Diaphorina citri psyllid: psy1747

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MKSSFLKVVMSKVPIFVILGSTGTGKSKLGIEIAKKFNGEIISADSMQGLKFLVECRVKLELLRLKPD
ccHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccEEEEccHHHHHcccccccccHHHHHcccc
****FLKVVMSKVPIFVILGSTGTGKSKLGIEIAKKFNGEIISADSMQGLKFLVECRVKLELLRL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSSFLKVVMSKVPIFVILGSTGTGKSKLGIEIAKKFNGEIISADSMQGLKFLVECRVKLELLRLKPD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA dimethylallyltransferase Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).confidentA8FDI9
tRNA dimethylallyltransferase Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).confidentQ04LL6
tRNA dimethylallyltransferase Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).confidentQ8CQL3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]bindingprobableGO:0003674
GO:0052381 [MF]tRNA dimethylallyltransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0052623 [MF]ADP dimethylallyltransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0052622 [MF]ATP dimethylallyltransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008033 [BP]tRNA processingprobableGO:0016070, GO:0006139, GO:0044238, GO:0034470, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0006399, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034660, GO:0006396, GO:0046483
GO:0009824 [MF]AMP dimethylallyltransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A8T, chain A
Confidence level:very confident
Coverage over the Query: 12-61
View the alignment between query and template
View the model in PyMOL