BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy17466
(226 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1YKE|A Chain A, Structure Of The Mediator Med7MED21 SUBCOMPLEX
pdb|1YKE|C Chain C, Structure Of The Mediator Med7MED21 SUBCOMPLEX
pdb|1YKH|A Chain A, Structure Of The Mediator Med7MED21 (MED7SRB7) SUBCOMPLEX
Length = 108
Score = 30.4 bits (67), Expect = 0.90, Method: Compositional matrix adjust.
Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
Query: 101 PDSPRRTEKVEDXXXXXXXXXXXXNEFRPHQARETLRVMMELQ 143
PD R KVE+ NE+RPHQ+RE+L +++E Q
Sbjct: 44 PDMYER--KVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQ 84
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.135 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,054,074
Number of Sequences: 62578
Number of extensions: 223598
Number of successful extensions: 412
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 5
length of query: 226
length of database: 14,973,337
effective HSP length: 95
effective length of query: 131
effective length of database: 9,028,427
effective search space: 1182723937
effective search space used: 1182723937
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)