BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1749
         (87 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1WD2|A Chain A, Solution Structure Of The C-Terminal Ring From A
          Ring-Ibr- Ring (Triad) Motif
          Length = 60

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 20 CPMCSVPIEKDEGCAQMLCK--RCKHVFCWYCLASLD 54
          CP C V IEKD GC  M+C+   CK  FCW CL   +
Sbjct: 9  CPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWE 45


>pdb|1YVK|A Chain A, Crystal Structure Of The Bacillis Subtilis
           Acetyltransferase In Complex With Coa, Northeast
           Structural Genomics Target Sr237.
 pdb|1YVK|B Chain B, Crystal Structure Of The Bacillis Subtilis
           Acetyltransferase In Complex With Coa, Northeast
           Structural Genomics Target Sr237.
 pdb|1YVK|C Chain C, Crystal Structure Of The Bacillis Subtilis
           Acetyltransferase In Complex With Coa, Northeast
           Structural Genomics Target Sr237.
 pdb|1YVK|D Chain D, Crystal Structure Of The Bacillis Subtilis
           Acetyltransferase In Complex With Coa, Northeast
           Structural Genomics Target Sr237
          Length = 163

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 46  CWYCLASLDDDFLLRHYDKGPCKNKL 71
           C + + ++D DF LRHYD+   +N +
Sbjct: 118 CGFRIQAIDHDFFLRHYDEDIFENGI 143


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.514 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,717,980
Number of Sequences: 62578
Number of extensions: 87417
Number of successful extensions: 243
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 236
Number of HSP's gapped (non-prelim): 14
length of query: 87
length of database: 14,973,337
effective HSP length: 55
effective length of query: 32
effective length of database: 11,531,547
effective search space: 369009504
effective search space used: 369009504
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)