinase activity is cell cycle dependent
           and peaks at the S and G2 phases. PCTAIRE-1 is highly
           expressed in the brain and may play a role in regulating
           neurite outgrowth. It can also associate with Trap
           (Tudor repeat associator with PCTAIRE-2), a
           physiological partner of PCTAIRE-2; with p11, a small
           dimeric protein with similarity to S100; and with 14-3-3
           proteins, mediators of phosphorylation-dependent
           interactions in many different proteins.
          Length = 301

 Score = 27.3 bits (60), Expect = 0.80
 Identities = 9/28 (32%), Positives = 16/28 (57%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFILE 82
           +LL K+L  +  KR+   +A+ HP+   
Sbjct: 264 ELLSKLLQFEGRKRISAEEAMKHPYFHC 291


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 27.1 bits (61), Expect = 0.96
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           DL+  +L  D  KR   +QAL HP+
Sbjct: 258 DLIKDMLRWDPKKRPTASQALQHPY 282


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 2.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 2, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK2 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK2 plays a
           role in pro-apoptotic signaling. It is cleaved and
           activated by caspases leading to morphological changes
           during apoptosis. PAK2 is also activated in response to
           a variety of stresses including DNA damage,
           hyperosmolarity, serum starvation, and contact
           inhibition, and may play a role in coordinating the
           stress response. PAK2 also contributes to cancer cell
           invasion through a mechanism distinct from that of PAK1.
          Length = 296

 Score = 27.0 bits (59), Expect = 0.97
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 27  HPTRDLHSELVGNQHLPDDQARKVLQ--LKDLLDKILMLDTSKRLPINQALTHPFI 80
           +P R L+  L+     P+ Q  + L    +D L++ L +D  KR    + L HPF+
Sbjct: 219 NPLRALY--LIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFL 272


>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional.
          Length = 467

 Score = 27.2 bits (60), Expect = 0.99
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFILE 82
           L DL+  +L  D  KRL   Q  THP++L+
Sbjct: 414 LCDLIYGLLHYDRQKRLNARQMTTHPYVLK 443


>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase,
           Nemo-Like Kinase.  Serine/Threonine Kinases (STKs),
           Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The NLK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mitogen-activated protein
           kinases (MAPKs) are important mediators of cellular
           responses to extracellular signals. NLK is an atypical
           MAPK that is not regulated by a MAPK kinase. It
           functions downstream of the MAPK kinase kinase Tak1,
           which also plays a role in activating the JNK and p38
           MAPKs. The Tak1/NLK pathways are regulated by Wnts, a
           family of secreted proteins that is critical in the
           control of asymmetric division and cell polarity. NLK
           can phosphorylate transcription factors from the TCF/LEF
           family, inhibiting their ability to activate the
           transcription of target genes. In prostate cancer cells,
           NLK is involved in regulating androgen receptor-mediated
           transcription and its expression is altered during
           cancer progression.
          Length = 372

 Score = 27.0 bits (60), Expect = 1.2
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFILE 82
            LL ++L+ D  KR+    AL HP++ E
Sbjct: 266 HLLCRMLVFDPDKRISAADALAHPYLDE 293


>gnl|CDD|213549 TIGR00673, cynS, cyanate hydratase.  Alternate names include
          cyanate lyase, cyanase and cyanate hydrolase [Cellular
          processes, Detoxification].
          Length = 150

 Score = 26.7 bits (59), Expect = 1.2
 Identities = 13/48 (27%), Positives = 20/48 (41%), Gaps = 3/48 (6%)

Query: 36 LVGNQHLPDDQARKVLQLKDLLDKILML--DTSKRLPINQAL-THPFI 80
          L G    P D+AR V    DL +  ++       R  I+  + T P +
Sbjct: 42 LYGQAAAPADEARLVGAKLDLDEDSILELQMAPLRGCIDPVIPTDPTM 89


>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine
           Kinases, Mitogen-Activated Protein Kinases 4 and 6.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK4/6 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. MAPK4 is also called ERK4 or
           p63MAPK, while MAPK6 is also called ERK3 or p97MAPK.
           MAPK4 and MAPK6 are atypical MAPKs that are not
           regulated by MAP2Ks. MAPK6 is expressed ubiquitously
           with highest amounts in brain and skeletal muscle. It
           may be involved in the control of cell differentiation
           by negatively regulating cell cycle progression in
           certain conditions. It may also play a role in
           glucose-induced insulin secretion. MAPK6 and MAPK4
           cooperate to regulate the activity of MAPK-activated
           protein kinase 5 (MK5), leading to its relocation to the
           cytoplasm and exclusion from the nucleus. The MAPK6/MK5
           and MAPK4/MK5 pathways may play critical roles in
           embryonic and post-natal development.
          Length = 342

 Score = 26.7 bits (59), Expect = 1.3
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
           D L++IL  +   RL   +AL HP++
Sbjct: 278 DFLEQILTFNPMDRLTAEEALMHPYM 303


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 26.8 bits (60), Expect = 1.3
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHP 78
           +LKDL+ K+L  D  KR    + L H 
Sbjct: 189 ELKDLIRKMLQKDPEKRPSAKEILEHL 215


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 26.5 bits (59), Expect = 1.4
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 37  VGNQHLPD--DQARKVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           VG  H P   D  +   + KD LD+ L  D  KR   ++ L HPF+
Sbjct: 219 VGAGHKPPIPDSLQLSPEGKDFLDRCLESDPKKRPTASELLQHPFV 264


>gnl|CDD|224430 COG1513, CynS, Cyanate lyase [Inorganic ion transport and
          metabolism].
          Length = 151

 Score = 26.3 bits (58), Expect = 1.6
 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 36 LVGNQHLPDDQARKVLQLKDLLDKILML--DTSKRLPINQAL-THPFI 80
          L G   LP D+AR V +  DL +  ++L      R  +   + T P I
Sbjct: 42 LYGQAALPADEARAVGEALDLDEDAILLLQMIPLRGCLGPVIPTDPLI 89


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 3.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 3, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK3 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK3 is
           highly expressed in the brain. It is implicated in
           neuronal plasticity, synapse formation, dendritic spine
           morphogenesis, cell cycle progression, neuronal
           migration, and apoptosis. Inactivating mutations in the
           PAK3 gene cause X-linked non-syndromic mental
           retardation, the severity of which depends on the site
           of the mutation.
          Length = 297

 Score = 26.6 bits (58), Expect = 1.7
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 27  HPTRDLHSELVGNQHLPDDQARKVLQ--LKDLLDKILMLDTSKRLPINQALTHPFI 80
           +P R L+  L+     P+ Q  + L    +D L++ L +D  +R    + L HPF+
Sbjct: 219 NPLRALY--LIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFL 272


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 26.3 bits (58), Expect = 1.7
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 55  DLLDKILMLDTSKRLPINQALTH 77
           DLL  +L L+  +R+   +AL H
Sbjct: 291 DLLQSLLKLNPLERISAKEALKH 313


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 1 (CDKL1) and CDKL4 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL1 and CDKL4
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL1, also called
           p42 KKIALRE, is a glial protein that is upregulated in
           gliosis. It is present in neuroblastoma and A431 human
           carcinoma cells, and may be implicated in neoplastic
           transformation. The function of CDKL4 is unknown.
          Length = 286

 Score = 26.6 bits (59), Expect = 1.7
 Identities = 12/49 (24%), Positives = 22/49 (44%), Gaps = 9/49 (18%)

Query: 40  QHLPDDQARKVLQLK---------DLLDKILMLDTSKRLPINQALTHPF 79
             +P+ + R+ L+ K           L   L +D ++RL   + L HP+
Sbjct: 237 LSIPEPETREPLESKFPNISSPALSFLKGCLQMDPTERLSCEELLEHPY 285


>gnl|CDD|215258 PLN02465, PLN02465, L-galactono-1,4-lactone dehydrogenase.
          Length = 573

 Score = 26.4 bits (58), Expect = 2.1
 Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 4/65 (6%)

Query: 14  PPSQEKIVTMSTIHPTRDLHSELVGNQHL----PDDQARKVLQLKDLLDKILMLDTSKRL 69
           P  + K      + P RDL+ E  G +      PD Q     +L+D L  +  LD     
Sbjct: 318 PKIKPKYSEDERVQPLRDLYKESAGTKSSENPEPDIQEMGFGELRDKLLALDPLDPDHVK 377

Query: 70  PINQA 74
            +N A
Sbjct: 378 RVNAA 382


>gnl|CDD|225990 COG3459, COG3459, Cellobiose phosphorylase [Carbohydrate
          transport and metabolism].
          Length = 1056

 Score = 26.2 bits (58), Expect = 2.1
 Identities = 8/28 (28%), Positives = 13/28 (46%)

Query: 53 LKDLLDKILMLDTSKRLPINQALTHPFI 80
          L   LD I+ L    R+P  + ++  F 
Sbjct: 28 LGFTLDPIISLRRVVRVPAGKKISLIFW 55


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 26.2 bits (56), Expect = 2.2
 Identities = 16/80 (20%), Positives = 29/80 (36%)

Query: 1   MSLISFKIINFHFPPSQEKIVTMSTIHPTRDLHSELVGNQHLPDDQARKVLQLKDLLDKI 60
           ++L         F   +    T  T+    +L +  + +   P +         DLL K+
Sbjct: 199 ITLYELLTGLPPFEGEKNSSATSQTLKIILELPTPSLASPLSPSNPELISKAASDLLKKL 258

Query: 61  LMLDTSKRLPINQALTHPFI 80
           L  D   RL  +  L+H  +
Sbjct: 259 LAKDPKNRLSSSSDLSHDLL 278


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 26.0 bits (57), Expect = 2.6
 Identities = 12/44 (27%), Positives = 21/44 (47%)

Query: 37  VGNQHLPDDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           +G    P+  +    +  D L+K   +D +KR    + L HPF+
Sbjct: 224 IGENASPEIPSNISSEAIDFLEKTFEIDHNKRPTAAELLKHPFL 267


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 26.0 bits (58), Expect = 2.7
 Identities = 8/18 (44%), Positives = 12/18 (66%)

Query: 52  QLKDLLDKILMLDTSKRL 69
             KDL+  +L +D +KRL
Sbjct: 224 DAKDLIRNLLQVDLTKRL 241


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase(MAPKK) subfamily, fungal
           Pek1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Pek1/Skh1 from
           Schizosaccharomyces pombe and MKK2 from Saccharomyces
           cerevisiae, and related proteins. Both fission yeast
           Pek1 and baker's yeast MKK2 are components of the cell
           integrity MAPK pathway. In fission yeast, Pek1
           phosphorylates and activates the MAPK Pmk1/Spm1 and is
           regulated by the MAPKKK Mkh1. In baker's yeast, the
           pathway involves the MAPK Slt2, the MAPKKs MKK1 and
           MKK2, and the MAPKKK Bck1. The cell integrity MAPK
           cascade is activated by multiple stress conditions, and
           is essential  in cell wall construction, morphogenesis,
           cytokinesis, and ion homeostasis.
          Length = 287

 Score = 25.8 bits (57), Expect = 2.8
 Identities = 21/94 (22%), Positives = 32/94 (34%), Gaps = 27/94 (28%)

Query: 1   MSLISFKIINFHFPPSQEK----------IVTMSTIHPTRDLHSELVGNQHLPDDQARKV 50
           ++L+      F FPP  E           IV M               N  L D+    +
Sbjct: 191 LTLLEVAQNRFPFPPEGEPPLGPIELLSYIVNMP--------------NPELKDEPGNGI 236

Query: 51  L---QLKDLLDKILMLDTSKRLPINQALTHPFIL 81
               + KD + + L  D ++R      L HP+I 
Sbjct: 237 KWSEEFKDFIKQCLEKDPTRRPTPWDMLEHPWIK 270


>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), PCTAIRE-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The PCTAIRE-like subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily share sequence similarity with
           Cyclin-Dependent Kinases (CDKs), which belong to a large
           family of STKs that are regulated by their cognate
           cyclins. Together, CDKs and cyclins are involved in the
           control of cell-cycle progression, transcription, and
           neuronal function. The association of PCTAIRE-like
           proteins with cyclins has not been widely studied,
           although PFTAIRE-1 has been shown to function as a CDK
           which is regulated by cyclin D3 as well as the
           membrane-associated cyclin Y. PCTAIRE-like proteins show
           unusual expression patterns with high levels in
           post-mitotic tissues, suggesting that they may be
           involved in regulating post-mitotic cellular events.
          Length = 291

 Score = 25.8 bits (57), Expect = 3.1
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPF 79
           +L  K L  +  KR+   +A+ HP+
Sbjct: 266 ELALKFLQYEPKKRISAAEAMKHPY 290


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 25.4 bits (56), Expect = 3.8
 Identities = 8/28 (28%), Positives = 12/28 (42%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFI 80
            + ++   L  D SKR    + L H F 
Sbjct: 240 FRKMISLCLQKDPSKRPTAEELLKHKFF 267


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 25.5 bits (57), Expect = 3.8
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPFI 80
           L++L+  +L  D  +R  I Q L  PFI
Sbjct: 231 LRNLVSSLLQKDPEERPSIAQILQSPFI 258


>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase
           catalyzes the production of CDP-D-Glucose.
           Alpha-D-Glucose-1-phosphate Cytidylyltransferase
           catalyzes the production of CDP-D-Glucose from
           alpha-D-Glucose-1-phosphate and MgCTP as substrate.
           CDP-D-Glucose is the precursor  for synthesizing four of
           the five naturally occurring 3,6-dideoxy sugars-abequose
           (3,6-dideoxy-D-Xylo-hexose), ascarylose
           (3,6-dideoxy-L-arabino-hexose), paratose
           (3,6-dideoxy-D-ribohexose), and tyvelose
           (3,6-dideoxy-D-arabino-hexose. Deoxysugars are
           ubiquitous in nature where they function in a variety of
           biological processes, including cell adhesion, immune
           response, determination of ABO blood groups,
           fertilization, antibiotic function, and microbial
           pathogenicity.
          Length = 253

 Score = 25.2 bits (56), Expect = 4.0
 Identities = 8/23 (34%), Positives = 13/23 (56%), Gaps = 2/23 (8%)

Query: 7   KIINFHFPPSQEKIVTMSTIHPT 29
            +I FH   S  K+ T++ +HP 
Sbjct: 136 ALIEFH--RSHGKLATVTAVHPP 156


>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase,
           Cell Division Cycle 2-like 6.  Serine/Threonine Kinases
           (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDC2L6 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDC2L6 is also called CDK8-like and was
           previously referred to as CDK11. However, this is a
           confusing nomenclature as CDC2L6 is distinct from
           CDC2L1, which is represented by the two protein products
           from its gene, called CDK11(p110) and CDK11(p58), as
           well as the caspase-processed CDK11(p46). CDK11(p110),
           CDK11(p58), and CDK11(p46)do not belong to this
           subfamily. CDC2L6 is an associated protein of Mediator,
           a multiprotein complex that provides a platform to
           connect transcriptional and chromatin regulators and
           cofactors, in order to activate and mediate RNA
           polymerase II transcription. CDC2L6 is localized mainly
           in the nucleus amd exerts an opposing effect to CDK8 in
           VP16-dependent transcriptional activation by being a
           negative regulator.
          Length = 317

 Score = 25.4 bits (55), Expect = 4.1
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 56  LLDKILMLDTSKRLPINQALTHPF 79
           LL K+L +D +KR+   QAL  P+
Sbjct: 293 LLQKLLTMDPTKRITSEQALQDPY 316


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 25.2 bits (56), Expect = 4.2
 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 2/39 (5%)

Query: 42  LPDDQARKVLQLKDLLDKILMLDTSKRLPINQALTHPFI 80
           LP ++     + +D +   L  D  KR    + L HPFI
Sbjct: 223 LPAEEFSP--EFRDFISACLQKDPKKRPSAAELLQHPFI 259


>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase.  Putative
           L-iditol 2-dehydrogenase based on annotation of some
           members in this subgroup.  L-iditol 2-dehydrogenase
           catalyzes the NAD+-dependent conversion of L-iditol to
           L-sorbose in fructose and mannose metabolism. This
           enzyme is related to sorbitol dehydrogenase, alcohol
           dehydrogenase, and other medium chain
           dehydrogenase/reductases. The zinc-dependent alcohol
           dehydrogenase (ADH-Zn)-like family of proteins is a
           diverse group of proteins related to the first
           identified member, class I mammalian ADH.  This group is
           also called the medium chain dehydrogenases/reductase
           family (MDR) to highlight its broad range of activities
           and to distinguish from the smaller short chain
           dehydrogenases (~ 250 amino acids vs. the ~ 350 amino
           acids of the MDR).  The MDR proteins have 2 domains: a
           C-terminal NAD(P) binding-Rossmann fold domain of a
           beta-alpha form and an N-terminal GroES-like catalytic
           domain.  The MDR group contains a host of activities,
           including the founding alcohol dehydrogenase (ADH),
           quinone reductase, sorbitol dehydrogenase, formaldehyde
           dehydrogenase, butanediol DH, ketose reductase, cinnamyl
           reductase, and numerous others. The zinc-dependent
           alcohol  dehydrogenases (ADHs) catalyze the
           NAD(P)(H)-dependent interconversion of alcohols to
           aldehydes or ketones.  Active site zinc has a catalytic
           role, while structural zinc aids in stability.  ADH-like
           proteins  typically form dimers (typically higher
           plants, mammals) or tetramers (yeast, bacteria), and
           generally have 2 tightly bound zinc atoms per subunit.
           The active site zinc is coordinated by a histidine, two
           cysteines, and a water molecule. The second zinc seems
           to play a structural role, affects subunit interactions,
           and is typically coordinated by 4 cysteines.
          Length = 343

 Score = 25.2 bits (56), Expect = 4.8
 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 15/78 (19%)

Query: 9   INF--HFPPSQEKIVTMSTIHPTRDLHSELVGNQHLPDDQARKVLQLKDLLDKILMLDTS 66
           I F    P      +  + IH  R++   + G+     +  ++ L+L      I     S
Sbjct: 261 ILFFGGLPKGSTVNIDPNLIH-YREIT--ITGSYAASPEDYKEALEL------I----AS 307

Query: 67  KRLPINQALTHPFILEKI 84
            ++ +   +TH F LE I
Sbjct: 308 GKIDVKDLITHRFPLEDI 325


>gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic
           subunit ClpP.  This model for the proteolytic subunit
           ClpP has been rebuilt to a higher stringency. In every
           bacterial genome with the ClpXP machine, a ClpP protein
           will be found that scores at least 370 by This model. In
           general, this ClpP member will be encoded adjacent to
           the clpX gene, as were all examples used in the seed
           alignment. A large fraction of genomes have one or more
           additional ClpP paralogs, sometimes encoded nearby and
           sometimes elsewhere. The stringency of the trusted
           cutoff used here excludes the more divergent ClpP
           paralogs from being called authentic ClpP by this model
           [Protein fate, Degradation of proteins, peptides, and
           glycopeptides].
          Length = 192

 Score = 25.1 bits (55), Expect = 5.1
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 32  LHSELVGNQHLPDD---QARKVLQLKDLLDKILMLDTSKRL 69
           +H  L G Q    D   QA ++L+LK LL+ IL   T + L
Sbjct: 122 IHQPLGGAQGQATDIEIQANEILRLKGLLNDILAEHTGQSL 162


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 24.8 bits (55), Expect = 5.1
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 4/30 (13%)

Query: 54  KDLLDKILMLDTSKRLPINQALT----HPF 79
           KDL++K+L+LD   RL +N+       HPF
Sbjct: 250 KDLIEKLLVLDPQDRLGVNEGYDELKAHPF 279


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 24.9 bits (55), Expect = 5.8
 Identities = 12/27 (44%), Positives = 13/27 (48%)

Query: 53  LKDLLDKILMLDTSKRLPINQALTHPF 79
            KD L K L  +  KR    Q L HPF
Sbjct: 227 FKDFLKKCLQKNPEKRPTAEQLLKHPF 253


>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK4 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK4
           partners with all three D-type cyclins (D1, D2, and D3)
           and is also regulated by INK4 inhibitors. It is active
           towards the retinoblastoma (pRb) protein and plays a
           role in regulating the early G1 phase of the cell cycle.
           It is expressed ubiquitously and is localized in the
           nucleus. CDK4 also shows kinase activity towards Smad3,
           a signal transducer of transforming growth factor
           (TGF)-beta signaling which modulates transcription and
           plays a role in cell proliferation and apoptosis. CDK4
           is inhibited by the p21 inhibitor and is specifically
           mutated in human melanoma.
          Length = 288

 Score = 24.9 bits (54), Expect = 6.0
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 55  DLLDKILMLDTSKRLPINQALTHPFI 80
            LL ++L  +  KR+   +AL HPF 
Sbjct: 263 QLLLEMLTFNPHKRISAFRALQHPFF 288


>gnl|CDD|239502 cd03408, Band_7_5, A subgroup of the band 7 domain of flotillin
           (reggie) like proteins. This subgroup contains proteins
           similar to stomatin, prohibitin, flotillin, HlfK/C and
           podicin.  Many of these band 7 domain-containing
           proteins are lipid raft-associated.  Individual proteins
           of this band 7 domain family may cluster to form
           membrane microdomains which may in turn recruit
           multiprotein complexes.  Microdomains formed from
           flotillin proteins may in addition be dynamic units with
           their own regulatory functions.  Flotillins have been
           implicated in signal transduction, vesicle trafficking,
           cytoskeleton rearrangement and are known to interact
           with a variety of proteins.  Stomatin interacts with and
           regulates members of the degenerin/epithelia Na+ channel
           family in mechanosensory cells of Caenorhabditis elegans
           and vertebrate neurons and participates in trafficking
           of Glut1 glucose transporters. Prohibitin may act as a
           chaperone for the stabilization of mitochondrial
           proteins.  Prokaryotic HflK/C plays a role in the
           decision between lysogenic and lytic cycle growth during
           lambda phage infection. Flotillins have been implicated
           in the progression of prion disease, in the pathogenesis
           of neurodegenerative diseases such as Parkinson's and
           Alzheimer's disease and, in cancer invasion and
           metastasis. Mutations in the podicin gene give rise to
           autosomal recessive steroid resistant nephritic
           syndrome.
          Length = 207

 Score = 24.6 bits (54), Expect = 6.5
 Identities = 5/23 (21%), Positives = 12/23 (52%)

Query: 1   MSLISFKIINFHFPPSQEKIVTM 23
           + L+S  I +  +P   +K++  
Sbjct: 183 LELVSVYIESISYPDEVQKLIDK 205


>gnl|CDD|234165 TIGR03303, OM_YaeT, outer membrane protein assembly complex, YaeT
           protein.  Members of this protein family are the YaeT
           protein of the YaeT/YfiO complex for assembling proteins
           into the outer membrane of Gram-negative bacteria. This
           protein is similar in sequence and function to a
           non-essential paralog, YtfM, that is also in the Omp85
           family. Members of this family typically have five
           tandem copies of the surface antigen variable number
           repeat (pfam07244), followed by an outer membrane
           beta-barrel domain (pfam01103), while the YtfM family
           typically has a single pfam07244 repeat [Protein fate,
           Protein and peptide secretion and trafficking].
          Length = 741

 Score = 24.5 bits (54), Expect = 7.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)

Query: 35  ELVGNQHLPDDQARKVLQLKD 55
             VGN+   D + R V  LK+
Sbjct: 156 NFVGNKAFSDSELRDVFALKE 176


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 24.5 bits (54), Expect = 7.9
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFI 80
           +  D + K L+ D  +R    Q L HPFI
Sbjct: 228 EFNDFVKKCLVKDPEERPSAIQLLQHPFI 256


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 24.4 bits (53), Expect = 8.1
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 52  QLKDLLDKILMLDTSKRLPINQALTHPFIL 81
           + +  +   L  + +KR    Q L HPFIL
Sbjct: 303 EFRHFISCCLQREPAKRWSAMQLLQHPFIL 332


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.139    0.395 

Gapped
Lambda     K      H
   0.267   0.0827    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,307,186
Number of extensions: 343047
Number of successful extensions: 445
Number of sequences better than 10.0: 1
Number of HSP's gapped: 444
Number of HSP's successfully gapped: 99
Length of query: 84
Length of database: 10,937,602
Length adjustment: 52
Effective length of query: 32
Effective length of database: 8,631,194
Effective search space: 276198208
Effective search space used: 276198208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (24.0 bits)