Query         psy17484
Match_columns 283
No_of_seqs    126 out of 146
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:39:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17484.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17484hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3119|consensus               99.7 1.3E-16 2.9E-21  146.8  13.8  181  101-281    14-258 (269)
  2 PF09006 Surfac_D-trimer:  Lung  91.6    0.22 4.7E-06   36.3   3.2   28  255-282     2-29  (46)
  3 PF14775 NYD-SP28_assoc:  Sperm  84.4     1.9 4.1E-05   32.4   4.3   25  254-278    35-59  (60)
  4 smart00338 BRLZ basic region l  82.6     2.1 4.6E-05   31.4   3.9   23  254-276    42-64  (65)
  5 PF07407 Seadorna_VP6:  Seadorn  80.3     1.7 3.6E-05   43.3   3.3   27  254-280    34-60  (420)
  6 PRK10265 chaperone-modulator p  77.7     2.8 6.1E-05   33.8   3.4   26  256-281    75-100 (101)
  7 PF07989 Microtub_assoc:  Micro  75.7     4.9 0.00011   31.4   4.1   34  247-280    38-71  (75)
  8 cd00068 GGL G protein gamma su  75.1     2.1 4.6E-05   31.5   1.9   22  256-277     3-24  (57)
  9 smart00224 GGL G protein gamma  73.9     1.9 4.2E-05   32.3   1.4   22  256-277     3-24  (63)
 10 PRK13922 rod shape-determining  70.4     6.1 0.00013   36.2   4.1   21  249-269    73-93  (276)
 11 KOG4196|consensus               70.1     5.8 0.00013   34.6   3.7   25  254-278    83-107 (135)
 12 PF02183 HALZ:  Homeobox associ  69.9     6.5 0.00014   28.1   3.3   23  254-276    21-43  (45)
 13 PF06005 DUF904:  Protein of un  69.8       7 0.00015   30.4   3.8   27  254-280    41-71  (72)
 14 TIGR02449 conserved hypothetic  64.4      12 0.00025   29.0   3.9   22  254-275    23-44  (65)
 15 PRK09413 IS2 repressor TnpA; R  60.4      16 0.00036   29.8   4.4   34  243-276    69-102 (121)
 16 PF00170 bZIP_1:  bZIP transcri  58.8      19 0.00041   26.4   4.1   21  254-274    42-62  (64)
 17 KOG4119|consensus               58.7      11 0.00023   29.7   2.9   29  254-282     9-37  (71)
 18 PF07544 Med9:  RNA polymerase   58.1      19 0.00042   28.2   4.3   25  257-281    57-81  (83)
 19 TIGR00219 mreC rod shape-deter  57.1      14  0.0003   34.9   3.9   23  254-276    75-108 (283)
 20 PF08826 DMPK_coil:  DMPK coile  56.9      18 0.00039   27.5   3.8   22  252-273    39-60  (61)
 21 PF08776 VASP_tetra:  VASP tetr  55.4      16 0.00034   26.1   3.0   18  256-273     7-25  (40)
 22 PRK14127 cell division protein  54.4      15 0.00033   30.8   3.3   27  254-280    46-72  (109)
 23 cd01111 HTH_MerD Helix-Turn-He  54.0      18  0.0004   29.3   3.7   46  232-277    35-105 (107)
 24 KOG4196|consensus               53.2      12 0.00026   32.7   2.6   25  254-281    90-114 (135)
 25 cd04765 HTH_MlrA-like_sg2 Heli  52.4       9  0.0002   30.7   1.6   43  232-274    35-98  (99)
 26 PRK03100 sec-independent trans  51.1      20 0.00044   31.2   3.7   28  246-273    36-71  (136)
 27 PF14197 Cep57_CLD_2:  Centroso  50.1      17 0.00038   27.9   2.8   20  254-273    49-68  (69)
 28 smart00340 HALZ homeobox assoc  49.4      13 0.00028   27.0   1.8   12  254-265    21-32  (44)
 29 PRK13922 rod shape-determining  48.5      24 0.00052   32.4   4.0   27  250-276    81-110 (276)
 30 PF00631 G-gamma:  GGL domain;   47.3      14  0.0003   27.7   1.8   23  255-277     5-27  (68)
 31 KOG4378|consensus               46.8      14  0.0003   38.9   2.4   20  254-273   652-671 (673)
 32 PF07716 bZIP_2:  Basic region   46.8      23  0.0005   25.3   2.9   25  254-278    27-51  (54)
 33 PF07407 Seadorna_VP6:  Seadorn  45.5      20 0.00042   36.0   3.0   21  254-274    41-61  (420)
 34 PF04508 Pox_A_type_inc:  Viral  43.9      28 0.00061   22.1   2.5   18  256-273     5-22  (23)
 35 KOG3119|consensus               43.1      10 0.00022   35.7   0.7   41   48-88     16-60  (269)
 36 PF15035 Rootletin:  Ciliary ro  42.1      38 0.00083   30.4   4.1   27  250-276    93-119 (182)
 37 PF11598 COMP:  Cartilage oligo  41.8      40 0.00087   24.4   3.4   25  255-279    18-42  (45)
 38 PF10458 Val_tRNA-synt_C:  Valy  41.6      32  0.0007   25.6   3.1   25  258-282     3-27  (66)
 39 PF04880 NUDE_C:  NUDE protein,  41.2     9.3  0.0002   34.2   0.1   22  254-276    33-54  (166)
 40 PRK14127 cell division protein  41.1      33 0.00071   28.8   3.3   28  254-281    39-66  (109)
 41 PF12808 Mto2_bdg:  Micro-tubul  39.9      40 0.00086   25.1   3.2   25  254-278    24-48  (52)
 42 cd04766 HTH_HspR Helix-Turn-He  39.7      26 0.00057   27.1   2.4   45  233-277    36-90  (91)
 43 PRK11239 hypothetical protein;  39.5      31 0.00067   32.3   3.2   26  255-280   186-211 (215)
 44 PF06295 DUF1043:  Protein of u  39.4      40 0.00086   28.3   3.6   25  254-278    27-51  (128)
 45 PF06305 DUF1049:  Protein of u  38.7      31 0.00067   25.0   2.5   21  252-272    48-68  (68)
 46 PF12329 TMF_DNA_bd:  TATA elem  37.7      31 0.00067   26.7   2.5   42  236-277    24-72  (74)
 47 PRK00182 tatB sec-independent   36.7      45 0.00098   29.9   3.7   26  246-271    36-69  (160)
 48 PF11594 Med28:  Mediator compl  36.0      42 0.00092   28.3   3.2   27  254-280    37-63  (106)
 49 PF11221 Med21:  Subunit 21 of   35.0      68  0.0015   27.3   4.4    8  246-253    78-85  (144)
 50 COG3132 Uncharacterized protei  34.6      35 0.00075   31.7   2.7   17  254-270   194-210 (215)
 51 KOG3156|consensus               34.4      60  0.0013   30.6   4.2   25  254-278   111-135 (220)
 52 KOG4010|consensus               33.7      44 0.00094   31.1   3.2   25  256-280    48-72  (208)
 53 PF14197 Cep57_CLD_2:  Centroso  33.5      47   0.001   25.6   2.9   26  256-281     2-27  (69)
 54 COG3074 Uncharacterized protei  33.4      71  0.0015   25.6   3.9   28  254-281    48-79  (79)
 55 PRK14872 rod shape-determining  33.1      47   0.001   32.8   3.5   21  252-272    64-84  (337)
 56 PF06005 DUF904:  Protein of un  33.1      69  0.0015   24.9   3.8   14  254-267    20-33  (72)
 57 PF15483 DUF4641:  Domain of un  33.0      61  0.0013   33.3   4.4   65  214-279   371-445 (445)
 58 PF14182 YgaB:  YgaB-like prote  32.2      61  0.0013   26.2   3.4   23  254-276    42-64  (79)
 59 PRK11239 hypothetical protein;  31.8      53  0.0012   30.8   3.5   22  254-275   192-213 (215)
 60 cd04769 HTH_MerR2 Helix-Turn-H  30.8      56  0.0012   26.4   3.1   22  232-253    34-55  (116)
 61 PF04977 DivIC:  Septum formati  30.7      75  0.0016   23.2   3.5   21  256-276    28-48  (80)
 62 cd01109 HTH_YyaN Helix-Turn-He  30.2      54  0.0012   26.3   2.9   20  234-253    37-56  (113)
 63 PF04977 DivIC:  Septum formati  29.5 1.1E+02  0.0024   22.3   4.2   18  254-271    33-50  (80)
 64 PF05465 Halo_GVPC:  Halobacter  29.5      89  0.0019   20.9   3.3   25  256-280     3-27  (32)
 65 PF07106 TBPIP:  Tat binding pr  29.3      80  0.0017   27.1   4.0   26  254-279   111-136 (169)
 66 PF10186 Atg14:  UV radiation r  29.1      76  0.0016   28.4   3.9   24  254-277    72-95  (302)
 67 KOG1319|consensus               29.0      43 0.00093   31.3   2.4   24  259-282   126-149 (229)
 68 PRK00306 50S ribosomal protein  28.8      77  0.0017   23.8   3.3   19  254-272    11-29  (66)
 69 cd04790 HTH_Cfa-like_unk Helix  28.8      46   0.001   29.1   2.4   48  234-281    38-103 (172)
 70 PF10392 COG5:  Golgi transport  28.7      88  0.0019   26.1   4.0   34  248-281    68-102 (132)
 71 PRK14872 rod shape-determining  28.6      54  0.0012   32.4   3.1   27  255-281    60-86  (337)
 72 PF02403 Seryl_tRNA_N:  Seryl-t  28.5      76  0.0016   25.1   3.4   28  254-281    69-96  (108)
 73 COG2433 Uncharacterized conser  27.9      79  0.0017   33.9   4.3   26  254-279   438-463 (652)
 74 PRK00888 ftsB cell division pr  27.4      85  0.0018   25.7   3.6   20  254-273    43-62  (105)
 75 TIGR00012 L29 ribosomal protei  27.1      66  0.0014   23.4   2.6   19  254-272     7-25  (55)
 76 PRK14549 50S ribosomal protein  27.1      85  0.0019   24.0   3.3   19  254-272    14-32  (69)
 77 PF13863 DUF4200:  Domain of un  27.0      99  0.0022   24.8   3.9   27  254-280    76-102 (126)
 78 PF07106 TBPIP:  Tat binding pr  27.0      83  0.0018   27.0   3.7   26  247-272    81-106 (169)
 79 PF10281 Ish1:  Putative stress  27.0      36 0.00078   22.8   1.2   15  129-143     7-21  (38)
 80 PRK09413 IS2 repressor TnpA; R  26.9      65  0.0014   26.3   2.9   30  247-276    80-111 (121)
 81 cd04775 HTH_Cfa-like Helix-Tur  26.8      51  0.0011   26.2   2.2   50  233-282    36-101 (102)
 82 PRK00461 rpmC 50S ribosomal pr  26.8      82  0.0018   25.5   3.3   19  254-272    10-28  (87)
 83 TIGR02894 DNA_bind_RsfA transc  26.8   1E+02  0.0022   27.7   4.3   23  254-276   113-135 (161)
 84 PF03980 Nnf1:  Nnf1 ;  InterPr  26.4      46   0.001   26.6   1.9   14  254-267    96-109 (109)
 85 PRK00888 ftsB cell division pr  25.8      85  0.0019   25.7   3.3   25  254-278    36-60  (105)
 86 PF09350 DUF1992:  Domain of un  25.5      51  0.0011   25.3   1.9   16  256-271    56-71  (71)
 87 PRK10093 primosomal replicatio  25.4      67  0.0015   29.0   2.9   28  255-282   139-166 (171)
 88 PF07445 priB_priC:  Primosomal  25.4      68  0.0015   28.3   2.9   29  254-282   140-168 (173)
 89 PF10384 Scm3:  Centromere prot  25.3      87  0.0019   23.6   3.0   22  260-281     2-28  (58)
 90 PF09036 Bcr-Abl_Oligo:  Bcr-Ab  25.1      61  0.0013   26.1   2.2   27  255-282    23-49  (79)
 91 TIGR02894 DNA_bind_RsfA transc  24.9      93   0.002   28.0   3.6   34  247-280    99-132 (161)
 92 KOG0313|consensus               24.2      38 0.00083   34.4   1.2   25  118-142    53-81  (423)
 93 PF06698 DUF1192:  Protein of u  24.1 1.1E+02  0.0023   23.3   3.3   22  255-276    31-52  (59)
 94 TIGR02047 CadR-PbrR Cd(II)/Pb(  24.0      69  0.0015   26.5   2.5   21  233-253    36-56  (127)
 95 PF06156 DUF972:  Protein of un  23.9      77  0.0017   26.3   2.8   20  254-273    38-57  (107)
 96 PRK13169 DNA replication intia  23.2      79  0.0017   26.6   2.7   18  254-271    38-55  (110)
 97 PF08606 Prp19:  Prp19/Pso4-lik  23.1      90   0.002   24.6   2.8   17  254-270    24-40  (70)
 98 PF10883 DUF2681:  Protein of u  23.1 1.6E+02  0.0035   24.0   4.3   29  247-275    25-53  (87)
 99 PF12709 Kinetocho_Slk19:  Cent  23.0 1.3E+02  0.0028   24.7   3.8   19  254-272    58-76  (87)
100 PF11382 DUF3186:  Protein of u  22.5   1E+02  0.0022   29.5   3.7   36  245-280    32-67  (308)
101 PF01486 K-box:  K-box region;   22.4   1E+02  0.0022   24.4   3.1   25  255-279    15-39  (100)
102 TIGR02268 Myxococcus xanthus p  22.2      74  0.0016   31.0   2.7   28  254-281   133-160 (295)
103 KOG2216|consensus               22.1 1.2E+02  0.0025   29.9   3.9   25  257-281    88-112 (303)
104 cd04776 HTH_GnyR Helix-Turn-He  22.1      84  0.0018   25.8   2.7   22  232-253    33-54  (118)
105 cd00427 Ribosomal_L29_HIP Ribo  22.0      95  0.0021   22.6   2.6   19  254-272     8-26  (57)
106 PF07558 Shugoshin_N:  Shugoshi  21.9      46   0.001   23.7   1.0   20  254-273    16-35  (46)
107 PF09789 DUF2353:  Uncharacteri  21.9 1.1E+02  0.0023   30.3   3.7   36  245-280    72-114 (319)
108 PF10186 Atg14:  UV radiation r  21.4 1.3E+02  0.0029   26.9   4.0   31  249-279    81-111 (302)
109 PF01166 TSC22:  TSC-22/dip/bun  21.4      57  0.0012   25.0   1.4   23  256-278    11-33  (59)
110 cd04770 HTH_HMRTR Helix-Turn-H  21.2      97  0.0021   25.0   2.8   21  233-253    36-56  (123)
111 PF13591 MerR_2:  MerR HTH fami  21.0      81  0.0018   24.5   2.2   34  234-273    35-84  (84)
112 cd04787 HTH_HMRTR_unk Helix-Tu  20.6      96  0.0021   25.7   2.7   20  234-253    37-56  (133)
113 PF12644 DUF3782:  Protein of u  20.3 1.1E+02  0.0024   22.1   2.7   30  252-281     8-38  (64)
114 cd01108 HTH_CueR Helix-Turn-He  20.2      82  0.0018   25.9   2.2   21  233-253    36-56  (127)
115 PRK12461 UDP-N-acetylglucosami  20.1      46 0.00099   30.8   0.8   35  232-269   196-234 (255)
116 PF04912 Dynamitin:  Dynamitin   20.1      91   0.002   30.4   2.9   20  254-273    96-115 (388)
117 PRK00708 sec-independent trans  20.1 1.2E+02  0.0026   28.3   3.4   26  246-271    35-69  (209)
118 PF14389 Lzipper-MIP1:  Leucine  20.0 1.3E+02  0.0027   24.0   3.2   18  254-271    10-27  (88)

No 1  
>KOG3119|consensus
Probab=99.71  E-value=1.3e-16  Score=146.83  Aligned_cols=181  Identities=27%  Similarity=0.262  Sum_probs=119.4

Q ss_pred             cccccccccccCCccCCCcccCCCC---CcccchhhHHhhCCCCCCCCCCCCCCCCCCCCCCcCCCCCCccCcccccccc
Q psy17484        101 WSTVEAQAAFLGPNIWDKTLPYDSD---LKYVDLDEFLSDNGIPVDGNTSQTSTGGAPTPAANLTGGHTTTTLQNVTSTI  177 (283)
Q Consensus       101 ~~~~~~~SAfLgP~LWDKTlPyDGd---LeYMDLdEFL~ENGIp~s~~~s~~~~~~~p~~~a~~~~~~~~~s~~~~~~~~  177 (283)
                      ......+.++.+|.+|+.+++|+.+   ..|+|+++||++++|+.+..........++.+..............+.....
T Consensus        14 ~~a~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~p~~~~~~~~sa~~~~~~~p~~~~   93 (269)
T KOG3119|consen   14 LSAQLGQRARPLPPVFGPERELDLDAGLEALQDLDVGLSNVDLPDAEHQPSNILLDQPGLSLEERHSALPSSLFNPSLKS   93 (269)
T ss_pred             ccccccccccCCCCCCcccccccccccchhcccccccccccCCcccccccccccccCCCcccccccccccccccCccccc
Confidence            3356789999999999999999987   4799999999999999742111111111111000000000000000000000


Q ss_pred             cCC-CCC---C--CC----CCc---cccccCCCCCCC--CCCCCCCcCCCCCCCCccccCCCCCCCCCCCCCCCCccccC
Q psy17484        178 SGR-LSP---C--GS----SQA---SVMTKRERSPSP--SEPMSPLTISPPSPADSTLSFTSSTRDFDPRSRTFSDEELK  242 (283)
Q Consensus       178 s~~-~~~---~--~~----~~~---~~~~~~~~tPSP--~~~i~pd~i~~PDPaDLaLSSvPG~E~FDPRkhkFSEEELK  242 (283)
                      ... .+.   .  ..    ...   ..-...+.+++|  .+++.+...+.++++++..|..++++.|+|++++|+...+|
T Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~s~~~~~  173 (269)
T KOG3119|consen   94 SPFGPSELAEVTRTSESRPGPRAPRSTDLASRATPSPVPPDTLQPLVGYEPDPSDLAASSSPSPSSPDPSKPKSSGAKLK  173 (269)
T ss_pred             ccCCccccccccCcccccccccccccccccccCCCCCCChhhccccccCCCCccccccccCCCCCCCCCCCCCCcccccC
Confidence            000 000   0  00    000   000112234444  46666776667999999999999999999999999999999


Q ss_pred             Ccchhhhhhhh----------------------------------------------hhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        243 PQPMVKKSRKQ----------------------------------------------NMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       243 PQPMIKKARKv----------------------------------------------NaaLRqEVa~LRKElgr~rniLs  276 (283)
                      +|.++||++|+                                              |.+||++|.+|++||..||+++.
T Consensus       174 ~~~~~~K~~~~~~~~~~~~~~y~err~rNN~A~~kSR~~~k~~~~e~~~r~~~leken~~lr~~v~~l~~el~~~~~~~~  253 (269)
T KOG3119|consen  174 PQSTARKKSKLSSPVEKKDPEYKERRRRNNEAVRKSRDKRKQKEDEMAHRVAELEKENEALRTQVEQLKKELATLRRLFL  253 (269)
T ss_pred             CccchhhhccCCCchhcCCHHHHHHHHhhhHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999998877                                              99999999999999999999999


Q ss_pred             hhhcc
Q psy17484        277 KFTDL  281 (283)
Q Consensus       277 KYE~~  281 (283)
                      .|.+.
T Consensus       254 ~~~~~  258 (269)
T KOG3119|consen  254 QLPKP  258 (269)
T ss_pred             hhccc
Confidence            98764


No 2  
>PF09006 Surfac_D-trimer:  Lung surfactant protein D coiled-coil trimerisation;  InterPro: IPR015097 This domain is found in the SFTPD family, which includes lung surfactant protein D (SFTPD), conglutinin, collectin-43 and collectin-46. It forms a triple-helical parallel coiled coil, and mediates trimerisation of the protein []. ; PDB: 4DN8_A 3G84_A 2RIE_C 3IKR_B 1B08_A 2GGX_B 2OS9_C 2ORK_B 1PWB_A 2RIA_C ....
Probab=91.65  E-value=0.22  Score=36.26  Aligned_cols=28  Identities=25%  Similarity=0.362  Sum_probs=25.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      +||||-|..|..++.++.+.+|+|..+.
T Consensus         2 ~aLrqQv~aL~~qv~~Lq~~fs~yKKa~   29 (46)
T PF09006_consen    2 NALRQQVEALQGQVQRLQAAFSQYKKAE   29 (46)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5899999999999999999999998763


No 3  
>PF14775 NYD-SP28_assoc:  Sperm tail C-terminal domain
Probab=84.41  E-value=1.9  Score=32.35  Aligned_cols=25  Identities=36%  Similarity=0.500  Sum_probs=24.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      .++|-+|+..||+++..+|++|..|
T Consensus        35 R~~l~~e~~~L~~qN~eLr~lLkqY   59 (60)
T PF14775_consen   35 RAALIQEKESLEQQNEELRSLLKQY   59 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            8899999999999999999999988


No 4  
>smart00338 BRLZ basic region leucin zipper.
Probab=82.57  E-value=2.1  Score=31.42  Aligned_cols=23  Identities=39%  Similarity=0.628  Sum_probs=21.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLs  276 (283)
                      |..|+.+|..|++|+..+++++.
T Consensus        42 n~~L~~~~~~l~~e~~~lk~~~~   64 (65)
T smart00338       42 NERLKKEIERLRRELEKLKSELE   64 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999875


No 5  
>PF07407 Seadorna_VP6:  Seadornavirus VP6 protein;  InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus. Members of this family are typically of around 420 residues in length. The function of this family is unknown.
Probab=80.26  E-value=1.7  Score=43.28  Aligned_cols=27  Identities=37%  Similarity=0.537  Sum_probs=21.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      |+|||||=+.||||+..+|..|.+-|+
T Consensus        34 ~~aLr~EN~~LKkEN~~Lk~eVerLE~   60 (420)
T PF07407_consen   34 NFALRMENHSLKKENNDLKIEVERLEN   60 (420)
T ss_pred             hhhHHHHhHHHHHHHHHHHHHHHHHHH
Confidence            778888888888888888887777665


No 6  
>PRK10265 chaperone-modulator protein CbpM; Provisional
Probab=77.67  E-value=2.8  Score=33.80  Aligned_cols=26  Identities=42%  Similarity=0.592  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        256 GLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      -|=+|+.+||+|+.++++.|++|+..
T Consensus        75 ~LLd~i~~Lr~el~~L~~~l~~~~~~  100 (101)
T PRK10265         75 TLLDEIAHLKQENRLLRQRLSRFVAH  100 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            36789999999999999999999863


No 7  
>PF07989 Microtub_assoc:  Microtubule associated;  InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [].
Probab=75.72  E-value=4.9  Score=31.38  Aligned_cols=34  Identities=26%  Similarity=0.363  Sum_probs=28.8

Q ss_pred             hhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        247 VKKSRKQNMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       247 IKKARKvNaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      ++.+-|-|.-|+.||+.||+|+..++.-|.+-+.
T Consensus        38 ~~~~~keNieLKve~~~L~~el~~~~~~l~~a~~   71 (75)
T PF07989_consen   38 IEELLKENIELKVEVESLKRELQEKKKLLKEAEK   71 (75)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4566677999999999999999999998876554


No 8  
>cd00068 GGL G protein gamma subunit-like motifs, the alpha-helical G-gamma chain dimerizes with the G-beta propeller subunit as part of the heterotrimeric G-protein complex; involved in signal transduction via G-protein-coupled receptors
Probab=75.07  E-value=2.1  Score=31.47  Aligned_cols=22  Identities=45%  Similarity=0.516  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Q psy17484        256 GLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsK  277 (283)
                      .+|+||..||+|+++.|-.+|+
T Consensus         3 ~~~~~veqLr~el~~~RikvS~   24 (57)
T cd00068           3 QLKKEVEQLRKELSRERLKVSK   24 (57)
T ss_pred             HHHHHHHHHHHHHCCchhhHHH
Confidence            5899999999999998877775


No 9  
>smart00224 GGL G protein gamma subunit-like motifs.
Probab=73.88  E-value=1.9  Score=32.32  Aligned_cols=22  Identities=50%  Similarity=0.549  Sum_probs=19.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Q psy17484        256 GLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsK  277 (283)
                      .+|+||..||+|++|-|-.+|+
T Consensus         3 ~~~~~ve~Lr~el~~~RikvS~   24 (63)
T smart00224        3 QLRKEVEQLRKELSRERIKVSK   24 (63)
T ss_pred             HHHHHHHHHHHHHCCceehHHH
Confidence            6899999999999998877665


No 10 
>PRK13922 rod shape-determining protein MreC; Provisional
Probab=70.43  E-value=6.1  Score=36.22  Aligned_cols=21  Identities=24%  Similarity=0.324  Sum_probs=12.8

Q ss_pred             hhhhhhhHHHHHHHHHHHHHH
Q psy17484        249 KSRKQNMGLRQEMERLKKENL  269 (283)
Q Consensus       249 KARKvNaaLRqEVa~LRKElg  269 (283)
                      +.++-|..||+|+++|+.++.
T Consensus        73 ~l~~en~~L~~e~~~l~~~~~   93 (276)
T PRK13922         73 DLREENEELKKELLELESRLQ   93 (276)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            334447777777766655544


No 11 
>KOG4196|consensus
Probab=70.13  E-value=5.8  Score=34.64  Aligned_cols=25  Identities=40%  Similarity=0.659  Sum_probs=20.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      |+-|+|||..||.|+.+++--+.-|
T Consensus        83 k~~L~qqv~~L~~e~s~~~~E~da~  107 (135)
T KOG4196|consen   83 KAELQQQVEKLKEENSRLRRELDAY  107 (135)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999998887655433


No 12 
>PF02183 HALZ:  Homeobox associated leucine zipper;  InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=69.86  E-value=6.5  Score=28.07  Aligned_cols=23  Identities=35%  Similarity=0.508  Sum_probs=20.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLs  276 (283)
                      |.+|.+|+..||.|+..+++.|.
T Consensus        21 ~~~L~~E~~~L~aev~~L~~kl~   43 (45)
T PF02183_consen   21 YDSLKKENEKLRAEVQELKEKLQ   43 (45)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhc
Confidence            88999999999999999998874


No 13 
>PF06005 DUF904:  Protein of unknown function (DUF904);  InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA.; GO: 0000917 barrier septum formation, 0043093 cytokinesis by binary fission, 0005737 cytoplasm; PDB: 2JEE_A.
Probab=69.84  E-value=7  Score=30.36  Aligned_cols=27  Identities=41%  Similarity=0.559  Sum_probs=14.4

Q ss_pred             hhHHHHHHHHHHHH----HHHHHHHHhhhhc
Q psy17484        254 NMGLRQEMERLKKE----NLSLRDKLSKFTD  280 (283)
Q Consensus       254 NaaLRqEVa~LRKE----lgr~rniLsKYE~  280 (283)
                      |..|++|...||+|    -.|++.+|.|.+.
T Consensus        41 ~~~L~~en~~L~~e~~~~~~rl~~LL~kl~~   71 (72)
T PF06005_consen   41 NEELKEENEQLKQERNAWQERLRSLLGKLEE   71 (72)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            44445555555544    3566666666554


No 14 
>TIGR02449 conserved hypothetical protein TIGR02449. Members of this family are small proteins, typically 73 amino acids in length, with single copies in each of several Proteobacteria, including Xylella fastidiosa, Pseudomonas aeruginosa, and Xanthomonas campestris. The function is unknown.
Probab=64.40  E-value=12  Score=28.96  Aligned_cols=22  Identities=27%  Similarity=0.270  Sum_probs=19.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRDKL  275 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniL  275 (283)
                      |+.||++++.++.|-.+++...
T Consensus        23 N~~Lr~q~~~~~~ER~~L~ekn   44 (65)
T TIGR02449        23 NRLLRAQEKTWREERAQLLEKN   44 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999988876654


No 15 
>PRK09413 IS2 repressor TnpA; Reviewed
Probab=60.38  E-value=16  Score=29.81  Aligned_cols=34  Identities=21%  Similarity=0.258  Sum_probs=26.0

Q ss_pred             CcchhhhhhhhhhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        243 PQPMVKKSRKQNMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       243 PQPMIKKARKvNaaLRqEVa~LRKElgr~rniLs  276 (283)
                      +...++..++-|..||+||++|+.|+.-+|+.+.
T Consensus        69 ~~~~~~~~~~ei~~L~~el~~L~~E~diLKKa~~  102 (121)
T PRK09413         69 PASELAAAMKQIKELQRLLGKKTMENELLKEAVE  102 (121)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344566667799999999999999888777653


No 16 
>PF00170 bZIP_1:  bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature;  InterPro: IPR011616  The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0046983 protein dimerization activity, 0006355 regulation of transcription, DNA-dependent; PDB: 2H7H_B 2OQQ_B 1S9K_E 1JNM_A 1JUN_A 1FOS_H 1A02_J 1T2K_C 1CI6_A 1DH3_C ....
Probab=58.85  E-value=19  Score=26.36  Aligned_cols=21  Identities=48%  Similarity=0.650  Sum_probs=15.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRDK  274 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rni  274 (283)
                      |..|+.++..|++|+..+++.
T Consensus        42 n~~L~~~~~~L~~~~~~L~~e   62 (64)
T PF00170_consen   42 NEELKKELEQLKKEIQSLKSE   62 (64)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            777777777777777777654


No 17 
>KOG4119|consensus
Probab=58.74  E-value=11  Score=29.71  Aligned_cols=29  Identities=34%  Similarity=0.300  Sum_probs=23.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      |..+|.+|..||.|++..|-.+|+-.+.|
T Consensus         9 ~~q~k~~VeqLk~e~~~~R~~vS~a~~el   37 (71)
T KOG4119|consen    9 KPQMKKEVEQLKLEANIERIKVSKAAAEL   37 (71)
T ss_pred             hHHHHHHHHHHHHHHHhhHhhHHHHHHHH
Confidence            46789999999999999888888765443


No 18 
>PF07544 Med9:  RNA polymerase II transcription mediator complex subunit 9;  InterPro: IPR011425 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.  The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11.  The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.   The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22.  The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4.  The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16.  The CDK8 module contains: MED12, MED13, CCNC and CDK8.   Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. This entry represents subunit Med9 of the Mediator complex. Subunit Med9 is part of the middle module of the Mediator complex []; this associates with the core polymerase subunits to form the RNA polymerase II holoenzyme. Med9 alternatively known as the chromosome segregation protein, CSE2 (P33308 from SWISSPROT) is required, along with CSE1 (P33307 from SWISSPROT) for accurate mitotic chromosome segregation in Saccharomyces cerevisiae (Baker's yeast) [].; GO: 0001104 RNA polymerase II transcription cofactor activity, 0006357 regulation of transcription from RNA polymerase II promoter, 0016592 mediator complex
Probab=58.12  E-value=19  Score=28.18  Aligned_cols=25  Identities=28%  Similarity=0.433  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        257 LRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       257 LRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      --+|++.||+++.+-|.+|.||...
T Consensus        57 q~~~i~~Le~~i~~k~~~L~~~~~~   81 (83)
T PF07544_consen   57 QEEEIEELEEQIRKKREVLQKFKER   81 (83)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4568999999999999999999754


No 19 
>TIGR00219 mreC rod shape-determining protein MreC. MreC (murein formation C) is involved in the rod shape determination in E. coli, and more generally in cell shape determination of bacteria whether or not they are rod-shaped. Cells defective in MreC are round. Species with MreC include many of the Proteobacteria, Gram-positives, and spirochetes.
Probab=57.12  E-value=14  Score=34.91  Aligned_cols=23  Identities=48%  Similarity=0.667  Sum_probs=16.4

Q ss_pred             hhHHHHHHHHH-----------HHHHHHHHHHHh
Q psy17484        254 NMGLRQEMERL-----------KKENLSLRDKLS  276 (283)
Q Consensus       254 NaaLRqEVa~L-----------RKElgr~rniLs  276 (283)
                      |..||+|+++|           ++||.|+|+.|.
T Consensus        75 N~~Lr~e~~~l~~~~~~~~~~l~~EN~rLr~LL~  108 (283)
T TIGR00219        75 NYKLRQELLKKNQQLEILTQNLKQENVRLRELLN  108 (283)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            88888887654           666777777654


No 20 
>PF08826 DMPK_coil:  DMPK coiled coil domain like;  InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure. It plays a role in dimerisation []. ; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 1WT6_D.
Probab=56.90  E-value=18  Score=27.53  Aligned_cols=22  Identities=59%  Similarity=0.696  Sum_probs=18.7

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHH
Q psy17484        252 KQNMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       252 KvNaaLRqEVa~LRKElgr~rn  273 (283)
                      +-|..|-+||..|++|+..+|.
T Consensus        39 ~rn~eL~~ei~~L~~e~ee~r~   60 (61)
T PF08826_consen   39 KRNRELEQEIERLKKEMEELRS   60 (61)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHHHHHHHhhc
Confidence            3399999999999999988764


No 21 
>PF08776 VASP_tetra:  VASP tetramerisation domain;  InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure []. ; PDB: 1USE_A 1USD_A.
Probab=55.44  E-value=16  Score=26.10  Aligned_cols=18  Identities=33%  Similarity=0.602  Sum_probs=13.7

Q ss_pred             HHHHHH-HHHHHHHHHHHH
Q psy17484        256 GLRQEM-ERLKKENLSLRD  273 (283)
Q Consensus       256 aLRqEV-a~LRKElgr~rn  273 (283)
                      +|+||+ .++|||+.+.|+
T Consensus         7 ~~KqEIL~EvrkEl~K~K~   25 (40)
T PF08776_consen    7 RLKQEILEEVRKELQKVKE   25 (40)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            567775 578888888876


No 22 
>PRK14127 cell division protein GpsB; Provisional
Probab=54.39  E-value=15  Score=30.77  Aligned_cols=27  Identities=30%  Similarity=0.190  Sum_probs=21.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      |..|+.|++.|++++..++..++.|+.
T Consensus        46 ~~~Lk~e~~~l~~~l~e~~~~~~~~~~   72 (109)
T PRK14127         46 IEELQQENARLKAQVDELTKQVSVGAS   72 (109)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccccc
Confidence            788888888888888888888777754


No 23 
>cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator. Helix-turn-helix (HTH) transcription regulator MerD. The putative secondary regulator of mercury resistance (mer) operons, MerD, has been shown to down-regulate the expression of this operon in gram-negative bacteria. It binds to the same operator DNA as MerR that activates transcription of the operon in the presence of mercury ions. The MerD protein shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily, which promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are conserved and contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules such as metal ions, drugs, 
Probab=54.04  E-value=18  Score=29.28  Aligned_cols=46  Identities=22%  Similarity=0.227  Sum_probs=36.1

Q ss_pred             CCCCCCccccCCcchhhhhhhh-------------------------hhHHHHHHHHHHHHHHHHHHHHhh
Q psy17484        232 RSRTFSDEELKPQPMVKKSRKQ-------------------------NMGLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       232 RkhkFSEEELKPQPMIKKARKv-------------------------NaaLRqEVa~LRKElgr~rniLsK  277 (283)
                      ..|.|++++|.---+|+.+|..                         ...+++++++.+++|.+++..|.+
T Consensus        35 g~R~Y~~~~l~~l~~I~~lr~~G~~l~~I~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~l~~~L~~  105 (107)
T cd01111          35 GYGLFDDCALQRLRFVRAAFEAGIGLDELARLCRALDAGDGKQPEACLAQLRQKIEVRRAALNALTTQLAE  105 (107)
T ss_pred             CCeecCHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHhCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4566899999999999999876                         556677777777888888877754


No 24 
>KOG4196|consensus
Probab=53.16  E-value=12  Score=32.70  Aligned_cols=25  Identities=28%  Similarity=0.422  Sum_probs=20.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      =-.||+|++.||.|+.-||++   ||++
T Consensus        90 v~~L~~e~s~~~~E~da~k~k---~e~l  114 (135)
T KOG4196|consen   90 VEKLKEENSRLRRELDAYKSK---YEAL  114 (135)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH---HHHH
Confidence            357899999999999988876   6654


No 25 
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=52.39  E-value=9  Score=30.66  Aligned_cols=43  Identities=16%  Similarity=0.324  Sum_probs=34.3

Q ss_pred             CCCCCCccccCCcchhhhh-hhh--------------------hhHHHHHHHHHHHHHHHHHHH
Q psy17484        232 RSRTFSDEELKPQPMVKKS-RKQ--------------------NMGLRQEMERLKKENLSLRDK  274 (283)
Q Consensus       232 RkhkFSEEELKPQPMIKKA-RKv--------------------NaaLRqEVa~LRKElgr~rni  274 (283)
                      ..|.|+++++.---.||.. |+.                    =+++++++-++|+|+..+|.-
T Consensus        35 g~R~Yt~~di~~l~~I~~llr~~G~~l~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~   98 (99)
T cd04765          35 GRRYYRPKDVELLLLIKHLLYEKGYTIEGAKQALKEDGAAAIREEEAEERLPSIRAELLDLRDQ   98 (99)
T ss_pred             CCeeeCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHhccccccchhhHHHHHHHHHHHHHHHHhc
Confidence            4567999999988888874 543                    356999999999999998863


No 26 
>PRK03100 sec-independent translocase; Provisional
Probab=51.06  E-value=20  Score=31.19  Aligned_cols=28  Identities=21%  Similarity=0.311  Sum_probs=18.9

Q ss_pred             hhhhhhhh--------hhHHHHHHHHHHHHHHHHHH
Q psy17484        246 MVKKSRKQ--------NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       246 MIKKARKv--------NaaLRqEVa~LRKElgr~rn  273 (283)
                      +||++|+.        +..|.-|+.+|||++..+++
T Consensus        36 ~vr~~R~~~~~~~~~~~~elg~e~~dlrk~l~el~~   71 (136)
T PRK03100         36 ALRQARDYASGATSQLREELGPEFDDLRKPLGELQK   71 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHH
Confidence            56777776        34444577899997766554


No 27 
>PF14197 Cep57_CLD_2:  Centrosome localisation domain of PPC89 
Probab=50.06  E-value=17  Score=27.94  Aligned_cols=20  Identities=45%  Similarity=0.494  Sum_probs=17.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rn  273 (283)
                      |.-|+.||..|||||..|+.
T Consensus        49 ~~~Lk~E~e~L~~el~~~r~   68 (69)
T PF14197_consen   49 NNKLKEENEALRKELEELRA   68 (69)
T ss_pred             HHHHHHHHHHHHHHHHHhhc
Confidence            88899999999999888764


No 28 
>smart00340 HALZ homeobox associated leucin zipper.
Probab=49.38  E-value=13  Score=26.97  Aligned_cols=12  Identities=33%  Similarity=0.614  Sum_probs=9.3

Q ss_pred             hhHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLK  265 (283)
Q Consensus       254 NaaLRqEVa~LR  265 (283)
                      |..|+.||++||
T Consensus        21 NrRL~ke~~eLr   32 (44)
T smart00340       21 NRRLQKEVQELR   32 (44)
T ss_pred             HHHHHHHHHHHH
Confidence            777777777776


No 29 
>PRK13922 rod shape-determining protein MreC; Provisional
Probab=48.48  E-value=24  Score=32.37  Aligned_cols=27  Identities=30%  Similarity=0.501  Sum_probs=14.1

Q ss_pred             hhhhhhHHHHHHH---HHHHHHHHHHHHHh
Q psy17484        250 SRKQNMGLRQEME---RLKKENLSLRDKLS  276 (283)
Q Consensus       250 ARKvNaaLRqEVa---~LRKElgr~rniLs  276 (283)
                      -|+.|+.|++|++   +|++|+.++|..|.
T Consensus        81 L~~e~~~l~~~~~~~~~l~~en~~L~~lL~  110 (276)
T PRK13922         81 LKKELLELESRLQELEQLEAENARLRELLN  110 (276)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3444555555555   44555555555543


No 30 
>PF00631 G-gamma:  GGL domain;  InterPro: IPR015898 This entry represents the G protein gamma subunit and the GGL (G protein gamma-like) domain, which are related in sequence and are comprised of an extended alpha-helical polypeptide. The G protein gamma subunit forms a stable dimer with the beta subunit, but it does not make any contact with the alpha subunit, which contacts the opposite face of the beta subunit. The GGL domain is found in several RGS (regulators of G protein signaling) proteins. GGL domains can interact with beta subunits to form novel dimers that prevent gamma subunit binding, and may prevent heterotrimer formation by inhibiting alpha subunit binding. The interaction between G protein beta-5 neuro-specific isoforms and RGS GGL domains may represent a general mode of binding between beta-propeller proteins and their partners [].; GO: 0004871 signal transducer activity, 0007186 G-protein coupled receptor protein signaling pathway, 0005834 heterotrimeric G-protein complex; PDB: 3PSC_G 3SN6_G 1OMW_G 2BCJ_G 1GG2_G 3PVW_G 3PVU_G 3AH8_G 3CIK_G 1GP2_G ....
Probab=47.32  E-value=14  Score=27.68  Aligned_cols=23  Identities=39%  Similarity=0.432  Sum_probs=14.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhh
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsK  277 (283)
                      .+|++||..||+|+.+-|-.+|+
T Consensus         5 ~~l~~ei~~L~~el~~~r~~vS~   27 (68)
T PF00631_consen    5 DQLKREIEQLRQELERERIKVSK   27 (68)
T ss_dssp             HHHHHHHHHHHHHHTS----HHH
T ss_pred             HHHHHHHHHHHHHHcccceeHHH
Confidence            47888999999998775544443


No 31 
>KOG4378|consensus
Probab=46.84  E-value=14  Score=38.88  Aligned_cols=20  Identities=40%  Similarity=0.499  Sum_probs=16.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rn  273 (283)
                      |-+|..|+.-||+|+.++|.
T Consensus       652 Ne~l~aelk~lreenq~lr~  671 (673)
T KOG4378|consen  652 NEMLKAELKFLREENQTLRC  671 (673)
T ss_pred             hHHHHHHHHHHHHhhhhhhc
Confidence            88888888888888887774


No 32 
>PF07716 bZIP_2:  Basic region leucine zipper;  InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0046983 protein dimerization activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1NWQ_A 1H89_B 1H88_A 1GTW_B 2E43_A 1IO4_A 1GU4_B 2E42_A 1H8A_B 1GU5_B ....
Probab=46.79  E-value=23  Score=25.28  Aligned_cols=25  Identities=32%  Similarity=0.559  Sum_probs=14.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      ...|.++|.+|..|+..++.-+...
T Consensus        27 ~~~le~~~~~L~~en~~L~~~i~~L   51 (54)
T PF07716_consen   27 EEELEQEVQELEEENEQLRQEIAQL   51 (54)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4455566666666666665555544


No 33 
>PF07407 Seadorna_VP6:  Seadornavirus VP6 protein;  InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus. Members of this family are typically of around 420 residues in length. The function of this family is unknown.
Probab=45.47  E-value=20  Score=36.01  Aligned_cols=21  Identities=33%  Similarity=0.389  Sum_probs=15.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRDK  274 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rni  274 (283)
                      |.+||+|-.+||.|+.|+.+=
T Consensus        41 N~~LKkEN~~Lk~eVerLE~e   61 (420)
T PF07407_consen   41 NHSLKKENNDLKIEVERLENE   61 (420)
T ss_pred             hHHHHHHHHHHHHHHHHHHHH
Confidence            788888888888887777653


No 34 
>PF04508 Pox_A_type_inc:  Viral A-type inclusion protein repeat ;  InterPro: IPR007596 The repeat is found in the A-type inclusion protein of the Poxvirus family [].; GO: 0016032 viral reproduction
Probab=43.85  E-value=28  Score=22.12  Aligned_cols=18  Identities=22%  Similarity=0.350  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy17484        256 GLRQEMERLKKENLSLRD  273 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rn  273 (283)
                      .||..+.+|.++|..|+.
T Consensus         5 rlr~rI~dLer~L~~C~~   22 (23)
T PF04508_consen    5 RLRNRISDLERQLSECRR   22 (23)
T ss_pred             HHHHHHHHHHHHHHHHhc
Confidence            688889999999998874


No 35 
>KOG3119|consensus
Probab=43.08  E-value=10  Score=35.65  Aligned_cols=41  Identities=15%  Similarity=0.062  Sum_probs=35.0

Q ss_pred             hhhhhhhhcCccccccCCCCCcc---hhhh-hhhhhhccCCCCCC
Q psy17484         48 TVEAQAAFLGPNIWDKTLPYDSD---LKVM-LSPLVLSTGKTNCK   88 (283)
Q Consensus        48 ~~~~~sA~LgP~lWdKTlpy~gd---l~~~-l~~f~~enG~~~~~   88 (283)
                      ...++.++.+|.+|+.+++|+.+   ..|+ ++.|+..++++...
T Consensus        16 a~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~   60 (269)
T KOG3119|consen   16 AQLGQRARPLPPVFGPERELDLDAGLEALQDLDVGLSNVDLPDAE   60 (269)
T ss_pred             ccccccccCCCCCCcccccccccccchhcccccccccccCCcccc
Confidence            47889999999999999999987   4445 99999999988654


No 36 
>PF15035 Rootletin:  Ciliary rootlet component, centrosome cohesion
Probab=42.07  E-value=38  Score=30.37  Aligned_cols=27  Identities=33%  Similarity=0.602  Sum_probs=17.1

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        250 SRKQNMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       250 ARKvNaaLRqEVa~LRKElgr~rniLs  276 (283)
                      |++.|.+|+.|+..|+.++.+++.-|.
T Consensus        93 ~~~~N~~L~~dl~klt~~~~~l~~eL~  119 (182)
T PF15035_consen   93 ARKANEALQEDLQKLTQDWERLRDELE  119 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344477777777777666666665554


No 37 
>PF11598 COMP:  Cartilage oligomeric matrix protein;  InterPro: IPR024665 Thrombospondins are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. Cartilage oligomeric matrix protein may play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as collagen and fibronectin [, ]. Thrombospondin 3 and 4 and cartilage oligomeric matrix proteins contain a five-stranded coiled-coil domain represented by this entry. This domain has a binding site between two internal rings formed by Leu37 and Thr40 [].; PDB: 1MZ9_D 1FBM_A 1VDF_E.
Probab=41.80  E-value=40  Score=24.38  Aligned_cols=25  Identities=20%  Similarity=0.267  Sum_probs=20.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFT  279 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE  279 (283)
                      +-||++|.+-+||...+||.|..-+
T Consensus        18 ~elk~~l~~Q~kE~~~LRntI~eC~   42 (45)
T PF11598_consen   18 QELKELLRQQIKETRFLRNTIMECQ   42 (45)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHT-T
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3478999999999999999987543


No 38 
>PF10458 Val_tRNA-synt_C:  Valyl tRNA synthetase tRNA binding arm;  InterPro: IPR019499 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This entry represents the C-terminal domain of Valyl-tRNA synthetase, which consists of two helices in a long alpha-hairpin. Valyl-tRNA synthetase (6.1.1.9 from EC) is an alpha monomer that belongs to class Ia.; GO: 0000166 nucleotide binding, 0004832 valine-tRNA ligase activity, 0005524 ATP binding, 0006438 valyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IVS_B 1GAX_B.
Probab=41.64  E-value=32  Score=25.57  Aligned_cols=25  Identities=32%  Similarity=0.494  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        258 RQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       258 RqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      -.|++.|.||+.++..-|.+++..|
T Consensus         3 ~~E~~rL~Kel~kl~~~i~~~~~kL   27 (66)
T PF10458_consen    3 EAEIERLEKELEKLEKEIERLEKKL   27 (66)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4577777777777777777666554


No 39 
>PF04880 NUDE_C:  NUDE protein, C-terminal conserved region;  InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins. Emericella nidulans (Aspergillus nidulans) NUDE, acts in the cytoplasmic dynein/dynactin pathway and is required for distribution of nuclei []. It is a homologue of the nuclear distribution protein RO11 of Neurospora crassa. NUDE interacts with the NUDF via an N-terminal coiled coil domain; this is the only domain which is absolutely required for NUDE function.; PDB: 2V66_B 2V71_B.
Probab=41.16  E-value=9.3  Score=34.19  Aligned_cols=22  Identities=32%  Similarity=0.462  Sum_probs=0.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLs  276 (283)
                      +..||.|+-|||+|+ .++.++.
T Consensus        33 ~QRLkDE~RDLKqEl-~V~ek~~   54 (166)
T PF04880_consen   33 VQRLKDELRDLKQEL-IVQEKLR   54 (166)
T ss_dssp             H----------------------
T ss_pred             HHHHHHHHHHHHHHH-HHHHHhh
Confidence            889999999999999 7777664


No 40 
>PRK14127 cell division protein GpsB; Provisional
Probab=41.05  E-value=33  Score=28.80  Aligned_cols=28  Identities=25%  Similarity=0.477  Sum_probs=24.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      -.+|-.|+++|+.|+.+++..|..|+.-
T Consensus        39 ye~l~~e~~~Lk~e~~~l~~~l~e~~~~   66 (109)
T PRK14127         39 YEAFQKEIEELQQENARLKAQVDELTKQ   66 (109)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5678889999999999999999999864


No 41 
>PF12808 Mto2_bdg:  Micro-tubular organiser Mto1 C-term Mto2-binding region;  InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi. In Schizosaccharomyces pombe it has been shown to interact with the Mto2p protein, an interaction which is critical for anchoring the cytokinetic actin ring to the medial region of the cell and for proper coordination of mitosis with cytokinesis [, ].
Probab=39.87  E-value=40  Score=25.07  Aligned_cols=25  Identities=28%  Similarity=0.484  Sum_probs=22.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      +.+.++++.+|+.|+-.+|..|.+-
T Consensus        24 ~~~a~~rl~~l~~EN~~Lr~eL~~~   48 (52)
T PF12808_consen   24 RSAARKRLSKLEGENRLLRAELERL   48 (52)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHH
Confidence            7888999999999999999988763


No 42 
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain  with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=39.71  E-value=26  Score=27.07  Aligned_cols=45  Identities=20%  Similarity=0.414  Sum_probs=34.6

Q ss_pred             CCCCCccccCCcchhhhhhh-h---------hhHHHHHHHHHHHHHHHHHHHHhh
Q psy17484        233 SRTFSDEELKPQPMVKKSRK-Q---------NMGLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       233 khkFSEEELKPQPMIKKARK-v---------NaaLRqEVa~LRKElgr~rniLsK  277 (283)
                      .+.|+++++.---.|+..++ .         -..|+.++..|++|+.++++.|.+
T Consensus        36 ~R~y~~~dv~~l~~i~~L~~d~g~~l~~i~~~l~l~~~~~~l~~~l~~l~~~~~~   90 (91)
T cd04766          36 TRRYSERDIERLRRIQRLTQELGVNLAGVKRILELEEELAELRAELDELRARLRR   90 (91)
T ss_pred             CeeECHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            46689999998888888877 3         344777888888888888877654


No 43 
>PRK11239 hypothetical protein; Provisional
Probab=39.55  E-value=31  Score=32.32  Aligned_cols=26  Identities=23%  Similarity=0.331  Sum_probs=15.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      ++|.++|++|+.|+..+|..|.+...
T Consensus       186 ~~Le~rv~~Le~eva~L~~~l~~l~~  211 (215)
T PRK11239        186 GDLQARVEALEIEVAELKQRLDSLLA  211 (215)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44666666666666666666555443


No 44 
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=39.44  E-value=40  Score=28.34  Aligned_cols=25  Identities=24%  Similarity=0.360  Sum_probs=22.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      ...|++|+.+.|+||.+||.-|..|
T Consensus        27 q~~l~~eL~~~k~el~~yk~~V~~H   51 (128)
T PF06295_consen   27 QAKLEQELEQAKQELEQYKQEVNDH   51 (128)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4789999999999999999988774


No 45 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=38.73  E-value=31  Score=24.98  Aligned_cols=21  Identities=38%  Similarity=0.545  Sum_probs=13.1

Q ss_pred             hhhhHHHHHHHHHHHHHHHHH
Q psy17484        252 KQNMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       252 KvNaaLRqEVa~LRKElgr~r  272 (283)
                      +-+..+|.|+++++||+..+|
T Consensus        48 ~~~~~~~k~l~~le~e~~~lr   68 (68)
T PF06305_consen   48 RRIRRLRKELKKLEKELEQLR   68 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHhcC
Confidence            335666667777777766543


No 46 
>PF12329 TMF_DNA_bd:  TATA element modulatory factor 1 DNA binding;  InterPro: IPR022092  This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures. The whole proteins bind to the TATA element of some RNA polymerase II promoters and repress their activity. by competing with the binding of TATA binding protein. TMFs are evolutionarily conserved golgins that bind Rab6, a ubiquitous ras-like GTP-binding Golgi protein, and contribute to Golgi organisation in animal [] and plant [] cells. 
Probab=37.69  E-value=31  Score=26.65  Aligned_cols=42  Identities=36%  Similarity=0.501  Sum_probs=25.6

Q ss_pred             CCccccCCcchhhhhhhhhh-------HHHHHHHHHHHHHHHHHHHHhh
Q psy17484        236 FSDEELKPQPMVKKSRKQNM-------GLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       236 FSEEELKPQPMIKKARKvNa-------aLRqEVa~LRKElgr~rniLsK  277 (283)
                      +|--||+--=.|||-|+.|.       .|+..++++-+++..++..|+.
T Consensus        24 LSk~el~~~~~IKKLr~~~~e~e~~~~~l~~~~~~~e~~~~~l~~~l~~   72 (74)
T PF12329_consen   24 LSKKELKLNNTIKKLRAKIKELEKQIKELKKKLEELEKELESLEERLKR   72 (74)
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            45567777778999888744       4444444445555555555543


No 47 
>PRK00182 tatB sec-independent translocase; Provisional
Probab=36.66  E-value=45  Score=29.90  Aligned_cols=26  Identities=12%  Similarity=0.239  Sum_probs=16.4

Q ss_pred             hhhhhhhh--------hhHHHHHHHHHHHHHHHH
Q psy17484        246 MVKKSRKQ--------NMGLRQEMERLKKENLSL  271 (283)
Q Consensus       246 MIKKARKv--------NaaLRqEVa~LRKElgr~  271 (283)
                      +||++|+.        +.-|+-|+.+|||.+..+
T Consensus        36 ~ir~~R~~~~~~k~el~~Elg~e~~elrk~l~~l   69 (160)
T PRK00182         36 ALLAARTAINNAKQQLDGDFGEEFDEFRKPLNQI   69 (160)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHH
Confidence            56677765        344555667888876653


No 48 
>PF11594 Med28:  Mediator complex subunit 28;  InterPro: IPR021640  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species [],[]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Subunit Med28 of the Mediator may function as a scaffolding protein within Mediator by maintaining the stability of a submodule within the head module, and components of this submodule act together in a gene-regulatory programme to suppress smooth muscle cell differentiation. Thus, mammalian Mediator subunit Med28 functions as a repressor of smooth muscle-cell differentiation, which could have implications for disorders associated with abnormalities in smooth muscle cell growth and differentiation, including atherosclerosis, asthma, hypertension, and smooth muscle tumours []. 
Probab=36.00  E-value=42  Score=28.29  Aligned_cols=27  Identities=26%  Similarity=0.308  Sum_probs=21.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      -..|++|+.+||.||.|-...|.|+..
T Consensus        37 e~~lkEEi~eLK~ElqRKe~Ll~Kh~~   63 (106)
T PF11594_consen   37 EQVLKEEINELKEELQRKEQLLQKHYE   63 (106)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            567899999999998887777777643


No 49 
>PF11221 Med21:  Subunit 21 of Mediator complex;  InterPro: IPR021384 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.  The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11.  The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.   The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22.  The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4.  The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16.  The CDK8 module contains: MED12, MED13, CCNC and CDK8.   Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP.  Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator []. ; PDB: 1YKE_B 1YKH_B.
Probab=34.95  E-value=68  Score=27.32  Aligned_cols=8  Identities=13%  Similarity=0.621  Sum_probs=5.9

Q ss_pred             hhhhhhhh
Q psy17484        246 MVKKSRKQ  253 (283)
Q Consensus       246 MIKKARKv  253 (283)
                      +|.|||.|
T Consensus        78 Ii~kakqI   85 (144)
T PF11221_consen   78 IIRKAKQI   85 (144)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            67777777


No 50 
>COG3132 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.62  E-value=35  Score=31.73  Aligned_cols=17  Identities=29%  Similarity=0.216  Sum_probs=10.8

Q ss_pred             hhHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLS  270 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr  270 (283)
                      =+||+||||+||.-|..
T Consensus       194 v~aLe~eva~L~~rld~  210 (215)
T COG3132         194 VEALEQEVAELRARLDS  210 (215)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            35677777777665544


No 51 
>KOG3156|consensus
Probab=34.40  E-value=60  Score=30.57  Aligned_cols=25  Identities=32%  Similarity=0.392  Sum_probs=20.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      +++.|+|.+.||+|+.++||=|.|-
T Consensus       111 ~S~e~sEF~~lr~e~EklkndlEk~  135 (220)
T KOG3156|consen  111 VSIERSEFANLRAENEKLKNDLEKL  135 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            8888888888888888888877653


No 52 
>KOG4010|consensus
Probab=33.73  E-value=44  Score=31.12  Aligned_cols=25  Identities=28%  Similarity=0.457  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        256 GLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      -||+|++.+-.|+..+|.+|+--|.
T Consensus        48 elr~EL~kvEeEI~TLrqVLaAKer   72 (208)
T KOG4010|consen   48 ELRTELAKVEEEIVTLRQVLAAKER   72 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            7999999999999999999986553


No 53 
>PF14197 Cep57_CLD_2:  Centrosome localisation domain of PPC89 
Probab=33.52  E-value=47  Score=25.58  Aligned_cols=26  Identities=27%  Similarity=0.124  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        256 GLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      +|.+||+.||..|.++-..+++|+..
T Consensus         2 ~Lea~~~~Lr~rLd~~~rk~~~~~~~   27 (69)
T PF14197_consen    2 KLEAEIATLRNRLDSLTRKNSVHEIE   27 (69)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            68899999999999999999998864


No 54 
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.44  E-value=71  Score=25.62  Aligned_cols=28  Identities=36%  Similarity=0.487  Sum_probs=20.4

Q ss_pred             hhHHHHHHHHHHHH----HHHHHHHHhhhhcc
Q psy17484        254 NMGLRQEMERLKKE----NLSLRDKLSKFTDL  281 (283)
Q Consensus       254 NaaLRqEVa~LRKE----lgr~rniLsKYE~~  281 (283)
                      +-||++|-..|++|    -.|+|..|.|.+.|
T Consensus        48 reaL~~eneqlk~e~~~WQerlrsLLGkme~V   79 (79)
T COG3074          48 REALERENEQLKEEQNGWQERLRALLGKMEEV   79 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhhccC
Confidence            56677777777777    35788888888765


No 55 
>PRK14872 rod shape-determining protein MreC; Provisional
Probab=33.12  E-value=47  Score=32.79  Aligned_cols=21  Identities=19%  Similarity=0.259  Sum_probs=15.3

Q ss_pred             hhhhHHHHHHHHHHHHHHHHH
Q psy17484        252 KQNMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       252 KvNaaLRqEVa~LRKElgr~r  272 (283)
                      +.|..||+|+++|+.++.++.
T Consensus        64 ~EN~~Lk~Ena~L~~~l~~~e   84 (337)
T PRK14872         64 TENFLLKERIALLEERLKSYE   84 (337)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            338888888888866666544


No 56 
>PF06005 DUF904:  Protein of unknown function (DUF904);  InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA.; GO: 0000917 barrier septum formation, 0043093 cytokinesis by binary fission, 0005737 cytoplasm; PDB: 2JEE_A.
Probab=33.09  E-value=69  Score=24.90  Aligned_cols=14  Identities=36%  Similarity=0.278  Sum_probs=9.3

Q ss_pred             hhHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKE  267 (283)
Q Consensus       254 NaaLRqEVa~LRKE  267 (283)
                      .++|+.||++||.+
T Consensus        20 i~~Lq~e~eeLke~   33 (72)
T PF06005_consen   20 IALLQMENEELKEK   33 (72)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            56667777777664


No 57 
>PF15483 DUF4641:  Domain of unknown function (DUF4641)
Probab=33.04  E-value=61  Score=33.29  Aligned_cols=65  Identities=25%  Similarity=0.324  Sum_probs=44.6

Q ss_pred             CCCCccccCCCCCCCCCCCCCCCCccccCCcchhhhhhhh----------hhHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17484        214 SPADSTLSFTSSTRDFDPRSRTFSDEELKPQPMVKKSRKQ----------NMGLRQEMERLKKENLSLRDKLSKFT  279 (283)
Q Consensus       214 DPaDLaLSSvPG~E~FDPRkhkFSEEELKPQPMIKKARKv----------NaaLRqEVa~LRKElgr~rniLsKYE  279 (283)
                      +|...-.++.. |.--=||.+.+|=|.=-|-.-..-.|..          =.-|-.||.|||++|+.++....||+
T Consensus       371 vpgnsq~~alS-qg~~~pR~papSgDQeppv~pprperqQ~ppG~qGCpRC~~LQkEIedLreQLaamqsl~~kfq  445 (445)
T PF15483_consen  371 VPGNSQPSALS-QGGVMPRGPAPSGDQEPPVHPPRPERQQQPPGAQGCPRCLVLQKEIEDLREQLAAMQSLADKFQ  445 (445)
T ss_pred             CCCCCcccccc-cccccCCCCCCCcccCCCCCCCCcccccCCCCCCCCcccHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            55555555543 2234599999997643332222223543          77899999999999999999999985


No 58 
>PF14182 YgaB:  YgaB-like protein
Probab=32.21  E-value=61  Score=26.18  Aligned_cols=23  Identities=17%  Similarity=0.325  Sum_probs=19.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLs  276 (283)
                      =.++|+|++.+|++|..+.++..
T Consensus        42 l~~i~~EI~~mkk~Lk~Iq~~Fe   64 (79)
T PF14182_consen   42 LHSIQEEISQMKKELKEIQRVFE   64 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45789999999999999887743


No 59 
>PRK11239 hypothetical protein; Provisional
Probab=31.79  E-value=53  Score=30.78  Aligned_cols=22  Identities=32%  Similarity=0.226  Sum_probs=19.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRDKL  275 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniL  275 (283)
                      -++|++|||+||..+.++++-+
T Consensus       192 v~~Le~eva~L~~~l~~l~~~~  213 (215)
T PRK11239        192 VEALEIEVAELKQRLDSLLAHL  213 (215)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999988754


No 60 
>cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MerR2 and related proteins. MerR2 in Bacillus cereus RC607 regulates resistance to organomercurials. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=30.76  E-value=56  Score=26.42  Aligned_cols=22  Identities=14%  Similarity=0.345  Sum_probs=18.5

Q ss_pred             CCCCCCccccCCcchhhhhhhh
Q psy17484        232 RSRTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       232 RkhkFSEEELKPQPMIKKARKv  253 (283)
                      .-|.|+++++.---+|+..|+.
T Consensus        34 ~yR~Y~~~d~~~l~~I~~lr~~   55 (116)
T cd04769          34 NYRVYDAQHVECLRFIKEARQL   55 (116)
T ss_pred             CceeeCHHHHHHHHHHHHHHHc
Confidence            4567899999998999999877


No 61 
>PF04977 DivIC:  Septum formation initiator;  InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation []. These proteins are mainly composed of an N-terminal coiled-coil. DivIB, DivIC and FtsL inter-depend on each other for stabilisation and localisation. The latter two form a heterodimer. DivIC is always centre cell but the other two associate with it during septation [].; GO: 0007049 cell cycle
Probab=30.73  E-value=75  Score=23.20  Aligned_cols=21  Identities=43%  Similarity=0.716  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHh
Q psy17484        256 GLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLs  276 (283)
                      .|+.+++++++|+..++..+.
T Consensus        28 ~l~~~i~~l~~e~~~L~~ei~   48 (80)
T PF04977_consen   28 ELQKEIEELKKENEELKEEIE   48 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            334444444444444443333


No 62 
>cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=30.18  E-value=54  Score=26.28  Aligned_cols=20  Identities=30%  Similarity=0.481  Sum_probs=15.1

Q ss_pred             CCCCccccCCcchhhhhhhh
Q psy17484        234 RTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       234 hkFSEEELKPQPMIKKARKv  253 (283)
                      |.|+++++.---+|+..|+.
T Consensus        37 R~Y~~~~l~~l~~I~~lr~~   56 (113)
T cd01109          37 RDFTEEDLEWLEFIKCLRNT   56 (113)
T ss_pred             ccCCHHHHHHHHHHHHHHHc
Confidence            45688888877888887766


No 63 
>PF04977 DivIC:  Septum formation initiator;  InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation []. These proteins are mainly composed of an N-terminal coiled-coil. DivIB, DivIC and FtsL inter-depend on each other for stabilisation and localisation. The latter two form a heterodimer. DivIC is always centre cell but the other two associate with it during septation [].; GO: 0007049 cell cycle
Probab=29.53  E-value=1.1e+02  Score=22.33  Aligned_cols=18  Identities=39%  Similarity=0.339  Sum_probs=13.0

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSL  271 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~  271 (283)
                      ++.|++|..+|++|+.++
T Consensus        33 i~~l~~e~~~L~~ei~~l   50 (80)
T PF04977_consen   33 IEELKKENEELKEEIERL   50 (80)
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            677777777777777766


No 64 
>PF05465 Halo_GVPC:  Halobacterial gas vesicle protein C (GVPC) repeat;  InterPro: IPR008639 This family consists of Halobacterium gas vesicle protein C sequences which are thought to confer stability to the gas vesicle membranes [,].; GO: 0031412 gas vesicle organization, 0031411 gas vesicle
Probab=29.53  E-value=89  Score=20.92  Aligned_cols=25  Identities=16%  Similarity=0.324  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        256 GLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      .|+.+++++|.|....+....-|..
T Consensus         3 ~l~a~I~~~r~~f~~~~~aF~aY~~   27 (32)
T PF05465_consen    3 DLLAAIAEFREEFDDTQDAFEAYAD   27 (32)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5788888888888888887777764


No 65 
>PF07106 TBPIP:  Tat binding protein 1(TBP-1)-interacting protein (TBPIP);  InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation [].
Probab=29.29  E-value=80  Score=27.05  Aligned_cols=26  Identities=42%  Similarity=0.585  Sum_probs=17.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFT  279 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE  279 (283)
                      |.-|+.++++|++|+..+...|..+.
T Consensus       111 ~~el~~~i~~l~~e~~~l~~kL~~l~  136 (169)
T PF07106_consen  111 NEELREEIEELEEEIEELEEKLEKLR  136 (169)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            66666677777777766666666554


No 66 
>PF10186 Atg14:  UV radiation resistance protein and autophagy-related subunit 14;  InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking. In yeast, two distinct PI3-kinase complexes are known: complex I (Vps34, Vps15, Vps30/Atg6, and Atg14) is involved in autophagy, and complex II (Vps34, Vps15, Vps30/Atg6, and Vps38) functions in the vacuolar protein sorting pathway. In mammals, the counterparts of Vps34, Vps15, and Vps30/Atg6 are Vps34, p150, and Beclin 1, respectively. Mammalian UV irradiation resistance-associated gene (UVRAG) has been identified as identical to yeast Vps38 [].  The Atg14 (autophagy-related protein 14) proteins are hydrophilic proteins and have a coiled-coil motif at the N terminus region. Yeast cells with mutant Atg14 are defective not only in autophagy but also in sorting of carboxypeptidase Y (CPY), a vacuolar-soluble hydrolase, to the vacuole []. This entry represents Atg14 and UVRAG, which bind Beclin 1 to forms two distinct PI3-kinase complexes. This entry also includes Bakor (beclin-1-associated autophagy-related key regulator), also known as autophagy-related protein 14-like protein, which share sequence similarity to the yeast Atg14 protein []. Barkor positively regulates autophagy through its interaction with Beclin-1, with decreased levels of autophagosome formation observed when Barkor expression is eliminated []. Autophagy mediates the cellular response to nutrient deprivation, protein aggregation, and pathogen invasion in humans, and malfunction of autophagy has been implicated in multiple human diseases including cancer. ; GO: 0010508 positive regulation of autophagy
Probab=29.11  E-value=76  Score=28.44  Aligned_cols=24  Identities=33%  Similarity=0.472  Sum_probs=12.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSK  277 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsK  277 (283)
                      +..||+++.++|+++...|+.|.+
T Consensus        72 ~~~l~~~i~~~~~~i~~~r~~l~~   95 (302)
T PF10186_consen   72 LERLRERIERLRKRIEQKRERLEE   95 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            555555555555555555554443


No 67 
>KOG1319|consensus
Probab=29.04  E-value=43  Score=31.32  Aligned_cols=24  Identities=17%  Similarity=0.364  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        259 QEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       259 qEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      .||+.||||...+|=|-+.||..+
T Consensus       126 ~e~s~L~k~vtAL~iIk~~YEqM~  149 (229)
T KOG1319|consen  126 EEVSTLRKDVTALKIIKVNYEQMV  149 (229)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            478889999999999999999865


No 68 
>PRK00306 50S ribosomal protein L29; Reviewed
Probab=28.80  E-value=77  Score=23.75  Aligned_cols=19  Identities=37%  Similarity=0.443  Sum_probs=13.0

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~r  272 (283)
                      ..-|..++.+||+||-.+|
T Consensus        11 ~~eL~~~l~~lkkeL~~lR   29 (66)
T PRK00306         11 VEELNEKLLELKKELFNLR   29 (66)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            5566777777777776666


No 69 
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators. Putative helix-turn-helix (HTH) MerR-like transcription regulator; conserved, Cfa-like, unknown proteins (~172 a.a.). The N-terminal domain of these proteins appears to be related to the HTH domain of Cfa, a cyclopropane fatty acid synthase. These Cfa-like proteins have a unique C-terminal domain with conserved histidines (motif HXXFX7HXXF). Based on sequence similarity of the N-terminal domains, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domain
Probab=28.77  E-value=46  Score=29.09  Aligned_cols=48  Identities=21%  Similarity=0.331  Sum_probs=36.4

Q ss_pred             CCCCccccCCcchhhhhhhh------------------hhHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        234 RTFSDEELKPQPMVKKSRKQ------------------NMGLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       234 hkFSEEELKPQPMIKKARKv------------------NaaLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      |.|++++|.--=+|+..|..                  ...|++.+++|++|+.+++.+....+.+
T Consensus        38 R~Y~~~dl~rL~~I~~lr~~G~sL~eI~~ll~~~~~~~~~~L~~~~~~l~~ei~~L~~~~~~l~~l  103 (172)
T cd04790          38 RLYGERDLERLEQICAYRSAGVSLEDIRSLLQQPGDDATDVLRRRLAELNREIQRLRQQQRAIATL  103 (172)
T ss_pred             ccCCHHHHHHHHHHHHHHHcCCCHHHHHHHHhcCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            55699999888889888876                  3468888888888888777776655443


No 70 
>PF10392 COG5:  Golgi transport complex subunit 5;  InterPro: IPR019465  The conserved oligomeric Golgi (COG) complex is a peripheral membrane complex involved in intra-Golgi protein trafficking. Subunit 5 is located in the smaller, B lobe, together with subunits 6-8, and has been shown to bind subunits 1 and 7 [].
Probab=28.75  E-value=88  Score=26.08  Aligned_cols=34  Identities=15%  Similarity=0.291  Sum_probs=26.1

Q ss_pred             hhhhhhhhHHHHHHHHHHHHHHHHH-HHHhhhhcc
Q psy17484        248 KKSRKQNMGLRQEMERLKKENLSLR-DKLSKFTDL  281 (283)
Q Consensus       248 KKARKvNaaLRqEVa~LRKElgr~r-niLsKYE~~  281 (283)
                      +.+..+..++|.-|..|..-..|+| .|+..|+.+
T Consensus        68 ~~~~~~l~~v~~~v~~L~~s~~RL~~eV~~Py~~~  102 (132)
T PF10392_consen   68 EELESVLQAVRSSVESLQSSYERLRSEVIEPYEKI  102 (132)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHH
Confidence            4444558888999999999999988 577778764


No 71 
>PRK14872 rod shape-determining protein MreC; Provisional
Probab=28.58  E-value=54  Score=32.37  Aligned_cols=27  Identities=22%  Similarity=0.278  Sum_probs=20.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      ..|++|-.+||+|+.++++.+.+|+.+
T Consensus        60 ~~L~~EN~~Lk~Ena~L~~~l~~~e~l   86 (337)
T PRK14872         60 LVLETENFLLKERIALLEERLKSYEEA   86 (337)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            457888888888888888888777743


No 72 
>PF02403 Seryl_tRNA_N:  Seryl-tRNA synthetase N-terminal domain;  InterPro: IPR015866 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This entry represents the N-terminal domain of Seryl-tRNA synthetase, which consists of two helices in a long alpha-hairpin. Seryl-tRNA synthetase (6.1.1.11 from EC) exists as monomer and belongs to class IIa [].; GO: 0000166 nucleotide binding, 0004828 serine-tRNA ligase activity, 0005524 ATP binding, 0006434 seryl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 3QO8_A 3QO5_A 3QO7_A 3QNE_A 3LSQ_A 3LSS_A 2DQ3_B 1SET_A 1SER_A 1SRY_B ....
Probab=28.49  E-value=76  Score=25.08  Aligned_cols=28  Identities=25%  Similarity=0.397  Sum_probs=21.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      -..|+.|+.+|++++..+...+..++..
T Consensus        69 ~~~l~~e~~~lk~~i~~le~~~~~~e~~   96 (108)
T PF02403_consen   69 AEELKAEVKELKEEIKELEEQLKELEEE   96 (108)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4578888888888888888877776643


No 73 
>COG2433 Uncharacterized conserved protein [Function unknown]
Probab=27.91  E-value=79  Score=33.94  Aligned_cols=26  Identities=38%  Similarity=0.616  Sum_probs=22.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFT  279 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE  279 (283)
                      |..|+.|+.+|++|+..|++.|+.+.
T Consensus       438 ~~~L~~~~ee~k~eie~L~~~l~~~~  463 (652)
T COG2433         438 NSELKRELEELKREIEKLESELERFR  463 (652)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999998888887653


No 74 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=27.36  E-value=85  Score=25.71  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=12.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rn  273 (283)
                      |+.|++|.++|+.|+.++++
T Consensus        43 ~~~l~~~n~~L~~eI~~L~~   62 (105)
T PRK00888         43 NAKLKARNDQLFAEIDDLKG   62 (105)
T ss_pred             HHHHHHHHHHHHHHHHHhhC
Confidence            55666666666666665554


No 75 
>TIGR00012 L29 ribosomal protein L29. called L29 in prokaryotic (50S) large subunits and L35 in eukaryotic (60S) large subunits.
Probab=27.14  E-value=66  Score=23.39  Aligned_cols=19  Identities=37%  Similarity=0.560  Sum_probs=14.7

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~r  272 (283)
                      +.-|..+++++|+||-.+|
T Consensus         7 ~~EL~~~l~~lr~eLf~Lr   25 (55)
T TIGR00012         7 KEELAKKLDELKKELFELR   25 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4557788888888888777


No 76 
>PRK14549 50S ribosomal protein L29P; Provisional
Probab=27.11  E-value=85  Score=24.02  Aligned_cols=19  Identities=32%  Similarity=0.281  Sum_probs=11.7

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~r  272 (283)
                      ..-|..++.+||+||-.+|
T Consensus        14 ~~eL~~~l~elk~eLf~LR   32 (69)
T PRK14549         14 PEEREEKLEELKLELLKER   32 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4556666666666666555


No 77 
>PF13863 DUF4200:  Domain of unknown function (DUF4200)
Probab=27.05  E-value=99  Score=24.82  Aligned_cols=27  Identities=26%  Similarity=0.398  Sum_probs=13.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      ..-.-.|+..|+.+++.++..+++++.
T Consensus        76 ~~~k~~ei~~l~~~l~~l~~~~~k~e~  102 (126)
T PF13863_consen   76 KEEKEAEIKKLKAELEELKSEISKLEE  102 (126)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334444555555555555555554443


No 78 
>PF07106 TBPIP:  Tat binding protein 1(TBP-1)-interacting protein (TBPIP);  InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation [].
Probab=27.02  E-value=83  Score=26.96  Aligned_cols=26  Identities=31%  Similarity=0.425  Sum_probs=11.2

Q ss_pred             hhhhhhhhhHHHHHHHHHHHHHHHHH
Q psy17484        247 VKKSRKQNMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       247 IKKARKvNaaLRqEVa~LRKElgr~r  272 (283)
                      |+.-+...+.|++|+..|+.||..++
T Consensus        81 i~~L~~el~~l~~~~k~l~~eL~~L~  106 (169)
T PF07106_consen   81 IKELREELAELKKEVKSLEAELASLS  106 (169)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            33333334444444444444444433


No 79 
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=27.02  E-value=36  Score=22.81  Aligned_cols=15  Identities=47%  Similarity=0.860  Sum_probs=13.0

Q ss_pred             cchhhHHhhCCCCCC
Q psy17484        129 VDLDEFLSDNGIPVD  143 (283)
Q Consensus       129 MDLdEFL~ENGIp~s  143 (283)
                      =||.+||.++||+.+
T Consensus         7 ~~L~~wL~~~gi~~~   21 (38)
T PF10281_consen    7 SDLKSWLKSHGIPVP   21 (38)
T ss_pred             HHHHHHHHHcCCCCC
Confidence            379999999999964


No 80 
>PRK09413 IS2 repressor TnpA; Reviewed
Probab=26.92  E-value=65  Score=26.29  Aligned_cols=30  Identities=17%  Similarity=0.055  Sum_probs=20.4

Q ss_pred             hhhhhhhhhHHHHHHHHHHHH--HHHHHHHHh
Q psy17484        247 VKKSRKQNMGLRQEMERLKKE--NLSLRDKLS  276 (283)
Q Consensus       247 IKKARKvNaaLRqEVa~LRKE--lgr~rniLs  276 (283)
                      |++-+|.+.-|+.|++=|+|-  +.++|+.+.
T Consensus        80 i~~L~~el~~L~~E~diLKKa~~~~~~~~~~~  111 (121)
T PRK09413         80 IKELQRLLGKKTMENELLKEAVEYGRAKKWIA  111 (121)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhchhhhhh
Confidence            677777777777787777775  355665543


No 81 
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators. Putative helix-turn-helix (HTH) MerR-like transcription regulators; the HTH domain of Cfa, a cyclopropane fatty acid synthase, and other related methyltransferases, as well as, the N-terminal domain of a conserved, uncharacterized ~172 a.a. protein. Based on sequence similarity of the N-terminal domain, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimil
Probab=26.84  E-value=51  Score=26.17  Aligned_cols=50  Identities=18%  Similarity=0.268  Sum_probs=37.5

Q ss_pred             CCCCCccccCCcchhhhhhhh----------------hhHHHHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        233 SRTFSDEELKPQPMVKKSRKQ----------------NMGLRQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       233 khkFSEEELKPQPMIKKARKv----------------NaaLRqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      .|.|+++++.---+|+..|+.                ...|.+-.++|++++.+++..+..-+.+|
T Consensus        36 ~R~Y~~~dl~~l~~I~~l~~~G~~l~ei~~~~~~~~~~~~l~~~~~~l~~~i~~l~~~~~~l~~~l  101 (102)
T cd04775          36 YRLYSEADLSRLEKIVFLQAGGLPLEEIAGCLAQPHVQAILEERLQSLNREIQRLRQQQQVLAAIL  101 (102)
T ss_pred             CeeeCHHHHHHHHHHHHHHHCCCCHHHHHHHHcCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            355799999888888888766                56677777888888888877777666554


No 82 
>PRK00461 rpmC 50S ribosomal protein L29; Reviewed
Probab=26.81  E-value=82  Score=25.47  Aligned_cols=19  Identities=32%  Similarity=0.300  Sum_probs=13.9

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~r  272 (283)
                      ..-|..++.+||+||..+|
T Consensus        10 ~eEL~e~L~elkkELf~LR   28 (87)
T PRK00461         10 VEELEKLVIELKAELFTLR   28 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            5667777777777777776


No 83 
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO.
Probab=26.76  E-value=1e+02  Score=27.74  Aligned_cols=23  Identities=43%  Similarity=0.526  Sum_probs=11.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLs  276 (283)
                      |+.|++++..|.+|+.++...++
T Consensus       113 ~~~l~~~~e~Le~e~~~L~~~~~  135 (161)
T TIGR02894       113 NESLQKRNEELEKELEKLRQRLS  135 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            44444455555555555544333


No 84 
>PF03980 Nnf1:  Nnf1 ;  InterPro: IPR007128 NNF1 is an essential yeast gene required for proper spindle orientation, nucleolar and nuclear envelope structure and mRNA export [].
Probab=26.37  E-value=46  Score=26.63  Aligned_cols=14  Identities=36%  Similarity=0.560  Sum_probs=10.7

Q ss_pred             hhHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKE  267 (283)
Q Consensus       254 NaaLRqEVa~LRKE  267 (283)
                      |.+|-++|+++|+|
T Consensus        96 N~~L~~~i~~~r~e  109 (109)
T PF03980_consen   96 NEALAEEIQEQRKE  109 (109)
T ss_pred             HHHHHHHHHHhhcC
Confidence            77788888777765


No 85 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=25.78  E-value=85  Score=25.69  Aligned_cols=25  Identities=20%  Similarity=0.206  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKY  278 (283)
                      -+++++|+++|++++.+++.-+.+.
T Consensus        36 ~~~~~~e~~~l~~~n~~L~~eI~~L   60 (105)
T PRK00888         36 VAAQQQTNAKLKARNDQLFAEIDDL   60 (105)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3455566666666666666655544


No 86 
>PF09350 DUF1992:  Domain of unknown function (DUF1992);  InterPro: IPR018961  This entry represents a family of proteins that may have a role in protein folding or as a chaperone. DnaJ is a member of the J-protein family, which are defined by the presence of a J domain that can regulate the activity of 70kDa heat-shock proteins []. Some of the proteins in this entry contain a J domain.
Probab=25.55  E-value=51  Score=25.33  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy17484        256 GLRQEMERLKKENLSL  271 (283)
Q Consensus       256 aLRqEVa~LRKElgr~  271 (283)
                      .||+|+.+||+.|.+|
T Consensus        56 ~l~kei~~l~~~l~~~   71 (71)
T PF09350_consen   56 ELRKEIEELREALAQC   71 (71)
T ss_pred             HHHHHHHHHHHHHHhC
Confidence            5677777777776665


No 87 
>PRK10093 primosomal replication protein N''; Provisional
Probab=25.41  E-value=67  Score=29.05  Aligned_cols=28  Identities=25%  Similarity=0.332  Sum_probs=24.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      ..|-+||+.+-.-|+|||.-|.|-|..+
T Consensus       139 q~lq~el~alegRL~RCrqAl~~IE~~I  166 (171)
T PRK10093        139 QTLHREVEAYEGRLARCRHALEKIENVL  166 (171)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4588999999999999999999988764


No 88 
>PF07445 priB_priC:  Primosomal replication protein priB and priC;  InterPro: IPR010890 This family contains the bacterial primosomal replication proteins priB and priC (approximately 180 residues long). In Escherichia coli, these function in the assembly of the primosome [].
Probab=25.38  E-value=68  Score=28.33  Aligned_cols=29  Identities=21%  Similarity=0.307  Sum_probs=24.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      -..|.+|++.+..-|+|||.-|++-|..|
T Consensus       140 ~~~lq~ei~a~e~RL~RCr~Ai~~iE~~I  168 (173)
T PF07445_consen  140 QQQLQQEILALEQRLQRCRQAIEKIEEQI  168 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34688899999999999999999887654


No 89 
>PF10384 Scm3:  Centromere protein Scm3;  InterPro: IPR018465 The centromere protein Scm3 is a non-histone component of centromeric chromatin that binds to CenH3-H4 histones, which are required for kinetochore assembly. Scm3 is required for Cse4 localisation and is required for its centromeric association [, ]. The histone H3 variant Cse4 replaces conventional histone H3 in centromeric chromatin and helps direct the assembly of the kinetochore. In addition, Scm3 has been shown in Saccharomyces cerevisiae (Baker's yeast) to be required for G2/M progression []. Scm3 is required to maintain kinetochore function throughout the cell cycle. Scm3 contains a nuclear export signal (NES). The N-terminal region of Scm3 is well conserved and functions as the CenH3-interacting domain, while the C-terminal region is variable in size and sometimes consists of DNA binding motifs [].; GO: 0005634 nucleus; PDB: 3R45_C 2YFV_C 2L5A_A.
Probab=25.29  E-value=87  Score=23.58  Aligned_cols=22  Identities=18%  Similarity=0.348  Sum_probs=16.2

Q ss_pred             HHHHHHHH-----HHHHHHHHhhhhcc
Q psy17484        260 EMERLKKE-----NLSLRDKLSKFTDL  281 (283)
Q Consensus       260 EVa~LRKE-----lgr~rniLsKYE~~  281 (283)
                      ||..+|++     ..+...|++||+..
T Consensus         2 ~l~~~~~~s~~r~k~~~e~I~~KY~~~   28 (58)
T PF10384_consen    2 ELMQLRKQSDQRFKSRWESIIEKYGQP   28 (58)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHCSG
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcCc
Confidence            56666666     56778899999873


No 90 
>PF09036 Bcr-Abl_Oligo:  Bcr-Abl oncoprotein oligomerisation domain;  InterPro: IPR015123 This entry represents the oligomerisation domain of the breakpoint cluster region oncoprotein Bcr, and the Bcr/Abl (Abelson-leukemia-virus) fusion protein created by a reciprocal (9;22) fusion []. Brc displays serine/threonine protein kinase activity (2.7.11.1 from EC), acting as a GTPase-activating protein for RAC1 and CDC42. Brc promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them []. The Bcr/Abl fusion protein loses some of the regulatory function of Bcr with regards to small Rho-like GTPases with negative consequences on cell motility, in particular on the capacity to adhere to endothelial cells []. The Bcr, Bcr/Abl oncoprotein oligomerisation domain consists of a short N-terminal helix (alpha-1), a flexible loop and a long C-terminal helix (alpha-2). Together these form an N-shaped structure, with the loop allowing the two helices to assume a parallel orientation. The monomeric domains associate into a dimer through the formation of an antiparallel coiled coil between the alpha-2 helices and domain swapping of two alpha-1 helices, where one alpha-1 helix swings back and packs against the alpha-2 helix from the second monomer. Two dimers then associate into a tetramer. The oligomerisation domain is essential for the oncogenicity of the Bcr-Abl protein []. ; GO: 0004674 protein serine/threonine kinase activity, 0005096 GTPase activator activity, 0006468 protein phosphorylation, 0007165 signal transduction; PDB: 1K1F_C.
Probab=25.10  E-value=61  Score=26.13  Aligned_cols=27  Identities=15%  Similarity=0.299  Sum_probs=19.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhccc
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFTDLL  282 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE~~~  282 (283)
                      ++|| -|-+|-+||.+||.-|-+-|.++
T Consensus        23 m~l~-svgd~e~eLerCK~sirrLeqev   49 (79)
T PF09036_consen   23 MELR-SVGDIEQELERCKASIRRLEQEV   49 (79)
T ss_dssp             ---S-SHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHH-HhccHHHHHHHHHHHHHHHHHHH
Confidence            4566 47889999999999888877654


No 91 
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO.
Probab=24.95  E-value=93  Score=28.02  Aligned_cols=34  Identities=29%  Similarity=0.394  Sum_probs=22.1

Q ss_pred             hhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        247 VKKSRKQNMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       247 IKKARKvNaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      .+..++-|.+|+.|+++|++++-.+.+-+.+.+.
T Consensus        99 ~~~~~~e~~~l~~e~~~l~~~~e~Le~e~~~L~~  132 (161)
T TIGR02894        99 DQALQKENERLKNQNESLQKRNEELEKELEKLRQ  132 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344444777777777777777777776665543


No 92 
>KOG0313|consensus
Probab=24.19  E-value=38  Score=34.42  Aligned_cols=25  Identities=40%  Similarity=0.705  Sum_probs=20.7

Q ss_pred             CcccCCC----CCcccchhhHHhhCCCCC
Q psy17484        118 KTLPYDS----DLKYVDLDEFLSDNGIPV  142 (283)
Q Consensus       118 KTlPyDG----dLeYMDLdEFL~ENGIp~  142 (283)
                      |+.|||.    +|=-|-|+|||.|+||-.
T Consensus        53 K~~pFDFLi~gelLRtsL~e~l~~kgiSs   81 (423)
T KOG0313|consen   53 KPVPFDFLIKGELLRTSLDEHLEEKGISS   81 (423)
T ss_pred             CCCcceEEEcceeeeccHHHHHHHcCcCh
Confidence            6678883    466899999999999986


No 93 
>PF06698 DUF1192:  Protein of unknown function (DUF1192);  InterPro: IPR009579 This family consists of several short, hypothetical, bacterial proteins of around 60 residues in length. The function of this family is unknown.
Probab=24.07  E-value=1.1e+02  Score=23.29  Aligned_cols=22  Identities=18%  Similarity=0.111  Sum_probs=13.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHh
Q psy17484        255 MGLRQEMERLKKENLSLRDKLS  276 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLs  276 (283)
                      ++|+.|++.+|.++.+-++..+
T Consensus        31 a~L~aEI~R~~~~~~~K~a~r~   52 (59)
T PF06698_consen   31 ALLEAEIARLEAAIAKKSASRA   52 (59)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            5666677766666666555544


No 94 
>TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator. This model represents the cadmium(II) and/or lead(II) responsive transcriptional activator of the proteobacterial metal efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(6-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix.
Probab=23.97  E-value=69  Score=26.49  Aligned_cols=21  Identities=10%  Similarity=0.294  Sum_probs=17.3

Q ss_pred             CCCCCccccCCcchhhhhhhh
Q psy17484        233 SRTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       233 khkFSEEELKPQPMIKKARKv  253 (283)
                      .|.|++++|.--=+|+..|+.
T Consensus        36 yR~Y~~~~l~~l~~I~~lr~l   56 (127)
T TIGR02047        36 YRVYTVGHVERLAFIRNCRTL   56 (127)
T ss_pred             CCcCCHHHHHHHHHHHHHHHc
Confidence            456799999888899988876


No 95 
>PF06156 DUF972:  Protein of unknown function (DUF972);  InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication. SUBUNIT: Interacts with both DnaA and DnaN, acting as a bridge between these two proteins. SIMILARITY: Belongs to the YabA family.
Probab=23.94  E-value=77  Score=26.30  Aligned_cols=20  Identities=35%  Similarity=0.376  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rn  273 (283)
                      |++||-|.+.||+-|.....
T Consensus        38 N~~L~~EN~~Lr~~l~~~~~   57 (107)
T PF06156_consen   38 NARLRIENEHLRERLEELEQ   57 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHhc


No 96 
>PRK13169 DNA replication intiation control protein YabA; Reviewed
Probab=23.18  E-value=79  Score=26.56  Aligned_cols=18  Identities=33%  Similarity=0.451  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSL  271 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~  271 (283)
                      |++||-|...||+.|...
T Consensus        38 N~~L~iEN~~Lr~~l~~~   55 (110)
T PRK13169         38 NTALRLENDKLRERLEEL   55 (110)
T ss_pred             HHHHHHHHHHHHHHHHHh


No 97 
>PF08606 Prp19:  Prp19/Pso4-like;  InterPro: IPR013915  This region is found specifically in PRP19-like protein. The region represented by this protein covers the sequence implicated in self-interaction and a coiled-coiled motif []. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly []. 
Probab=23.06  E-value=90  Score=24.63  Aligned_cols=17  Identities=24%  Similarity=0.479  Sum_probs=13.7

Q ss_pred             hhHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLS  270 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr  270 (283)
                      |-.||+.+..+||||++
T Consensus        24 ~f~LRk~l~~~rqELs~   40 (70)
T PF08606_consen   24 NFTLRKQLDQTRQELSH   40 (70)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            66788888888888875


No 98 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=23.06  E-value=1.6e+02  Score=23.95  Aligned_cols=29  Identities=41%  Similarity=0.541  Sum_probs=20.4

Q ss_pred             hhhhhhhhhHHHHHHHHHHHHHHHHHHHH
Q psy17484        247 VKKSRKQNMGLRQEMERLKKENLSLRDKL  275 (283)
Q Consensus       247 IKKARKvNaaLRqEVa~LRKElgr~rniL  275 (283)
                      ++||+|-|+.|-.|-..|..|..-...-+
T Consensus        25 ~~ka~~~~~kL~~en~qlk~Ek~~~~~qv   53 (87)
T PF10883_consen   25 VKKAKKQNAKLQKENEQLKTEKAVAETQV   53 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            47888888888888888877755444333


No 99 
>PF12709 Kinetocho_Slk19:  Central kinetochore-associated;  InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore. Slk19 is a yeast member and it may play an important role in the timing of nuclear migration. It may also participate, directly or indirectly, in the maintenance of centromeric tensile strength during mitotic stagnation, for instance during activation of checkpoint controls, when cells need to preserve nuclear integrity until cell cycle progression can be resumed [].
Probab=22.98  E-value=1.3e+02  Score=24.66  Aligned_cols=19  Identities=42%  Similarity=0.450  Sum_probs=15.1

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~r  272 (283)
                      |.+|++||..||+++..-|
T Consensus        58 ~~~l~~E~e~L~~~l~~e~   76 (87)
T PF12709_consen   58 NKALKRENEQLKKKLDTER   76 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            8888888888888776554


No 100
>PF11382 DUF3186:  Protein of unknown function (DUF3186);  InterPro: IPR021522  This bacterial family of proteins has no known function. 
Probab=22.52  E-value=1e+02  Score=29.45  Aligned_cols=36  Identities=22%  Similarity=0.280  Sum_probs=20.1

Q ss_pred             chhhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhhhc
Q psy17484        245 PMVKKSRKQNMGLRQEMERLKKENLSLRDKLSKFTD  280 (283)
Q Consensus       245 PMIKKARKvNaaLRqEVa~LRKElgr~rniLsKYE~  280 (283)
                      +|+..-......||+|..+||.|+..+++.+..+..
T Consensus        32 ~l~~~l~~~~~~lr~e~~~l~~~~~~~~~~~~~~d~   67 (308)
T PF11382_consen   32 NLIDSLEDQFDSLREENDELRAELDALQAQLNAADQ   67 (308)
T ss_pred             hhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345444444455666666666666666665554443


No 101
>PF01486 K-box:  K-box region;  InterPro: IPR002487 MADS genes in plants encode key developmental regulators of vegetative and reproductive development. The majority of the plant MADS proteins share a stereotypical MIKC structure. It comprises (from N- to C-terminal) an N-terminal domain, which is, however, present only in a minority of proteins; a MADS domain (see PDOC00302 from PROSITEDOC, IPR002100 from INTERPRO), which is the major determinant of DNA-binding but which also performs dimerisation and accessory factor binding functions; a weakly conserved intervening (I) domain, which constitutes a key molecular determinant for the selective formation of DNA-binding dimers; a keratin-like (K-box) domain, which promotes protein dimerisation; and a C-terminal (C) domain, which is involved in transcriptional activation or in the formation of ternary or quaternary protein complexes. The 80-amino acid K-box domain was originally identified as a region with low but significant similarity to a region of keratin, which is part of the coiled-coil sequence constituting the central rod-shaped domain of keratin [, , ]. The K-box protein-protein interaction domain which mediates heterodimerization of MIKC-type MADS proteins contains several heptad repeats in which the first and the fourth positions are occupied by hydrophobic amino acids suggesting that the K-box domain forms three amphipathic alpha-helices referred to as K1, K2, and K3 [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=22.36  E-value=1e+02  Score=24.38  Aligned_cols=25  Identities=40%  Similarity=0.586  Sum_probs=20.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17484        255 MGLRQEMERLKKENLSLRDKLSKFT  279 (283)
Q Consensus       255 aaLRqEVa~LRKElgr~rniLsKYE  279 (283)
                      --++.|++.||+|+..++..+..+.
T Consensus        15 e~~~~e~~~L~~~~~~L~~~~R~~~   39 (100)
T PF01486_consen   15 EELQQEIAKLRKENESLQKELRHLM   39 (100)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhccc
Confidence            4578999999999999998877653


No 102
>TIGR02268 Myxococcus xanthus paralogous family TIGR02268. This family consists of at least 8 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. The function is unknown.
Probab=22.22  E-value=74  Score=31.00  Aligned_cols=28  Identities=18%  Similarity=0.277  Sum_probs=23.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        254 NMGLRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      .+++++|+.++|-|+.+|+.-+.+|++.
T Consensus       133 ~es~~~E~~~~r~~~~~~~~e~~~lr~~  160 (295)
T TIGR02268       133 AASYQQEVVELRARNQLLEEENARLRRQ  160 (295)
T ss_pred             cccchhHHHHHHHHHHHHHHHHHHhhhh
Confidence            7788888888888888888888887753


No 103
>KOG2216|consensus
Probab=22.12  E-value=1.2e+02  Score=29.93  Aligned_cols=25  Identities=44%  Similarity=0.425  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhcc
Q psy17484        257 LRQEMERLKKENLSLRDKLSKFTDL  281 (283)
Q Consensus       257 LRqEVa~LRKElgr~rniLsKYE~~  281 (283)
                      |--||.-+|||..+|...=+||+.+
T Consensus        88 l~yev~HlkkeI~~c~~fks~~~el  112 (303)
T KOG2216|consen   88 LLYEVQHLKKEIKRCLDFKSKYTEL  112 (303)
T ss_pred             HHHHHHHHHHHHHHHHHhhccCccc
Confidence            4468899999999999999988764


No 104
>cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=22.11  E-value=84  Score=25.76  Aligned_cols=22  Identities=9%  Similarity=0.347  Sum_probs=17.2

Q ss_pred             CCCCCCccccCCcchhhhhhhh
Q psy17484        232 RSRTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       232 RkhkFSEEELKPQPMIKKARKv  253 (283)
                      ..|-|++++|.---+|++.|..
T Consensus        33 gyR~Y~~~~l~~l~~I~~lr~~   54 (118)
T cd04776          33 QTRVYSRRDRARLKLILRGKRL   54 (118)
T ss_pred             CccccCHHHHHHHHHHHHHHHC
Confidence            3456788998888888888866


No 105
>cd00427 Ribosomal_L29_HIP Ribosomal L29 protein/HIP.  L29 is a protein of the large ribosomal Subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals.  L29 is located on the surface of the large ribosomal subunit, where it participates in forming a protein ring that surrounds the polypeptide exit channel, providing structural support for the ribosome.  L29 is involved in forming the translocon binding site, along with L19, L22, L23, L24, and L31e.  In addition, L29 and L23 form the interaction site for trigger factor (TF) on the ribosomal surface, adjacent to the exit tunnel.  L29 forms numerous interactions with L23 and with the 23S rRNA. In some eukaryotes, L29 is referred to as L35, which is distinct from L35 found in bacteria and some eukaryotes (primarily plastids and mitochondria).  The mammalian homolog, HIP, is found on the surface of many tissues and cell lines. It is believed to play a role in cell adhesion and modulat
Probab=21.98  E-value=95  Score=22.63  Aligned_cols=19  Identities=37%  Similarity=0.637  Sum_probs=14.3

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLR  272 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~r  272 (283)
                      ..-|..++.+||+|+-.+|
T Consensus         8 ~~eL~~~l~~l~~elf~Lr   26 (57)
T cd00427           8 DEELQEKLDELKKELFNLR   26 (57)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3567778888888887776


No 106
>PF07558 Shugoshin_N:  Shugoshin N-terminal coiled-coil region;  InterPro: IPR011516 This entry represents the N-terminal domain of Shugoshin (Sgo1) kinetochore-attachment proteins. Shugoshin has a conserved coiled-coil N-terminal domain and a highly conserved C-terminal basic region (IPR011515 from INTERPRO). Shugoshin is a crucial target of Bub1 kinase that plays a central role in chromosome cohesion during mitosis and meiosis divisions by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms [, ]. Shugoshin is thought to act by protecting Rec8 and Rad21 at the centromeres from separase degradation during anaphase I (during meiosis) so that sister chromatids remain tethered []. Shugoshin also acts as a spindle checkpoint component required for sensing tension between sister chromatids during mitosis, its degradation when they separate preventing cell cycle arrest and chromosome loss in anaphase, a time when sister chromatids are no longer under tension. Human shugoshin is diffusible and mediates kinetochore-driven formation of kinetochore-microtubules during bipolar spindle assembly []. Further, the primary role of shugoshin is to ensure bipolar attachment of kinetochores, and its role in protecting cohesion has co-developed to facilitate this process [].; GO: 0045132 meiotic chromosome segregation, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 3FGA_D.
Probab=21.94  E-value=46  Score=23.69  Aligned_cols=20  Identities=25%  Similarity=0.335  Sum_probs=3.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rn  273 (283)
                      |++|...|.+|.+|+.++++
T Consensus        16 Ns~l~~ki~~le~~~s~L~~   35 (46)
T PF07558_consen   16 NSALSIKIQELENEVSKLLN   35 (46)
T ss_dssp             --------------HHHHHH
T ss_pred             hHHHHhHHHHHHhHHHHHHH
Confidence            77777777666666666554


No 107
>PF09789 DUF2353:  Uncharacterized coiled-coil protein (DUF2353);  InterPro: IPR019179  Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function. 
Probab=21.92  E-value=1.1e+02  Score=30.26  Aligned_cols=36  Identities=33%  Similarity=0.504  Sum_probs=27.7

Q ss_pred             chhhhhhhhhhHHHHHHHHHHHHH-------HHHHHHHhhhhc
Q psy17484        245 PMVKKSRKQNMGLRQEMERLKKEN-------LSLRDKLSKFTD  280 (283)
Q Consensus       245 PMIKKARKvNaaLRqEVa~LRKEl-------gr~rniLsKYE~  280 (283)
                      .++..+|..|-.|..||.+||+.+       --+|..+++++.
T Consensus        72 ~lL~~sre~Nk~L~~Ev~~Lrqkl~E~qGD~KlLR~~la~~r~  114 (319)
T PF09789_consen   72 QLLSESREQNKKLKEEVEELRQKLNEAQGDIKLLREKLARQRV  114 (319)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHhhhh
Confidence            577888888888888888888875       337777877764


No 108
>PF10186 Atg14:  UV radiation resistance protein and autophagy-related subunit 14;  InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking. In yeast, two distinct PI3-kinase complexes are known: complex I (Vps34, Vps15, Vps30/Atg6, and Atg14) is involved in autophagy, and complex II (Vps34, Vps15, Vps30/Atg6, and Vps38) functions in the vacuolar protein sorting pathway. In mammals, the counterparts of Vps34, Vps15, and Vps30/Atg6 are Vps34, p150, and Beclin 1, respectively. Mammalian UV irradiation resistance-associated gene (UVRAG) has been identified as identical to yeast Vps38 [].  The Atg14 (autophagy-related protein 14) proteins are hydrophilic proteins and have a coiled-coil motif at the N terminus region. Yeast cells with mutant Atg14 are defective not only in autophagy but also in sorting of carboxypeptidase Y (CPY), a vacuolar-soluble hydrolase, to the vacuole []. This entry represents Atg14 and UVRAG, which bind Beclin 1 to forms two distinct PI3-kinase complexes. This entry also includes Bakor (beclin-1-associated autophagy-related key regulator), also known as autophagy-related protein 14-like protein, which share sequence similarity to the yeast Atg14 protein []. Barkor positively regulates autophagy through its interaction with Beclin-1, with decreased levels of autophagosome formation observed when Barkor expression is eliminated []. Autophagy mediates the cellular response to nutrient deprivation, protein aggregation, and pathogen invasion in humans, and malfunction of autophagy has been implicated in multiple human diseases including cancer. ; GO: 0010508 positive regulation of autophagy
Probab=21.43  E-value=1.3e+02  Score=26.91  Aligned_cols=31  Identities=26%  Similarity=0.291  Sum_probs=21.5

Q ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHHHHhhhh
Q psy17484        249 KSRKQNMGLRQEMERLKKENLSLRDKLSKFT  279 (283)
Q Consensus       249 KARKvNaaLRqEVa~LRKElgr~rniLsKYE  279 (283)
                      +.|+....+|++++++|++|...+..|+++.
T Consensus        81 ~~~~~i~~~r~~l~~~~~~l~~~~~~l~~~~  111 (302)
T PF10186_consen   81 RLRKRIEQKRERLEELRESLEQRRSRLSASQ  111 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344477778888888888888777776443


No 109
>PF01166 TSC22:  TSC-22/dip/bun family;  InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation. These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Proteins containing this signature include:   Vertebrate protein TSC-22 [], a transcriptional regulator which seems to act on C-type natriuretic peptide (CNP) promoter. Mammalian protein DIP (DSIP-immunoreactive peptide) [], a protein whose function is not yet known. Drosophila protein bunched [] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.  Caenorhabditis elegans hypothetical protein T18D3.7.  ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1DIP_B.
Probab=21.43  E-value=57  Score=25.03  Aligned_cols=23  Identities=30%  Similarity=0.498  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Q psy17484        256 GLRQEMERLKKENLSLRDKLSKF  278 (283)
Q Consensus       256 aLRqEVa~LRKElgr~rniLsKY  278 (283)
                      |.|.||.-||..+..+....+.+
T Consensus        11 AVrEEVevLK~~I~eL~~~n~~L   33 (59)
T PF01166_consen   11 AVREEVEVLKEQIAELEERNSQL   33 (59)
T ss_dssp             T-TTSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            44555555555555544444433


No 110
>cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators. Helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR): MerR1 (mercury), CueR (copper),  CadR (cadmium),  PbrR (lead), ZntR (zinc), and other related proteins. These transcription regulators mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=21.20  E-value=97  Score=24.97  Aligned_cols=21  Identities=10%  Similarity=0.371  Sum_probs=16.3

Q ss_pred             CCCCCccccCCcchhhhhhhh
Q psy17484        233 SRTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       233 khkFSEEELKPQPMIKKARKv  253 (283)
                      -|.|+++++.---+|+..|+.
T Consensus        36 yR~Y~~~~i~~l~~I~~lr~~   56 (123)
T cd04770          36 YRLYGEADLARLRFIRRAQAL   56 (123)
T ss_pred             CccCCHHHHHHHHHHHHHHHC
Confidence            456788888888888888766


No 111
>PF13591 MerR_2:  MerR HTH family regulatory protein
Probab=21.03  E-value=81  Score=24.46  Aligned_cols=34  Identities=35%  Similarity=0.571  Sum_probs=24.9

Q ss_pred             CCCCccccCCcchhhhhhhh---------h-------hHHHHHHHHHHHHHHHHHH
Q psy17484        234 RTFSDEELKPQPMVKKSRKQ---------N-------MGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       234 hkFSEEELKPQPMIKKARKv---------N-------aaLRqEVa~LRKElgr~rn  273 (283)
                      ..|+.++|      ..+||+         |       .-|-++|..||+|+.++||
T Consensus        35 ~~f~~~~l------~rl~~~~rL~~Dl~in~~gi~lil~LLd~i~~L~~el~~L~~   84 (84)
T PF13591_consen   35 WYFSEEDL------ARLRRIRRLHRDLGINLEGIALILDLLDRIEQLRRELRELRR   84 (84)
T ss_pred             eeECHHHH------HHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            34787765      566666         3       3478899999999988875


No 112
>cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators. Putative helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR), unknown subgroup. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules, such as, metal ions, drugs, and organic substrates. This subgroup lacks one of the c
Probab=20.61  E-value=96  Score=25.73  Aligned_cols=20  Identities=20%  Similarity=0.441  Sum_probs=15.4

Q ss_pred             CCCCccccCCcchhhhhhhh
Q psy17484        234 RTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       234 hkFSEEELKPQPMIKKARKv  253 (283)
                      |.|+++++.---+|+..|+.
T Consensus        37 R~Y~~~~~~~l~~I~~lr~~   56 (133)
T cd04787          37 RLYSEKDLSRLRFILSARQL   56 (133)
T ss_pred             eeCCHHHHHHHHHHHHHHHc
Confidence            45788888888888888776


No 113
>PF12644 DUF3782:  Protein of unknown function (DUF3782);  InterPro: IPR024271 This functionally uncharacterised family of proteins is found in bacteria and archaea. Proteins in this family are typically between 91 and 186 amino acids in length.
Probab=20.30  E-value=1.1e+02  Score=22.10  Aligned_cols=30  Identities=20%  Similarity=0.392  Sum_probs=20.8

Q ss_pred             hhhhHHHHHHHHHHH-HHHHHHHHHhhhhcc
Q psy17484        252 KQNMGLRQEMERLKK-ENLSLRDKLSKFTDL  281 (283)
Q Consensus       252 KvNaaLRqEVa~LRK-Elgr~rniLsKYE~~  281 (283)
                      +-+.++++++.++++ ....-..+|.+|...
T Consensus         8 ~~i~a~~e~l~~~~~~lt~e~~~~l~~~~~a   38 (64)
T PF12644_consen    8 DEIMATKEELEELEERLTKEDKKRLEEYIDA   38 (64)
T ss_pred             HHHHHHHHHHHHHHhhcCHHHHHHHHHHHHH
Confidence            347888888888877 555556666666554


No 114
>cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators. Helix-turn-helix (HTH) transcription regulators CueR and ActP, copper efflux regulators. In Bacillus subtilis, copper induced CueR regulates the copZA operon, preventing copper toxicity. In Rhizobium leguminosarum, ActP controls copper homeostasis; it detects cytoplasmic copper stress and activates transcription in response to increasing copper concentrations. These proteins are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have two conserved cysteines that define a monovalent copper ion binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements
Probab=20.16  E-value=82  Score=25.92  Aligned_cols=21  Identities=10%  Similarity=0.455  Sum_probs=17.2

Q ss_pred             CCCCCccccCCcchhhhhhhh
Q psy17484        233 SRTFSDEELKPQPMVKKSRKQ  253 (283)
Q Consensus       233 khkFSEEELKPQPMIKKARKv  253 (283)
                      .|.|+++++.---+|+..|+.
T Consensus        36 ~R~Y~~~~~~~l~~I~~lr~~   56 (127)
T cd01108          36 YRVYNQRDIEELRFIRRARDL   56 (127)
T ss_pred             ceecCHHHHHHHHHHHHHHHc
Confidence            456799999988899888866


No 115
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=20.15  E-value=46  Score=30.84  Aligned_cols=35  Identities=23%  Similarity=0.481  Sum_probs=27.6

Q ss_pred             CCCCCCccccCCcchhhhhhhh----hhHHHHHHHHHHHHHH
Q psy17484        232 RSRTFSDEELKPQPMVKKSRKQ----NMGLRQEMERLKKENL  269 (283)
Q Consensus       232 RkhkFSEEELKPQPMIKKARKv----NaaLRqEVa~LRKElg  269 (283)
                      ||+.|++|+++   -||+|=|+    +..|++=+++|++|+.
T Consensus       196 ~r~g~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (255)
T PRK12461        196 RRRGFSSRAIR---ALKRAYKIIYRSGLSVQQAVAELELQQF  234 (255)
T ss_pred             hhcCCCHHHHH---HHHHHHHHHHhcCCCHHHHHHHHHHhcc
Confidence            78889999998   78999887    5566666777777654


No 116
>PF04912 Dynamitin:  Dynamitin ;  InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []. It is also thought to modulate cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organisation during mitosis. Dynamitin is also involved in anchoring microtubules to centrosomes and may play a role in synapse formation during brain development []. ; GO: 0007017 microtubule-based process, 0005869 dynactin complex
Probab=20.09  E-value=91  Score=30.39  Aligned_cols=20  Identities=35%  Similarity=0.350  Sum_probs=17.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSLRD  273 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~rn  273 (283)
                      -+.||.||++|+.|+...++
T Consensus        96 l~RL~~Ev~EL~eEl~~~~~  115 (388)
T PF04912_consen   96 LQRLRREVEELKEELEKRKA  115 (388)
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            46799999999999998754


No 117
>PRK00708 sec-independent translocase; Provisional
Probab=20.07  E-value=1.2e+02  Score=28.29  Aligned_cols=26  Identities=23%  Similarity=0.415  Sum_probs=17.0

Q ss_pred             hhhhhhhh--------hhHHHH-HHHHHHHHHHHH
Q psy17484        246 MVKKSRKQ--------NMGLRQ-EMERLKKENLSL  271 (283)
Q Consensus       246 MIKKARKv--------NaaLRq-EVa~LRKElgr~  271 (283)
                      +|+++|++        +..||+ |+.++|+++...
T Consensus        35 ~v~k~R~~a~e~r~~~~e~~~~~eldd~~k~~~~~   69 (209)
T PRK00708         35 MTARMRKMAGEFRRQFDEALREAELDDVRQTISDA   69 (209)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHH
Confidence            56777776        566664 777777766443


No 118
>PF14389 Lzipper-MIP1:  Leucine-zipper of ternary complex factor MIP1
Probab=20.01  E-value=1.3e+02  Score=24.00  Aligned_cols=18  Identities=28%  Similarity=0.285  Sum_probs=15.0

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q psy17484        254 NMGLRQEMERLKKENLSL  271 (283)
Q Consensus       254 NaaLRqEVa~LRKElgr~  271 (283)
                      =.+|.|||++|++.|..=
T Consensus        10 r~~LeqeV~~Lq~~L~~E   27 (88)
T PF14389_consen   10 RSALEQEVAELQKQLQEE   27 (88)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            368999999999998753


Done!