RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17490
         (67 letters)



>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended
          (e) SDRs.  SDRs are Rossmann-fold NAD(P)H-binding
          proteins, many of which may function as fatty acyl CoA
          reductases (FAR), acting on medium and long chain fatty
          acids, and have been reported to be involved in diverse
          processes such as biosynthesis of insect pheromones,
          plant cuticular wax production, and mammalian wax
          biosynthesis. In Arabidopsis thaliana, proteins with
          this particular architecture have also been identified
          as the MALE STERILITY 2 (MS2) gene product, which is
          implicated in male gametogenesis. Mutations in MS2
          inhibit the synthesis of exine (sporopollenin),
          rendering plants unable to reduce pollen wall fatty
          acids to corresponding alcohols. This N-terminal domain
          shares the catalytic triad (but not the upstream Asn)
          and characteristic NADP-binding motif of the extended
          SDR family. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 320

 Score = 82.3 bits (204), Expect = 7e-21
 Identities = 28/50 (56%), Positives = 40/50 (80%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVKNMLNS 65
          +L+TG TGF+GK+L++KLLRS PDIG IY+++R K G S EER++ +L  
Sbjct: 3  VLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLRELLKD 52


>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein.  This family
          represents the C-terminal region of the male sterility
          protein in a number of arabidopsis and drosophila. A
          sequence-related jojoba acyl CoA reductase is also
          included.
          Length = 245

 Score = 62.2 bits (152), Expect = 9e-14
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 1/44 (2%)

Query: 18 VTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVKN 61
          +TG TGF+GK+L++KLLRS P++  IY +VR K G S  ER++ 
Sbjct: 1  LTGATGFLGKVLLEKLLRSTPEV-KIYCLVRAKDGESALERLRQ 43


>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2.
          Length = 605

 Score = 63.0 bits (153), Expect = 1e-13
 Identities = 25/61 (40%), Positives = 41/61 (67%)

Query: 1   MQEEQKVDDFYRDGQILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVK 60
           M +   + +F R    L+TG TGF+ K+LI+K+LR+ PD+G IY++++ K   +  ER+K
Sbjct: 107 MADGIGIAEFLRGKNFLITGATGFLAKVLIEKILRTNPDVGKIYLLIKAKDKEAAIERLK 166

Query: 61  N 61
           N
Sbjct: 167 N 167


>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase.
          Length = 491

 Score = 47.0 bits (112), Expect = 5e-08
 Identities = 20/59 (33%), Positives = 35/59 (59%)

Query: 3  EEQKVDDFYRDGQILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVKN 61
          EE     F  +  ILVTG TGF+ K+ ++K+LR  P++  +Y+++R     S  +R+ +
Sbjct: 1  EEGSCVQFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRASDAKSATQRLHD 59


>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1.  This family
          consists of an SDR module of multidomain proteins
          identified as putative polyketide sythases fatty acid
          synthases (FAS), and nonribosomal peptide synthases,
          among others. However, unlike the usual ketoreductase
          modules of FAS and polyketide synthase, these domains
          are related to the extended SDRs, and have canonical
          NAD(P)-binding motifs and an active site tetrad.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 290

 Score = 44.2 bits (105), Expect = 4e-07
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 15 QILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVKNMLNS 65
           +L+TG TGF+G  L+ +LL+   ++  IY +VR K   +  ER+ + L  
Sbjct: 1  TVLLTGATGFLGAYLLRELLKR-KNVSKIYCLVRAKDEEAALERLIDNLKE 50


>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional.
          Length = 657

 Score = 41.5 bits (98), Expect = 4e-06
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 17 LVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRD 49
           VTGGTGF+G+ L+ +LL    +   ++++VR 
Sbjct: 4  FVTGGTGFIGRRLVSRLLDRRRE-ATVHVLVRR 35


>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like,
          extended (e) SDRs.  This subgroup of extended SDR
          family domains have the characteristic active site
          tetrad and a well-conserved NAD(P)-binding motif. This
          subgroup is not well characterized, its members are
          annotated as having a variety of putative functions.
          One characterized member is Pseudomonas fluorescens
          MupV a protein  involved in the biosynthesis of
          Mupirocin, a polyketide-derived antibiotic. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 293

 Score = 41.2 bits (97), Expect = 6e-06
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERV 59
          + VTGGTGF+G+ L+ +LL    +   + ++VR +      ER+
Sbjct: 1  VFVTGGTGFLGRHLVKRLL---ENGFKVLVLVRSESLGEAHERI 41


>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain.  This
          model includes the terminal domain from the fungal
          alpha aminoadipate reductase enzyme (also known as
          aminoadipate semialdehyde dehydrogenase) which is
          involved in the biosynthesis of lysine , as well as the
          reductase-containing component of the myxochelin
          biosynthetic gene cluster, MxcG. The mechanism of
          reduction involves activation of the substrate by
          adenylation and transfer to a covalently-linked
          pantetheine cofactor as a thioester. This thioester is
          then reduced to give an aldehyde (thus releasing the
          product) and a regenerated pantetheine thiol. (In
          myxochelin biosynthesis this aldehyde is further
          reduced to an alcohol or converted to an amine by an
          aminotransferase.) This is a fundamentally different
          reaction than beta-ketoreductase domains of polyketide
          synthases which act at a carbonyl two carbons removed
          from the thioester and forms an alcohol as a product.
          This domain is invariably found at the C-terminus of
          the proteins which contain it (presumably because it
          results in the release of the product). The majority of
          hits to this model are non-ribosomal peptide
          synthetases in which this domain is similarly located
          proximal to a thiolation domain (pfam00550). In some
          cases this domain is found at the end of a polyketide
          synthetase enzyme, but is unlike ketoreductase domains
          which are found before the thiolase domains. Exceptions
          to this observed relationship with the thiolase domain
          include three proteins which consist of stand-alone
          reductase domains (GP|466833 from M. leprae, GP|435954
          from Anabaena and OMNI|NTL02SC1199 from Strep.
          coelicolor) and one protein (OMNI|NTL01NS2636 from
          Nostoc) which contains N-terminal homology with a small
          group of hypothetical proteins but no evidence of a
          thiolation domain next to the putative reductase
          domain. Below the noise cutoff to this model are
          proteins containing more distantly related
          ketoreductase and dehydratase/epimerase domains. It has
          been suggested that a NADP-binding motif can be found
          in the N-terminal portion of this domain that may form
          a Rossman-type fold.
          Length = 367

 Score = 39.3 bits (92), Expect = 2e-05
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 15 QILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVKNMLNS 65
           +L+TG TGF+G  L+++LLR       +  +VR        ER++  L S
Sbjct: 1  TVLLTGATGFLGAYLLEELLRRSTQAK-VICLVRAASEEHAMERLREALRS 50


>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs.  Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 200

 Score = 37.7 bits (88), Expect = 8e-05
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDI 40
          ILVTGG GF+G  L+ +LL    ++
Sbjct: 1  ILVTGGAGFIGSHLVRRLLERGHEV 25


>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup
          3, extended (e) SDRs.  Members of this bacterial
          subgroup are identified as possible sugar epimerases,
          such as UDP-glucose 4 epimerase. However, while the
          NAD(P)-binding motif is fairly well conserved, not all
          members retain the canonical active site tetrad of the
          extended SDRs. UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 306

 Score = 35.4 bits (82), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPE 56
          ILVTG  G +G+LL  +L  S P +  +  + R +   SP 
Sbjct: 1  ILVTGAAGGLGRLLARRLAAS-PRVIGVDGLDRRRPPGSPP 40


>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family.
           This family of proteins utilise NAD as a cofactor. The
          proteins in this family use nucleotide-sugar substrates
          for a variety of chemical reactions.
          Length = 233

 Score = 35.3 bits (82), Expect = 7e-04
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYI 45
          ILVTGGTGF+G  L+ +LL+   ++  +  
Sbjct: 1  ILVTGGTGFIGSHLVRRLLQEGYEVIVLGR 30


>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of
          multifunctional non-ribosomal peptide synthetases and
          related enzymes [Secondary metabolites biosynthesis,
          transport, and catabolism].
          Length = 382

 Score = 35.1 bits (81), Expect = 8e-04
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVR 48
          +L+TG TGF+G  L+ +LL        +  +VR
Sbjct: 3  VLLTGATGFLGAYLLLELLDRSD--AKVICLVR 33


>gnl|CDD|224015 COG1090, COG1090, Predicted nucleoside-diphosphate sugar
          epimerase [General function prediction only].
          Length = 297

 Score = 34.2 bits (79), Expect = 0.002
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSS 54
          IL+TGGTG +G+ L  +L +       + I+ R    +S
Sbjct: 1  ILITGGTGLIGRALTARLRKGGHQ---VTILTRRPPKAS 36


>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar
          epimerases [Cell envelope biogenesis, outer membrane /
          Carbohydrate transport and metabolism].
          Length = 275

 Score = 33.7 bits (77), Expect = 0.002
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKK 51
          ILVTG TGF+G  ++ +LL    +   +   VR+ +
Sbjct: 3  ILVTGATGFVGGAVVRELLARGHE---VRAAVRNPE 35


>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell
          envelope biogenesis, outer membrane / Carbohydrate
          transport and metabolism].
          Length = 314

 Score = 33.8 bits (77), Expect = 0.002
 Identities = 12/20 (60%), Positives = 16/20 (80%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          ILVTGG GF+G  L+++LL 
Sbjct: 3  ILVTGGAGFIGSHLVERLLA 22


>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like
          proteins, NMRa-like, atypical (a) SDRs.  TMR is an
          atypical NADP-binding protein of the SDR family. It
          lacks the active site residues of the SDRs but has a
          glycine rich NAD(P)-binding motif that matches the
          extended SDRs. Proteins in this subgroup however, are
          more similar in length to the classical SDRs. TMR was
          identified as a reducer of triphenylmethane dyes,
          important environmental pollutants. This subgroup also
          includes Escherichia coli NADPH-dependent quinine
          oxidoreductase (QOR2), which catalyzes two-electron
          reduction of quinone; but is unlikely to play a major
          role in protecting against quinone cytotoxicity.
          Atypical SDRs are distinct from classical SDRs.
          Atypical SDRs include biliverdin IX beta reductase
          (BVR-B,aka flavin reductase), NMRa (a negative
          transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 272

 Score = 33.4 bits (77), Expect = 0.003
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRD 49
          ILVTG TG +G  +++ LL     + A+   VR+
Sbjct: 1  ILVTGATGKLGTAVVELLLAKVASVVAL---VRN 31


>gnl|CDD|233570 TIGR01777, yfcH, TIGR01777 family protein.  This model represents
          a clade of proteins of unknown function including the
          E. coli yfcH protein [Hypothetical proteins,
          Conserved].
          Length = 291

 Score = 33.4 bits (77), Expect = 0.003
 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 5/54 (9%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPE--ERVKNMLNSVN 67
          IL+TGGTGF+G+ L  +L +   +   + I+ R     +    E  K       
Sbjct: 1  ILITGGTGFIGRALTQRLTKRGHE---VTILTRSPPPGANTKWEGYKPWAGEDA 51


>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          archaeal and bacterial proteins, and has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 33.0 bits (76), Expect = 0.004
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          ILVTGG GF+G  L+D+LL 
Sbjct: 2  ILVTGGAGFIGSHLVDRLLE 21


>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases
          (3b-HSD)-like, extended (e) SDRs.  Extended SDR family
          domains belonging to this subgroup have the
          characteristic active site tetrad and a fairly
          well-conserved NAD(P)-binding motif. 3b-HSD catalyzes
          the NAD-dependent conversion of various steroids, such
          as pregnenolone to progesterone, or androstenediol to
          testosterone. This subgroup includes an unusual
          bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis
          thaliana, and Saccharomyces cerevisiae ERG26, a
          3b-HSD/C-4 decarboxylase, involved in the synthesis of
          ergosterol, the major sterol of yeast. It also includes
          human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7].  C(27) 3beta-HSD/HSD3B7 is a membrane-bound
          enzyme of the endoplasmic reticulum, that catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human NSDHL (NAD(P)H
          steroid dehydrogenase-like protein) cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 331

 Score = 33.2 bits (76), Expect = 0.004
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERV 59
          +LVTGG+GF G+ L+ +LL    + G  Y+   D   + P E +
Sbjct: 2  VLVTGGSGFFGERLVKQLL----ERGGTYVRSFDI--APPGEAL 39


>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and
          related proteins, extended (e) SDRs.  UGD catalyzes the
          formation of UDP-xylose from UDP-glucuronate; it is an
          extended-SDR, and has the characteristic glycine-rich
          NAD-binding pattern, TGXXGXXG, and active site tetrad. 
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 305

 Score = 33.0 bits (76), Expect = 0.004
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          IL+TGG GF+G  L D+LL 
Sbjct: 3  ILITGGAGFLGSHLCDRLLE 22


>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase,
          extended (e) SDRs.  This subgroup contains
          UDP-N-acetylglucosamine 4-epimerase of Pseudomonas
          aeruginosa, WbpP,  an extended SDR, that catalyzes the
          NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to
          UDP-Glc and UDP-Gal.  This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 304

 Score = 31.8 bits (73), Expect = 0.011
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          +LVTGG GF+G  L+++LL 
Sbjct: 2  VLVTGGAGFIGSHLVERLLE 21


>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs.
          This subgroup contains FRs of the extended SDR-type and
          related proteins. These FRs act in the NADP-dependent
          reduction of  flavonoids, ketone-containing plant
          secondary metabolites; they have the characteristic
          active site triad of the SDRs (though not the upstream
          active site Asn) and a NADP-binding motif that is very
          similar to the typical extended SDR motif. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 293

 Score = 31.8 bits (73), Expect = 0.012
 Identities = 9/18 (50%), Positives = 14/18 (77%)

Query: 18 VTGGTGFMGKLLIDKLLR 35
          VTG +GF+G  L+ +LL+
Sbjct: 3  VTGASGFIGSWLVKRLLQ 20


>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid
          dehydrogenase) and HSD3B1(delta 5-delta
          4-isomerase)-like, extended (e) SDRs.  This
          extended-SDR subgroup includes human 3 beta-HSD/HSD3B1
          and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7], and related proteins. These proteins have the
          characteristic active site tetrad and NAD(P)-binding
          motif of extended SDRs. 3 beta-HSD catalyzes the
          oxidative conversion of delta 5-3 beta-hydroxysteroids
          to the delta 4-3-keto configuration; this activity is
          essential for the biosynthesis of all classes of
          hormonal steroids. C(27) 3beta-HSD is a membrane-bound
          enzyme of the endoplasmic reticulum, it catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 354

 Score = 31.7 bits (72), Expect = 0.012
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 17 LVTGGTGFMGKLLIDKLLRSFPDIGAI 43
          LVTGG GF+G+ +I  LL    ++  I
Sbjct: 3  LVTGGGGFLGQHIIRLLLERKEELKEI 29


>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains dTDP-D-glucose
          4,6-dehydratase and related proteins, members of the
          extended-SDR family, with the characteristic Rossmann
          fold core region, active site tetrad and NAD(P)-binding
          motif. dTDP-D-glucose 4,6-dehydratase is closely
          related to other sugar epimerases of the SDR family.
          dTDP-D-dlucose 4,6,-dehydratase catalyzes the second of
          four steps in the dTDP-L-rhamnose pathway (the
          dehydration of dTDP-D-glucose to
          dTDP-4-keto-6-deoxy-D-glucose) in the synthesis of
          L-rhamnose, a cell wall component of some pathogenic
          bacteria. In many gram negative bacteria, L-rhamnose is
          an important constituent of lipopoylsaccharide
          O-antigen. The larger N-terminal portion of
          dTDP-D-Glucose 4,6-dehydratase forms a Rossmann fold
          NAD-binding domain, while the C-terminus binds the
          sugar substrate. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 315

 Score = 31.8 bits (73), Expect = 0.013
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPD 39
          ILVTGG GF+G   +  LL  +PD
Sbjct: 3  ILVTGGAGFIGSNFVRYLLNKYPD 26


>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs.  Extended
          or atypical short-chain dehydrogenases/reductases
          (SDRs, aka tyrosine-dependent oxidoreductases) are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          Atypical SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Atypical
          SDRs include biliverdin IX beta reductase (BVR-B,aka
          flavin reductase), NMRa (a negative transcriptional
          regulator of various fungi), progesterone
          5-beta-reductase like proteins, phenylcoumaran benzylic
          ether and pinoresinol-lariciresinol reductases,
          phenylpropene synthases, eugenol synthase,
          triphenylmethane reductase, isoflavone reductases, and
          others. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 176

 Score = 31.2 bits (71), Expect = 0.015
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEER 58
          IL+ G TGF+G+ L  +LL    +   + ++VR+ K  S E++
Sbjct: 1  ILILGATGFIGRALARELLEQGHE---VTLLVRNTKRLSKEDQ 40


>gnl|CDD|187659 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of
           fatty acid synthase (FAS), subgroup 3, complex (x).
           Ketoreductase, a module of the multidomain polyketide
           synthase (PKS), has 2 subdomains, each corresponding  to
           a SDR family monomer. The C-terminal subdomain catalyzes
           the NADPH-dependent reduction of the beta-carbonyl of a
           polyketide to a hydroxyl group, a step in the
           biosynthesis of polyketides, such as erythromycin. The
           N-terminal subdomain, an interdomain linker, is a
           truncated Rossmann fold which acts to stabilizes the
           catalytic subdomain. Unlike typical SDRs, the isolated
           domain does not oligomerize but is composed of 2
           subdomains, each resembling an SDR monomer. The active
           site resembles that of typical SDRs, except that the
           usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. In some instances, such as
           porcine FAS, an enoyl reductase (ER) module is inserted
           between the sub-domains. Fatty acid synthesis occurs via
           the stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consists of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthesis
           uses a dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles, ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-KR, forming beta-hydroxyacyl-ACP, which is in turn
           dehydrated by dehydratase to a beta-enoyl intermediate,
           which is reduced by NADP-dependent beta- ER. Polyketide
           synthesis also proceeds via the addition of 2-carbon
           units as in fatty acid synthesis. The complex SDR
           NADP-binding motif, GGXGXXG, is often present, but is
           not strictly conserved in each instance of the module.
           This subfamily includes KR domains found in many
           multidomain PKSs, including six of seven Sorangium
           cellulosum PKSs (encoded by spiDEFGHIJ) which
           participate in the synthesis of the polyketide scaffold
           of the cytotoxic spiroketal polyketide spirangien. These
           seven PKSs have either a single PKS module (SpiF), two
           PKR modules (SpiD,-E,-I,-J), or three PKS modules
           (SpiG,-H). This subfamily includes the second KR domains
           of SpiE,-G, I, and -J, both KR domains of SpiD, and the
           third KR domain of SpiH. The single KR domain of SpiF,
           the first and second KR domains of SpiH, the first KR
           domains of SpiE,-G,- I, and -J, and the third KR domain
           of SpiG, belong to a different KR_FAS_SDR subfamily.
           SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 448

 Score = 31.5 bits (72), Expect = 0.018
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query: 13  DGQILVTGGTGFMGKLL 29
           DG +L+TGGTG +G LL
Sbjct: 193 DGTVLITGGTGTLGALL 209


>gnl|CDD|181609 PRK09009, PRK09009, C factor cell-cell signaling protein;
          Provisional.
          Length = 235

 Score = 31.2 bits (71), Expect = 0.019
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDI 40
          IL+ GG+G +GK ++ +LL  +PD 
Sbjct: 3  ILIVGGSGGIGKAMVKQLLERYPDA 27


>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde
          reductase and flavonoid reductase related proteins,
          extended (e) SDRs.  This subgroup contains proteins of
          unknown function related to aldehyde reductase and
          flavonoid reductase of the extended SDR-type. Aldehyde
          reductase I (aka carbonyl reductase) is an NADP-binding
          SDR; it has an NADP-binding motif consensus that is
          slightly different from the canonical SDR form and
          lacks the Asn of the extended SDR active site tetrad.
          Aldehyde reductase I catalyzes the NADP-dependent
          reduction of ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
          reductases act in the NADP-dependent reduction of
          flavonoids, ketone-containing plant secondary
          metabolites. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 318

 Score = 31.1 bits (71), Expect = 0.020
 Identities = 12/21 (57%), Positives = 14/21 (66%)

Query: 16 ILVTGGTGFMGKLLIDKLLRS 36
          ILVTG TGF+G  L+  LL  
Sbjct: 1  ILVTGATGFLGSNLVRALLAQ 21


>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          bacterial proteins, and includes the Staphylococcus
          aureus capsular polysaccharide Cap5N, which may have a
          role in the synthesis of UDP-N-acetyl-d-fucosamine.
          This subgroup has the characteristic active site tetrad
          and NAD-binding motif of the extended SDRs. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 303

 Score = 31.2 bits (71), Expect = 0.021
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 16 ILVTGGTGFMGKLLIDKLL 34
          +LVTG  GF+G+ L+DKLL
Sbjct: 2  VLVTGANGFIGRALVDKLL 20


>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked
          N-acetylglucosamine) inverting 4,6-dehydratase,
          extended (e) SDRs.  UDP-Glcnac inverting
          4,6-dehydratase was identified in Helicobacter pylori
          as the hexameric flaA1 gene product (FlaA1). FlaA1 is
          hexameric, possesses UDP-GlcNAc-inverting
          4,6-dehydratase activity,  and catalyzes the first step
          in the creation of a pseudaminic acid derivative in
          protein glycosylation. Although this subgroup has the
          NADP-binding motif characteristic of extended SDRs, its
          members tend to have a Met substituted for the active
          site Tyr found in most SDR families. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 287

 Score = 31.0 bits (71), Expect = 0.022
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 8/59 (13%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFP------DIG--AIYIMVRDKKGSSPEERVKNMLNSV 66
          ILVTGG G +G  L+ ++L+  P      D     ++ +VR+ +   P ++++ ++  V
Sbjct: 5  ILVTGGAGSIGSELVRQILKFGPKKLIVFDRDENKLHELVRELRSRFPHDKLRFIIGDV 63


>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase. 
            Members of this protein family are
            L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31),
            product of the LYS2 gene. It is also called
            alpha-aminoadipate reductase. In fungi, lysine is
            synthesized via aminoadipate. Currently, all members of
            this family are fungal.
          Length = 1389

 Score = 31.2 bits (71), Expect = 0.023
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 16   ILVTGGTGFMGKLLIDKLL-RSFPDIGAIYIMVRDKKGSSPEERVKN 61
            + +TG TGF+G  ++  LL R       ++  VR K   +  ER++ 
Sbjct: 974  VFLTGATGFLGSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERLRK 1020


>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine
          4,6-dehydratase/5-epimerase.  The FnlA enzyme is the
          first step in the biosynthesis of UDP-FucNAc from
          UDP-GlcNAc in E. coli (along with FnlB and FnlC). The
          proteins identified by this model include FnlA homologs
          in the O-antigen clusters of O4, O25, O26, O29
          (Shigella D11), O118, O145 and O172 serotype strains,
          all of which produce O-antigens containing FucNAc (or
          the further modified FucNAm). A homolog from
          Pseudomonas aerugiosa serotype O11, WbjB, also involved
          in the biosynthesis of UDP-FucNAc has been
          characterized and is now believed to carry out both the
          initial 4,6-dehydratase reaction and the subsequent
          epimerization of the resulting methyl group at C-5. A
          phylogenetic tree of related sequences shows a distinct
          clade of enzymes involved in the biosynthesis of
          UDP-QuiNAc (Qui=qinovosamine). This clade appears to be
          descendant from the common ancestor of the Pseudomonas
          and E. coli fucose-biosynthesis enzymes. It has been
          hypothesized that the first step in the biosynthesis of
          these two compounds may be the same, and thus that
          these enzymes all have the same function. At present,
          lacking sufficient confirmation of this, the current
          model trusted cutoff only covers the tree segment
          surrounding the E. coli genes. The clades containing
          the Pseudomonas and QuiNAc biosynthesis enzymes score
          above the noise cutoff. Immediately below the noise
          cutoff are enzymes involved in the biosynthesis of
          UDP-RhaNAc (Rha=rhamnose), which again may or may not
          produce the same product.
          Length = 337

 Score = 30.7 bits (69), Expect = 0.027
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 11 YRDGQILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKK 51
          ++D  +L+TGGTG  G  ++ + L +  DI  I I  RD+K
Sbjct: 2  FKDKILLITGGTGSFGNAVLRRFLDT--DIKEIRIFSRDEK 40


>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs.  This
          subgroup contains aldehyde reductase of the extended
          SDR-type and related proteins. Aldehyde reductase I
          (aka carbonyl reductase) is an NADP-binding SDR; it has
          an NADP-binding motif consensus that is slightly
          different from the canonical SDR form and lacks the Asn
          of the extended SDR active site tetrad. Aldehyde
          reductase I catalyzes the NADP-dependent  reduction of
          ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 301

 Score = 30.7 bits (70), Expect = 0.027
 Identities = 9/20 (45%), Positives = 16/20 (80%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          +LVTG TGF+   ++++LL+
Sbjct: 2  VLVTGATGFIASHIVEQLLK 21


>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1.  Atypical SDRs in
          this subgroup are poorly defined and have been
          identified putatively as isoflavones reductase, sugar
          dehydratase, mRNA binding protein etc. Atypical SDRs
          are distinct from classical SDRs. Members of this
          subgroup retain the canonical active site triad (though
          not the upstream Asn found in most SDRs) but have an
          unusual putative glycine-rich NAD(P)-binding motif,
          GGXXXXG, in the usual location. Atypical SDRs generally
          lack the catalytic residues characteristic of the SDRs,
          and their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 250

 Score = 30.7 bits (70), Expect = 0.028
 Identities = 11/20 (55%), Positives = 17/20 (85%)

Query: 15 QILVTGGTGFMGKLLIDKLL 34
          +IL+ GGT F+GK L+++LL
Sbjct: 2  KILIIGGTRFIGKALVEELL 21


>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope
          biogenesis, outer membrane].
          Length = 340

 Score = 30.7 bits (70), Expect = 0.031
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 15 QILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDK 50
          +ILVTGG GF+G   +  +L   PD     ++  DK
Sbjct: 2  KILVTGGAGFIGSNFVRYILNKHPDDH---VVNLDK 34


>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase.  This
          enzyme catalyzes the first step in the biosynthesis of
          pseudaminic acid, the conversion of
          UDP-N-acetylglucosamine to
          UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences
          are members of the broader pfam01073 (3-beta
          hydroxysteroid dehydrogenase/isomerase family) family.
          Length = 324

 Score = 30.4 bits (69), Expect = 0.032
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRD 49
          IL+TGGTG  GK  I +LL ++ +   I I  RD
Sbjct: 7  ILITGGTGSFGKAFISRLLENY-NPKKIIIYSRD 39


>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs. 
          GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase)
          acts in the NADP-dependent synthesis of GDP-fucose from
          GDP-mannose. Two activities have been proposed for the
          same active site: epimerization and reduction. Proteins
          in this subgroup are extended SDRs, which have a
          characteristic active site tetrad and an NADP-binding
          motif, [AT]GXXGXXG, that is a close match to the
          archetypical form. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 30.6 bits (70), Expect = 0.034
 Identities = 9/21 (42%), Positives = 12/21 (57%)

Query: 16 ILVTGGTGFMGKLLIDKLLRS 36
          ILVTG  G +G  ++  L R 
Sbjct: 2  ILVTGHRGLVGSAIVRVLARR 22


>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl
          reductase.
          Length = 390

 Score = 30.5 bits (69), Expect = 0.036
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 13 DGQILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKG 52
          D  +LV G TG++GK ++ +L+R   ++ A+    R+K G
Sbjct: 60 DVTVLVVGATGYIGKFVVRELVRRGYNVVAV---AREKSG 96


>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme.
          Length = 668

 Score = 30.5 bits (69), Expect = 0.041
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 5/41 (12%)

Query: 11 YRDGQILVTGGTGFMGKLLIDKLLRSFPDIGAIY-IMVRDK 50
          Y    IL+TG  GF+   + ++L+R++PD    Y I+V DK
Sbjct: 4  YEPKNILITGAAGFIASHVANRLIRNYPD----YKIVVLDK 40


>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase.
          Length = 442

 Score = 30.3 bits (68), Expect = 0.046
 Identities = 10/21 (47%), Positives = 17/21 (80%)

Query: 15  QILVTGGTGFMGKLLIDKLLR 35
           +++VTGG GF+G  L+D+L+ 
Sbjct: 121 RVVVTGGAGFVGSHLVDRLMA 141


>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5.  This subgroup
          contains atypical SDRs, some of which are identified as
          putative NAD(P)-dependent epimerases, one as a putative
          NAD-dependent epimerase/dehydratase. Atypical SDRs are
          distinct from classical SDRs. Members of this subgroup
          have a glycine-rich NAD(P)-binding motif that is very
          similar to the extended SDRs, GXXGXXG, and binds NADP.
          Generally, this subgroup has poor conservation of the
          active site tetrad; however, individual sequences do
          contain matches to the YXXXK active site motif, the
          upstream Ser, and there is a highly conserved Asp in
          place of the usual active site Asn throughout the
          subgroup. Atypical SDRs generally lack the catalytic
          residues characteristic of the SDRs, and their
          glycine-rich NAD(P)-binding motif is often different
          from the forms normally seen in classical or extended
          SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 203

 Score = 29.9 bits (68), Expect = 0.047
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 5/36 (13%)

Query: 16 ILVTGGTGFMGKLLIDKLL-RSFPDIGAIYIMVRDK 50
          +LV G TG +G+ ++ +LL R +     +  +VRD 
Sbjct: 2  VLVVGATGKVGRHVVRELLDRGYQ----VRALVRDP 33


>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase.
          Length = 436

 Score = 30.0 bits (67), Expect = 0.049
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 15  QILVTGGTGFMGKLLIDKLL 34
           +I+VTGG GF+G  L+DKL+
Sbjct: 122 RIVVTGGAGFVGSHLVDKLI 141


>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1
          alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like,
          atypical (a) SDRs.  This subgroup of extended SDR-like
          proteins are atypical SDRs. They have a glycine-rich
          NAD(P)-binding motif similar to the typical SDRs,
          GXXGXXG, and have the YXXXK active site motif (though
          not the other residues of the SDR tetrad). Members
          identified include NDUFA9 (mitochondrial) and putative
          nucleoside-diphosphate-sugar epimerase. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 273

 Score = 29.9 bits (68), Expect = 0.051
 Identities = 7/21 (33%), Positives = 15/21 (71%)

Query: 16 ILVTGGTGFMGKLLIDKLLRS 36
          + V G TGF+G+ ++++L + 
Sbjct: 3  VTVFGATGFIGRYVVNRLAKR 23


>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e)
          SDRs.  Decarboxylase domain of ArnA. ArnA, is an enzyme
          involved in the modification of outer membrane protein
          lipid A of gram-negative bacteria. It is a bifunctional
          enzyme that catalyzes the NAD-dependent decarboxylation
          of UDP-glucuronic acid and
          N-10-formyltetrahydrofolate-dependent formylation of
          UDP-4-amino-4-deoxy-l-arabinose; its NAD-dependent
          decaboxylating activity is in the C-terminal 360
          residues. This subgroup belongs to the extended SDR
          family, however the NAD binding motif is not a perfect
          match and the upstream Asn of the canonical active site
          tetrad is not conserved. Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 316

 Score = 29.6 bits (67), Expect = 0.074
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 16 ILVTGGTGFMGKLLIDKLLRS 36
          +LVTG  GF+G  L ++LLR 
Sbjct: 2  VLVTGADGFIGSHLTERLLRE 22


>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases
           [Cell envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 588

 Score = 29.5 bits (67), Expect = 0.077
 Identities = 14/65 (21%), Positives = 28/65 (43%), Gaps = 8/65 (12%)

Query: 10  FYRDGQILVTGGTGFMGKLLIDKLLRSFP------DIG--AIYIMVRDKKGSSPEERVKN 61
                 +LVTGG G +G  L  ++L+  P            +Y++  + +   PE +++ 
Sbjct: 247 MLTGKTVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRF 306

Query: 62  MLNSV 66
            +  V
Sbjct: 307 YIGDV 311


>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase.  This
          protein is related to UDP-glucose 4-epimerase (GalE)
          and likewise has an NAD cofactor [Cell envelope,
          Biosynthesis and degradation of surface polysaccharides
          and lipopolysaccharides].
          Length = 317

 Score = 29.7 bits (67), Expect = 0.078
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPD 39
          ILVTGG GF+G   +  +L   PD
Sbjct: 2  ILVTGGAGFIGSNFVRYILNEHPD 25


>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2.  This subgroup
          contains atypical SDRs, one member is identified as
          Escherichia coli protein ybjT, function unknown.
          Atypical SDRs are distinct from classical SDRs. Members
          of this subgroup have a glycine-rich NAD(P)-binding
          motif consensus that generally matches the extended
          SDRs, TGXXGXXG, but lacks the characteristic active
          site residues of the SDRs. This subgroup has basic
          residues (HXXXR) in place of the active site motif
          YXXXK, these may have a catalytic role. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 293

 Score = 29.6 bits (67), Expect = 0.080
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERV 59
          +LVTG TG++G  L+ +LL+    + A+             ERV
Sbjct: 1  VLVTGATGYVGGRLVPRLLQEGHQVRALVRSPEKLADRPWSERV 44


>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a
          nucleoside-diphosphate-sugar 4-epimerase)-like,
          extended (e) SDRs.  Nucleoside-diphosphate-sugar
          4-epimerase has the characteristic active site tetrad
          and NAD-binding motif of the extended SDR, and is
          related to more specifically defined epimerases such as
          UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), which catalyzes the
          NAD-dependent conversion of UDP-galactose to
          UDP-glucose, the final step in Leloir galactose
          synthesis. This subgroup includes Escherichia coli
          055:H7 Gne, a UDP-GlcNAc 4-epimerase, essential for O55
          antigen synthesis. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 29.3 bits (66), Expect = 0.095
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVK 60
          +L+TG +GF+G+ L ++LL   P+   I I V   K  S   RV 
Sbjct: 3  VLITGASGFVGQRLAERLLSDVPNERLILIDVVSPKAPSGAPRVT 47


>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid
          dehydrogenase-like protein)-like, extended (e) SDRs.
          This subgroup includes human NSDHL and related
          proteins. These proteins have the characteristic active
          site tetrad of extended SDRs, and also have a close
          match to their  NAD(P)-binding motif.  Human NSDHL is a
          3beta-hydroxysteroid dehydrogenase (3 beta-HSD) which
          functions in the cholesterol biosynthetic pathway.  3
          beta-HSD catalyzes the oxidative conversion of delta
          5-3 beta-hydroxysteroids to the delta 4-3-keto
          configuration; this activity is essential for the
          biosynthesis of all classes of hormonal steroids.
          Mutations in the gene encoding NSDHL cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait.  This subgroup also includes an
          unusual bifunctional [3beta-hydroxysteroid
          dehydrogenase (3b-HSD)/C-4 decarboxylase from
          Arabidopsis thaliana, and Saccharomyces cerevisiae
          ERG26, a 3b-HSD/C-4 decarboxylase, involved in the
          synthesis of ergosterol, the major sterol of yeast.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 335

 Score = 28.9 bits (65), Expect = 0.12
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 17 LVTGGTGFMGKLLIDKLL-RSFPDIGAIYIMVRDKKGSSPEERVK 60
          LV GG+GF+G+ L+++LL R  P +    I    +   S   RV+
Sbjct: 3  LVVGGSGFLGRHLVEQLLRRGNPTVHVFDIRPTFELDPSSSGRVQ 47


>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase.  Members
          of this protein family are CDP-glucose 4,6-dehydratase
          from a variety of Gram-negative and Gram-positive
          bacteria. Members typically are encoded next to a gene
          that encodes a glucose-1-phosphate
          cytidylyltransferase, which produces the substrate,
          CDP-D-glucose, used by this enzyme to produce
          CDP-4-keto-6-deoxyglucose [Cell envelope, Biosynthesis
          and degradation of surface polysaccharides and
          lipopolysaccharides].
          Length = 349

 Score = 28.8 bits (65), Expect = 0.12
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 10 FYRDGQILVTGGTGFMGKLL 29
          F++  ++LVTG TGF G  L
Sbjct: 1  FWQGKKVLVTGHTGFKGSWL 20


>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein. 
          This is a family of diverse bacterial polysaccharide
          biosynthesis proteins including the CapD protein, WalL
          protein mannosyl-transferase and several putative
          epimerases (e.g. WbiI).
          Length = 280

 Score = 28.6 bits (65), Expect = 0.15
 Identities = 12/59 (20%), Positives = 27/59 (45%), Gaps = 8/59 (13%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFP------DIG--AIYIMVRDKKGSSPEERVKNMLNSV 66
          +LVTGG G +G  L  ++L+  P            +Y + ++ +    + +++  +  V
Sbjct: 1  VLVTGGGGSIGSELCRQILKFNPKKIILFSRDEFKLYEIRQELRQEYNDPKLRFFIGDV 59


>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup
          5, extended (e) SDRs.  This subgroup partially
          conserves the characteristic active site tetrad and
          NAD-binding motif of the extended SDRs, and has been
          identified as possible UDP-glucose 4-epimerase (aka
          UDP-galactose 4-epimerase), a homodimeric member of the
          extended SDR family. UDP-glucose 4-epimerase catalyzes
          the NAD-dependent conversion of UDP-galactose to
          UDP-glucose, the final step in Leloir galactose
          synthesis. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 28.8 bits (65), Expect = 0.16
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDI 40
          +L+ GG GF+G  L+D LL   P +
Sbjct: 2  VLIVGGNGFIGSHLVDALLEEGPQV 26


>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding. 
          Length = 182

 Score = 28.4 bits (64), Expect = 0.20
 Identities = 9/20 (45%), Positives = 12/20 (60%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          I V G TG  G+ L+ +LL 
Sbjct: 1  IAVIGATGKTGRRLVKELLA 20


>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional.
          Length = 355

 Score = 28.5 bits (63), Expect = 0.20
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 15 QILVTGGTGFMGKLLIDKLLRSFPD 39
          +IL+TGG GF+G  L+  ++    D
Sbjct: 3  KILITGGAGFIGSALVRYIINETSD 27


>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase,
          and related proteins, extended (e) SDRs.  This subgroup
          contains aldehyde reductase and flavonoid reductase of
          the extended SDR-type and related proteins. Proteins in
          this subgroup have a complete SDR-type active site
          tetrad and a close match to the canonical extended SDR
          NADP-binding motif. Aldehyde reductase I (aka carbonyl
          reductase) is an NADP-binding SDR; it catalyzes  the
          NADP-dependent  reduction of ethyl
          4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
          reductases act in the NADP-dependent reduction of
          flavonoids, ketone-containing plant secondary
          metabolites. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 295

 Score = 28.4 bits (63), Expect = 0.21
 Identities = 8/19 (42%), Positives = 15/19 (78%)

Query: 16 ILVTGGTGFMGKLLIDKLL 34
          +LVTG +GF+   ++++LL
Sbjct: 1  VLVTGASGFVASHVVEQLL 19


>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid
          dehydrogenase/isomerase family.  The enzyme 3
          beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase
          (3 beta-HSD) catalyzes the oxidation and isomerisation
          of 5-ene-3 beta-hydroxypregnene and
          5-ene-hydroxyandrostene steroid precursors into the
          corresponding 4-ene-ketosteroids necessary for the
          formation of all classes of steroid hormones.
          Length = 280

 Score = 28.5 bits (64), Expect = 0.21
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 17 LVTGGTGFMGKLLIDKLLR 35
          LVTGG GF+G+ ++  LLR
Sbjct: 1  LVTGGGGFLGRHIVRLLLR 19


>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase.
          Length = 367

 Score = 28.2 bits (63), Expect = 0.21
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 18 VTGGTGFMGKLLIDKLLR 35
          VTGG  F+G  ++D+LLR
Sbjct: 58 VTGGVSFLGLAIVDRLLR 75


>gnl|CDD|100016 cd02187, beta_tubulin, The tubulin superfamily includes five
           distinct families, the alpha-, beta-, gamma-, delta-,
           and epsilon-tubulins and a sixth family (zeta-tubulin)
           which is present only in kinetoplastid protozoa. The
           alpha- and beta-tubulins are the major components of
           microtubules, while gamma-tubulin plays a major role in
           the nucleation of microtubule assembly.  The delta- and
           epsilon-tubulins are widespread but unlike the alpha,
           beta, and gamma-tubulins they are not ubiquitous among
           eukaryotes. The alpha/beta-tubulin heterodimer is the
           structural subunit of microtubules.  The alpha- and
           beta-tubulins share 40% amino-acid sequence identity,
           exist in several isotype forms, and undergo a variety of
           posttranslational modifications.  The structures of
           alpha- and beta-tubulin are basically identical: each
           monomer is formed by a core of two beta-sheets
           surrounded by alpha-helices. The monomer structure is
           very compact, but can be divided into three regions
           based on function: the amino-terminal nucleotide-binding
           region, an intermediate taxol-binding region and the
           carboxy-terminal region which probably constitutes the
           binding surface for motor proteins.
          Length = 425

 Score = 28.4 bits (64), Expect = 0.22
 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 20  GGTGF-MGKLLIDKLLRSFPD 39
           GGTG  MG LLI K+   +PD
Sbjct: 140 GGTGSGMGTLLISKIREEYPD 160


>gnl|CDD|236461 PRK09302, PRK09302, circadian clock protein KaiC; Reviewed.
          Length = 509

 Score = 27.9 bits (63), Expect = 0.25
 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 10  FYRDGQILVTGGTGFMGKLLI 30
           F+R   ILV+G TG  GK L+
Sbjct: 270 FFRGSIILVSGATG-TGKTLL 289


>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family.  NmrA is a negative
          transcriptional regulator involved in the
          post-translational modification of the transcription
          factor AreA. NmrA is part of a system controlling
          nitrogen metabolite repression in fungi. This family
          only contains a few sequences as iteration results in
          significant matches to other Rossmann fold families.
          Length = 232

 Score = 28.0 bits (63), Expect = 0.26
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 16 ILVTGGTGFMGKLLIDKLLRS-FPDIGAIYIMVRDKKG 52
          ILV G TG+ G  ++   L++  P    +  +VRD K 
Sbjct: 1  ILVFGATGYQGGSVVRASLKAGHP----VRALVRDPKS 34


>gnl|CDD|187553 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8.  This subgroup
          contains atypical SDRs of unknown function. Proteins in
          this subgroup have a glycine-rich NAD(P)-binding motif
          consensus that resembles that of the extended SDRs,
          (GXXGXXG or GGXGXXG), but lacks the characteristic
          active site residues of the SDRs. A Cys often replaces
          the usual Lys of the YXXXK active site motif, while the
          upstream Ser is generally present and Arg replaces the
          usual Asn. Atypical SDRs generally lack the catalytic
          residues characteristic of the SDRs, and their
          glycine-rich NAD(P)-binding motif is often different
          from the forms normally seen in classical or extended
          SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 296

 Score = 27.6 bits (62), Expect = 0.31
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          I++TGGTGF+G+ L  +L  
Sbjct: 2  IVITGGTGFIGRALTRRLTA 21


>gnl|CDD|187560 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs.
          Atypical SDRs in this subgroup include CC3 (also known
          as TIP30) which is implicated in tumor suppression.
          Atypical SDRs are distinct from classical SDRs. Members
          of this subgroup have a glycine rich NAD(P)-binding
          motif that resembles the extended SDRs, and have an
          active site triad of the SDRs (YXXXK and upstream Ser),
          although the upstream Asn of the usual SDR active site
          is substituted with Asp. For CC3, the Tyr of the triad
          is displaced compared to the usual SDRs and the protein
          is monomeric, both these observations suggest that the
          usual SDR catalytic activity is not present. NADP
          appears to serve an important role as a ligand, and may
          be important in the interaction with other
          macromolecules. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 214

 Score = 27.6 bits (62), Expect = 0.32
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 17 LVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPEERVK 60
          LV G TG +GK L+ +LL+S P    +  +VR +K + PE + K
Sbjct: 4  LVLGATGLVGKHLLRELLKS-PYYSKVTAIVR-RKLTFPEAKEK 45


>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains CDP-D-glucose
          4,6-dehydratase, an extended SDR, which catalyzes the
          conversion of CDP-D-glucose to
          CDP-4-keto-6-deoxy-D-glucose. This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 336

 Score = 27.7 bits (62), Expect = 0.32
 Identities = 9/17 (52%), Positives = 13/17 (76%)

Query: 10 FYRDGQILVTGGTGFMG 26
          F++  ++LVTG TGF G
Sbjct: 1  FWQGKRVLVTGHTGFKG 17


>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope
          biogenesis, outer membrane].
          Length = 281

 Score = 27.6 bits (62), Expect = 0.33
 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 15 QILVTGGTGFMGKLLIDKLLRSFPDIGAIY 44
          +IL+TG  G +G  L   L   F ++ A  
Sbjct: 2  KILITGANGQLGTELRRALPGEF-EVIATD 30


>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase,
          LLPSF_EDH_00030 family.  This clade within the NAD
          dependent epimerase/dehydratase superfamily (pfam01370)
          is characterized by inclusion of its members within a
          cassette of seven distinctive enzymes. These include
          four genes homologous to the elements of the neuraminic
          (sialic) acid biosynthesis cluster (NeuABCD), an
          aminotransferase and a nucleotidyltransferase in
          addition to the epimerase/dehydratase. Together it is
          very likely that these enzymes direct the biosynthesis
          of a nine-carbon sugar analagous to CMP-neuraminic
          acid. These seven genes form the core of the cassette,
          although they are often accompanied by additional genes
          that may further modify the product sugar. Although
          this cassette is widely distributed in bacteria, the
          family nomenclature arises from the instance in
          Leptospira interrogans serovar Lai, str. 56601, where
          it appears as the 30th gene in the 91-gene
          lipopolysaccharide biosynthesis cluster.
          Length = 297

 Score = 27.7 bits (62), Expect = 0.35
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          +LVTG  GF+G  L++ L+R
Sbjct: 1  VLVTGADGFIGSHLVEALVR 20


>gnl|CDD|131715 TIGR02667, moaB_proteo, molybdenum cofactor biosynthesis protein B,
           proteobacterial.  This model represents the MoaB protein
           molybdopterin biosynthesis regions in Proteobacteria.
           This crystallized but incompletely characterized protein
           is thought to be involved in, though not required for,
           early steps in molybdopterin biosynthesis. It may bind a
           molybdopterin precursor. A distinctive conserved motif
           PCN near the C-terminus helps distinguish this clade
           from other homologs, including sets of proteins
           designated MogA [Biosynthesis of cofactors, prosthetic
           groups, and carriers, Molybdopterin].
          Length = 163

 Score = 27.4 bits (61), Expect = 0.40
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 17/50 (34%)

Query: 16  ILVTGGTGFMGK--------LLIDK-------LLR--SFPDIGAIYIMVR 48
           IL+TGGTGF G+         L DK       L R  S+ +IG   I  R
Sbjct: 67  ILITGGTGFTGRDVTPEALEPLFDKTVEGFGELFRQLSYEEIGTSTIQSR 116


>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           both KR domains of the Bacillus subtilis Pks J,-L, and
           PksM, and all three KR domains of PksN, components of
           the megacomplex bacillaene synthase, which synthesizes
           the antibiotic bacillaene. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G
           NAD(P)-binding motif. Some atypical SDRs have lost
           catalytic activity and/or have an unusual NAD(P)-binding
           motif and missing or unusual active site residues.
           Reactions catalyzed within the SDR family include
           isomerization, decarboxylation, epimerization, C=N bond
           reduction, dehydratase activity, dehalogenation,
           Enoyl-CoA reduction, and carbonyl-alcohol
           oxidoreduction.
          Length = 436

 Score = 27.3 bits (61), Expect = 0.41
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 12  RDGQILVTGGTGFMGKLLIDKLLRSF 37
             G  LVTGG G +G+ L   L R +
Sbjct: 204 PGGVYLVTGGAGGIGRALARALARRY 229


>gnl|CDD|187655 cd08952, KR_1_SDR_x, ketoreductase (KR), subgroup 1, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           KR domains found in many multidomain PKSs, including six
           of seven Sorangium cellulosum PKSs (encoded by
           spiDEFGHIJ) which participate in the synthesis of the
           polyketide scaffold of the cytotoxic spiroketal
           polyketide spirangien. These seven PKSs have either a
           single PKS module (SpiF), two PKR modules
           (SpiD,-E,-I,-J), or three PKS modules (SpiG,-H). This
           subfamily includes the single KR domain of SpiF, the
           first KR domains of SpiE,-G,H,-I,and #J, the third KR
           domain of SpiG, and the second KR domain of SpiH. The
           second KR domains of SpiE,-G, I, and #J, and the KR
           domains of SpiD, belong to a different KR_FAS_SDR
           subfamily. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 480

 Score = 27.5 bits (62), Expect = 0.41
 Identities = 9/13 (69%), Positives = 11/13 (84%)

Query: 14  GQILVTGGTGFMG 26
           G +LVTGGTG +G
Sbjct: 231 GTVLVTGGTGALG 243


>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7.  This subgroup
          contains atypical SDRs of unknown function. Members of
          this subgroup have a glycine-rich NAD(P)-binding motif
          consensus that matches the extended SDRs, TGXXGXXG, but
          lacks the characteristic active site residues of the
          SDRs. This subgroup has basic residues (HXXXR) in place
          of the active site motif YXXXK, these may have a
          catalytic role. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 291

 Score = 27.3 bits (61), Expect = 0.42
 Identities = 8/19 (42%), Positives = 14/19 (73%)

Query: 16 ILVTGGTGFMGKLLIDKLL 34
          + VTG TGF+G  ++ +L+
Sbjct: 3  VFVTGATGFIGSAVVRELV 21


>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH
          and WbmG-like, extended (e) SDRs.  Bordetella
          bronchiseptica enzymes WbmH and WbmG, and related
          proteins. This subgroup exhibits the active site tetrad
          and NAD-binding motif of the extended SDR family. It
          has been proposed that the active site in Bordetella
          WbmG and WbmH cannot function as an epimerase, and that
          it plays a role in O-antigen synthesis pathway from
          UDP-2,3-diacetamido-2,3-dideoxy-l-galacturonic acid.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 307

 Score = 27.5 bits (61), Expect = 0.48
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 15 QILVTGGTGFMGKLLIDKLL 34
          ++L+TGG G +G  LI+ LL
Sbjct: 2  KVLITGGAGQIGSHLIEHLL 21


>gnl|CDD|236649 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provisional.
          Length = 352

 Score = 27.1 bits (60), Expect = 0.55
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 15 QILVTGGTGFMGKLLIDKLLRSFPD 39
          +ILVTGG GF+G  ++  ++ +  D
Sbjct: 2  KILVTGGAGFIGSAVVRHIINNTQD 26


>gnl|CDD|240228 PTZ00010, PTZ00010, tubulin beta chain; Provisional.
          Length = 445

 Score = 27.0 bits (60), Expect = 0.55
 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 20  GGTGF-MGKLLIDKLLRSFPD 39
           GGTG  MG LLI KL   +PD
Sbjct: 141 GGTGSGMGTLLISKLREEYPD 161


>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 323

 Score = 27.1 bits (61), Expect = 0.62
 Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 13/38 (34%)

Query: 16 ILVTGGTGFMG-----KLL--------IDKLLRSFPDI 40
          +LVTGG G++G     +LL        +D L     + 
Sbjct: 2  VLVTGGAGYIGSHTVVELLEAGYDVVVLDNLSNGHREA 39


>gnl|CDD|181080 PRK07680, PRK07680, late competence protein ComER; Validated.
          Length = 273

 Score = 26.9 bits (60), Expect = 0.67
 Identities = 9/16 (56%), Positives = 11/16 (68%)

Query: 21 GTGFMGKLLIDKLLRS 36
          GTG MG +LI+  L S
Sbjct: 7  GTGNMGTILIEAFLES 22


>gnl|CDD|233775 TIGR02197, heptose_epim,
          ADP-L-glycero-D-manno-heptose-6-epimerase.  This family
          consists of examples of
          ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme
          involved in biosynthesis of the inner core of
          lipopolysaccharide (LPS) for Gram-negative bacteria.
          This enzyme is homologous to UDP-glucose 4-epimerase
          (TIGR01179) and belongs to the NAD dependent
          epimerase/dehydratase family (pfam01370) [Cell
          envelope, Biosynthesis and degradation of surface
          polysaccharides and lipopolysaccharides].
          Length = 314

 Score = 26.9 bits (60), Expect = 0.70
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 4/39 (10%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSS 54
          I+VTGG GF+G      L+++  + G   I+V D     
Sbjct: 1  IIVTGGAGFIGS----NLVKALNERGITDILVVDNLRDG 35


>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase
          (PCBER) like, atypical (a) SDRs.  PCBER and
          pinoresinol-lariciresinol reductases are
          NADPH-dependent aromatic alcohol reductases, and are
          atypical members of the SDR family. Other proteins in
          this subgroup are identified as eugenol synthase. These
          proteins contain an N-terminus characteristic of
          NAD(P)-binding proteins and a small C-terminal domain
          presumed to be involved in substrate binding, but they
          do not have the conserved active site Tyr residue
          typically found in SDRs. Numerous other members have
          unknown functions. The glycine rich NADP-binding motif
          in this subgroup is of 2 forms: GXGXXG and G[GA]XGXXG;
          it tends to be atypical compared with the forms
          generally seen in classical or extended SDRs. The usual
          SDR active site tetrad is not present, but a critical
          active site Lys at the usual SDR position has been
          identified in various members, though other charged and
          polar residues are found at this position in this
          subgroup. Atypical SDR-related proteins retain the
          Rossmann fold of the SDRs, but have limited sequence
          identity and generally lack the catalytic properties of
          the archetypical members. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 282

 Score = 26.5 bits (59), Expect = 0.83
 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 6/43 (13%)

Query: 16 ILVTGGTGFMGKLLIDKLLRS--FPDIGAIYIMVRDKKGSSPE 56
          I + G TG +G  ++  LL S  F     + ++ R    SS E
Sbjct: 2  IAIAGATGTLGGPIVSALLASPGFT----VTVLTRPSSTSSNE 40


>gnl|CDD|131703 TIGR02655, circ_KaiC, circadian clock protein KaiC.  Members of
           this family are the circadian clock protein KaiC, part
           of the kaiABC operon that controls circadian rhythm. It
           may be universal in Cyanobacteria. Each member has two
           copies of the KaiC domain (pfam06745), which is also
           found in other proteins. KaiC performs
           autophosphorylation and acts as its own transcriptional
           repressor [Cellular processes, Other].
          Length = 484

 Score = 26.8 bits (59), Expect = 0.85
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 10  FYRDGQILVTGGTGFMGKLLIDKLL 34
           F++D  IL TG TG    LL+ K L
Sbjct: 260 FFKDSIILATGATGTGKTLLVSKFL 284


>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase.
          Length = 351

 Score = 26.7 bits (59), Expect = 0.87
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 14 GQILVTGGTGFMGKLLIDKLL 34
            + VTG +GF+G  L+ +LL
Sbjct: 6  ETVCVTGASGFIGSWLVMRLL 26


>gnl|CDD|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus.
          Dihydrodipicolinate reductase (DapB) reduces the
          alpha,beta-unsaturated cyclic imine,
          dihydro-dipicolinate. This reaction is the second
          committed step in the biosynthesis of L-lysine and its
          precursor meso-diaminopimelate, which are critical for
          both protein and cell wall biosynthesis. The N-terminal
          domain of DapB binds the dinucleotide NADPH.
          Length = 122

 Score = 26.4 bits (59), Expect = 0.89
 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPD 39
          + V G +G MG+ LI K +   PD
Sbjct: 3  VAVVGASGRMGRELI-KAILEAPD 25


>gnl|CDD|215107 PLN00220, PLN00220, tubulin beta chain; Provisional.
          Length = 447

 Score = 26.3 bits (58), Expect = 0.95
 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 20  GGTGF-MGKLLIDKLLRSFPD 39
           GGTG  MG LLI K+   +PD
Sbjct: 141 GGTGSGMGTLLISKIREEYPD 161


>gnl|CDD|218047 pfam04367, DUF502, Protein of unknown function (DUF502).
          Predicted to be an integral membrane protein.
          Length = 108

 Score = 25.9 bits (58), Expect = 1.1
 Identities = 11/39 (28%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 16 ILVTG--GTGFMGKLLI---DKLLRSFPDIGAIYIMVRD 49
          I + G     F+G+ L+   ++LL   P + +IY  V+ 
Sbjct: 8  IFLVGLLARNFIGRWLLSLGERLLNRIPLVRSIYSSVKQ 46


>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis,
          outer membrane].
          Length = 329

 Score = 26.4 bits (59), Expect = 1.2
 Identities = 7/11 (63%), Positives = 10/11 (90%)

Query: 16 ILVTGGTGFMG 26
          +LVTGG G++G
Sbjct: 3  VLVTGGAGYIG 13


>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana
          GDP-mannose-3',5'-epimerase (GME)-like, extended (e)
          SDRs.  This subgroup of NDP-sugar
          epimerase/dehydratases are extended SDRs; they have the
          characteristic active site tetrad, and an NAD-binding
          motif: TGXXGXX[AG], which is a close match to the
          canonical NAD-binding motif. Members include
          Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)
          which catalyzes the epimerization of two positions of
          GDP-alpha-D-mannose to form GDP-beta-L-galactose.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 328

 Score = 26.3 bits (58), Expect = 1.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
           LVTG  GF+G  L ++L  
Sbjct: 3  ALVTGAGGFIGSHLAERLKA 22


>gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional.
          Length = 338

 Score = 26.0 bits (57), Expect = 1.4
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 10/45 (22%)

Query: 18 VTGGTGFMGKLLIDKLLRSFPDIG-AIYIMVRDKKGSSPEERVKN 61
          V GGTGF+  LLI  LL+     G A+   VRD     PE + K 
Sbjct: 14 VIGGTGFLASLLIKLLLQK----GYAVNTTVRD-----PENQKKI 49


>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase.
          Length = 352

 Score = 26.1 bits (58), Expect = 1.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)

Query: 16 ILVTGGTGFMG 26
          ILVTGG G++G
Sbjct: 8  ILVTGGAGYIG 18


>gnl|CDD|187559 cd05248, ADP_GME_SDR_e, ADP-L-glycero-D-mannoheptose 6-epimerase
          (GME), extended (e) SDRs.  This subgroup contains
          ADP-L-glycero-D-mannoheptose 6-epimerase, an extended
          SDR, which catalyzes the NAD-dependent interconversion
          of ADP-D-glycero-D-mannoheptose and
          ADP-L-glycero-D-mannoheptose.  This subgroup has the
          canonical active site tetrad and NAD(P)-binding motif.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 317

 Score = 26.1 bits (58), Expect = 1.4
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 16 ILVTGGTGFMGKLLIDKL 33
          I+VTGG GF+G  L+  L
Sbjct: 2  IIVTGGAGFIGSNLVKAL 19


>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase.  The
          sequences in this family are members of the pfam01370
          superfamily of NAD-dependent epimerases and
          dehydratases typically acting on nucleotide-sugar
          substrates. The genes of the family modeled here are
          generally in the same locus with genes involved in the
          biosynthesis and elaboration of hopene, the cyclization
          product of the polyisoprenoid squalene. This gene and
          its association with hopene biosynthesis in Zymomonas
          mobilis has been noted in the literature where the gene
          symbol hpnA was assigned. Hopanoids are known to be
          components of the plasma membrane and to have polar
          sugar head groups in Z. mobilis and other species.
          Length = 328

 Score = 25.7 bits (57), Expect = 1.7
 Identities = 10/21 (47%), Positives = 15/21 (71%)

Query: 14 GQILVTGGTGFMGKLLIDKLL 34
           ++LVTG TGF+G  ++  LL
Sbjct: 1  MKVLVTGATGFVGSAVVRLLL 21


>gnl|CDD|234595 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional.
          Length = 257

 Score = 25.5 bits (57), Expect = 1.8
 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 9/42 (21%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDI---GAIYIMVRDKKGSS 54
          + V G +G MG+ LI + + +  D+    A+     D+ GS 
Sbjct: 4  VAVAGASGRMGRELI-EAVEAAEDLELVAAV-----DRPGSP 39


>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR).  SDRs
          are a functionally diverse family of oxidoreductases
          that have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRs are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes catalyze a
          wide range of activities including the metabolism of
          steroids, cofactors, carbohydrates, lipids, aromatic
          compounds, and amino acids, and act in redox sensing.
          Classical SDRs have an TGXXX[AG]XG cofactor binding
          motif and a YXXXK active site motif, with the Tyr
          residue of the active site motif serving as a critical
          catalytic residue (Tyr-151, human prostaglandin
          dehydrogenase (PGDH) numbering). In addition to the Tyr
          and Lys, there is often an upstream Ser (Ser-138, PGDH
          numbering) and/or an Asn (Asn-107, PGDH numbering)
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Extended SDRs have additional
          elements in the C-terminal region, and typically have a
          TGXXGXXG cofactor binding motif. Complex (multidomain)
          SDRs such as ketoreductase (KR) domains of fatty acid
          synthase have a GGXGXXG NAD(P)-binding motif and an
          altered active site motif (YXXXN). Fungal type KRs have
          a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical
          SDRs have lost catalytic activity and/or have an
          unusual NAD(P)-binding motif and missing or unusual
          active site residues. Reactions catalyzed within the
          SDR family include isomerization, decarboxylation,
          epimerization, C=N bond reduction, dehydratase
          activity, dehalogenation, Enoyl-CoA reduction, and
          carbonyl-alcohol oxidoreduction.
          Length = 186

 Score = 25.6 bits (56), Expect = 1.9
 Identities = 8/20 (40%), Positives = 12/20 (60%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          +LVTGG+G +G  +   L  
Sbjct: 1  VLVTGGSGGIGGAIARWLAS 20


>gnl|CDD|187542 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcriptional
          regulator) and triphenylmethane reductase (TMR) like
          proteins, subgroup 1, atypical (a) SDRs.  Atypical SDRs
          related to NMRa, TMR, and HSCARG (an NADPH sensor).
          This subgroup resembles the SDRs and has a partially
          conserved characteristic [ST]GXXGXXG NAD-binding motif,
          but lacks the conserved active site residues. NmrA is a
          negative transcriptional regulator of various fungi,
          involved in the post-translational modulation of the
          GATA-type transcription factor AreA. NmrA lacks the
          canonical GXXGXXG NAD-binding motif and has altered
          residues at the catalytic triad, including a Met
          instead of the critical Tyr residue. NmrA may bind
          nucleotides but appears to lack any dehydrogenase
          activity. HSCARG has been identified as a putative
          NADP-sensing molecule, and redistributes and
          restructures in response to NADPH/NADP ratios. Like
          NmrA, it lacks most of the active site residues of the
          SDR family, but has an NAD(P)-binding motif similar to
          the extended SDR family, GXXGXXG. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Atypical
          SDRs are distinct from classical SDRs. Classical SDRs
          have an TGXXX[AG]XG cofactor binding motif and a YXXXK
          active site motif, with the Tyr residue of the active
          site motif serving as a critical catalytic residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser and/or an Asn, contributing to
          the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. In addition to the Rossmann fold core
          region typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 259

 Score = 25.4 bits (56), Expect = 2.0
 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%)

Query: 16 ILVTGGTGFMGKLLIDKLL-RSFP 38
          ILVTG TG +G  +   LL    P
Sbjct: 1  ILVTGATGRIGSKVATTLLEAGRP 24


>gnl|CDD|187561 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and
          HSCARG (an NADPH sensor) like proteins, atypical (a)
          SDRs.  NmrA and HSCARG like proteins. NmrA is a
          negative transcriptional regulator of various fungi,
          involved in the post-translational modulation of the
          GATA-type transcription factor AreA. NmrA lacks the
          canonical GXXGXXG NAD-binding motif and has altered
          residues at the catalytic triad, including a Met
          instead of the critical Tyr residue. NmrA may bind
          nucleotides but appears to lack any dehydrogenase
          activity. HSCARG has been identified as a putative
          NADP-sensing molecule, and redistributes and
          restructures in response to NADPH/NADP ratios. Like
          NmrA, it lacks most of the active site residues of the
          SDR family, but has an NAD(P)-binding motif similar to
          the extended SDR family, GXXGXXG. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Atypical
          SDRs are distinct from classical SDRs. Classical SDRs
          have an TGXXX[AG]XG cofactor binding motif and a YXXXK
          active site motif, with the Tyr residue of the active
          site motif serving as a critical catalytic residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          numbering). In addition to the Tyr and Lys, there is
          often an upstream Ser and/or an Asn, contributing to
          the active site; while substrate binding is in the
          C-terminal region, which determines specificity. The
          standard reaction mechanism is a 4-pro-S hydride
          transfer and proton relay involving the conserved Tyr
          and Lys, a water molecule stabilized by Asn, and
          nicotinamide. In addition to the Rossmann fold core
          region typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 242

 Score = 25.3 bits (56), Expect = 2.0
 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 4/44 (9%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGA-IYIMVRDKKGSSPEER 58
          ILV G TG  G  ++  LL+   D G  +  + RD    + +  
Sbjct: 1  ILVFGATGKQGGSVVRALLK---DPGFKVRALTRDPSSPAAKAL 41


>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE.  Alternate name:
          UDPgalactose 4-epimerase This enzyme interconverts
          UDP-glucose and UDP-galactose. A set of related
          proteins, some of which are tentatively identified as
          UDP-glucose-4-epimerase in Thermotoga maritima,
          Bacillus halodurans, and several archaea, but deeply
          branched from this set and lacking experimental
          evidence, are excluded from This model and described by
          a separate model [Energy metabolism, Sugars].
          Length = 328

 Score = 25.4 bits (56), Expect = 2.1
 Identities = 8/11 (72%), Positives = 10/11 (90%)

Query: 16 ILVTGGTGFMG 26
          ILVTGG G++G
Sbjct: 2  ILVTGGAGYIG 12


>gnl|CDD|182998 PRK11150, rfaD, ADP-L-glycero-D-mannoheptose-6-epimerase;
          Provisional.
          Length = 308

 Score = 25.4 bits (56), Expect = 2.2
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 4/34 (11%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRD 49
          I+VTGG GF+G  ++    ++  D G   I+V D
Sbjct: 2  IIVTGGAGFIGSNIV----KALNDKGITDILVVD 31


>gnl|CDD|234026 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP
           family.  This model represents a subfamily of pfam00107
           as defined by Pfam, a superfamily in which some members
           are zinc-binding medium-chain alcohol dehydrogenases
           while others are quinone oxidoreductases with no bound
           zinc. This subfamily includes proteins studied
           crystallographically for insight into function: YhdH
           from Escherichia coli and YhfP from Bacillus subtilis.
           Members bind NADPH or NAD, but not zinc [Unknown
           function, Enzymes of unknown specificity].
          Length = 323

 Score = 25.2 bits (56), Expect = 2.4
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 13  DGQILVTGGTGFMGKLLIDKL 33
           DG +LVTG TG +G L +  L
Sbjct: 146 DGPVLVTGATGGVGSLAVAIL 166


>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase.  This family
          contains a wide variety of dehydrogenases.
          Length = 167

 Score = 25.2 bits (56), Expect = 2.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          +L+TGGTG +G  L   L  
Sbjct: 3  VLITGGTGGLGLALARWLAA 22


>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e)
          SDRs.  CDP-tyvelose 2-epimerase is a tetrameric SDR
          that catalyzes the conversion of CDP-D-paratose to
          CDP-D-tyvelose, the last step in tyvelose biosynthesis.
          This subgroup is a member of the extended SDR
          subfamily, with a characteristic active site tetrad and
          NAD-binding motif. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 337

 Score = 24.9 bits (55), Expect = 3.1
 Identities = 9/20 (45%), Positives = 13/20 (65%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
          +L+TGG GF+G  L    L+
Sbjct: 3  VLITGGAGFIGSNLARFFLK 22


>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e)
          SDRs.  GDP-mannose 4,6 dehydratase, a homodimeric SDR,
          catalyzes the NADP(H)-dependent conversion of
          GDP-(D)-mannose to GDP-4-keto, 6-deoxy-(D)-mannose in
          the fucose biosynthesis pathway. These proteins have
          the canonical active site triad and NAD-binding
          pattern, however the active site Asn is often missing
          and may be substituted with Asp. A Glu residue has been
          identified as an important active site base. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 316

 Score = 24.9 bits (55), Expect = 3.1
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query: 16 ILVTGGTGFMGKLLIDKLLR 35
           L+TG TG  G  L + LL 
Sbjct: 2  ALITGITGQDGSYLAEFLLE 21


>gnl|CDD|187571 cd05261, CAPF_like_SDR_e, capsular polysaccharide assembling
          protein (CAPF) like, extended (e) SDRs.  This subgroup
          of extended SDRs, includes some members which have been
          identified as capsular polysaccharide assembling
          proteins, such as Staphylococcus aureus Cap5F which is
          involved in the biosynthesis of N-acetyl-l-fucosamine,
          a constituent of surface polysaccharide structures of
          S. aureus. This subgroup has the characteristic active
          site tetrad and NAD-binding motif of extended SDRs.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 248

 Score = 25.0 bits (55), Expect = 3.3
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 16 ILVTGGTGFMGKLLIDKL 33
          IL+TG  GF+GK LI +L
Sbjct: 3  ILITGAKGFIGKNLIARL 20


>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7.  These proteins
          are members of the classical SDR family, with a
          canonical active site triad (and also an active site
          Asn) and a typical Gly-rich NAD-binding motif. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRS are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes have a
          3-glycine N-terminal NAD(P)(H)-binding pattern
          (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
          extended SDRs), while substrate binding is in the
          C-terminal region. A critical catalytic Tyr residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          (15-PGDH) numbering), is often found in a conserved
          YXXXK pattern. In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) or
          additional Ser, contributing to the active site.
          Substrates for these enzymes include sugars, steroids,
          alcohols, and aromatic compounds. The standard reaction
          mechanism is a proton relay involving the conserved Tyr
          and Lys, as well as Asn (or Ser). Some SDR family
          members, including 17 beta-hydroxysteroid dehydrogenase
          contain an additional helix-turn-helix motif that is
          not generally found among SDRs.
          Length = 235

 Score = 24.7 bits (54), Expect = 4.5
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 12 RDGQILVTGGTGFMGKLLIDKLLRSFPDIGA--IYIMVRD 49
          +D  +LVTG    +GK  ++ LL      GA  +Y  VRD
Sbjct: 2  KDKTVLVTGANRGIGKAFVESLLAH----GAKKVYAAVRD 37


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
           MAPK/MAK/MRK Overlapping Kinase.  Serine/Threonine
           Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MOK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MOK, also called Renal tumor antigen 1
           (RAGE-1), is widely expressed and is enriched in testis,
           kidney, lung, and brain. It is expressed in
           approximately 50% of renal cell carcinomas (RCC) and is
           a potential target for immunotherapy. MOK is stabilized
           by its association with the HSP90 molecular chaperone.
           It is induced by the transcription factor Cdx2 and may
           be involved in regulating intestinal epithelial
           development and differentiation.
          Length = 282

 Score = 24.5 bits (54), Expect = 4.7
 Identities = 7/21 (33%), Positives = 15/21 (71%)

Query: 43  IYIMVRDKKGSSPEERVKNML 63
           +Y +++ +K   PE+RVK+ +
Sbjct: 86  LYELIKGRKRPLPEKRVKSYM 106


>gnl|CDD|193426 pfam12953, DUF3842, Domain of unknown function (DUF3842).  This
          short protein is found mainly in firmicute bacteria. It
          is functionally uncharacterized.
          Length = 131

 Score = 24.4 bits (54), Expect = 4.8
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 6/27 (22%)

Query: 13 DGQILVTGGTGFMGKLLIDKLLRSFPD 39
          DGQ    GG   +GK +I+KL +  P+
Sbjct: 6  DGQ----GGG--IGKQIIEKLRKELPE 26


>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended
          (e) SDRs.  This subgroup contains UDP-D-glucuronic acid
          4-epimerase, an extended SDR, which catalyzes the
          conversion of UDP-alpha-D-glucuronic acid to
          UDP-alpha-D-galacturonic acid. This group has the SDR's
          canonical catalytic tetrad and the TGxxGxxG NAD-binding
          motif of the extended SDRs. Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 332

 Score = 24.2 bits (53), Expect = 5.2
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 15 QILVTGGTGFMGKLLIDKLLR 35
          +ILVTG  GF+G  +  +LL 
Sbjct: 2  KILVTGAAGFIGFHVAKRLLE 22


>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone
           oxidoreductases.  Yhdh and yhfp-like putative quinone
           oxidoreductases (QOR). QOR catalyzes the conversion of a
           quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones
           are cyclic diones derived from aromatic compounds.
           Membrane bound QOR actin the respiratory chains of
           bacteria and mitochondria, while soluble QOR acts to
           protect from toxic quinones (e.g. DT-diaphorase) or as a
           soluble eye-lens protein in some vertebrates (e.g.
           zeta-crystalin). QOR reduces quinones through a
           semi-quinone intermediate via a NAD(P)H-dependent single
           electron transfer. QOR is a member of the medium chain
           dehydrogenase/reductase family, but lacks the
           zinc-binding sites of the prototypical alcohol
           dehydrogenases of this group.  NAD(P)(H)-dependent
           oxidoreductases are the major enzymes in the
           interconversion of alcohols and aldehydes, or ketones.
           Alcohol dehydrogenase in the liver converts ethanol and
           NAD+ to acetaldehyde and NADH, while in yeast and some
           other microorganisms ADH catalyzes the conversion
           acetaldehyde to ethanol in alcoholic fermentation.  ADH
           is a member of the medium chain alcohol dehydrogenase
           family (MDR), which has a NAD(P)(H)-binding domain in a
           Rossmann fold of a beta-alpha form.  The NAD(H)-binding
           region is comprised of 2 structurally similar halves,
           each of which contacts a mononucleotide.  A GxGxxG motif
           after the first mononucleotide contact half allows the
           close contact of the coenzyme with the ADH backbone.
           The N-terminal catalytic domain has a distant homology
           to GroES. These proteins typically form dimers
           (typically higher plants, mammals) or tetramers (yeast,
           bacteria), and have 2 tightly bound zinc atoms per
           subunit, a catalytic zinc at the active site and a
           structural zinc in a lobe of the catalytic domain.
           NAD(H) binding occurs in the cleft between the catalytic
           and coenzyme-binding domains at the active site, and
           coenzyme binding induces a conformational closing of
           this cleft. Coenzyme binding typically precedes and
           contributes to substrate binding. In human ADH
           catalysis, the zinc ion helps coordinate the alcohol,
           followed by deprotonation of  a histidine, the ribose of
           NAD, a serine, then the alcohol, which allows the
           transfer of a hydride to NAD+, creating NADH and a
           zinc-bound aldehyde or ketone. In yeast and some
           bacteria, the active site zinc binds an aldehyde,
           polarizing it, and leading to the reverse reaction.
          Length = 325

 Score = 24.4 bits (54), Expect = 5.4
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 13  DGQILVTGGTGFMGKLLIDKL 33
           DG +LVTG TG +G + +  L
Sbjct: 147 DGPVLVTGATGGVGSIAVAIL 167


>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family.  Members of
           this protein family contain multiple copies of the
           beta-propeller-forming Kelch repeat. All are full-length
           homologs to YjhT of Escherichia coli, which has been
           identified as a mutarotase for sialic acid. This protein
           improves bacterial ability to obtain host sialic acid,
           and thus serves as a virulence factor. Some bacteria
           carry what appears to be a cyclically permuted homolog
           of this protein.
          Length = 346

 Score = 24.2 bits (53), Expect = 6.9
 Identities = 7/16 (43%), Positives = 9/16 (56%)

Query: 11  YRDGQILVTGGTGFMG 26
             +G +LV GG  F G
Sbjct: 255 ISNGVLLVAGGANFPG 270


>gnl|CDD|227356 COG5023, COG5023, Tubulin [Cytoskeleton].
          Length = 443

 Score = 23.9 bits (52), Expect = 7.4
 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 20  GGTGF-MGKLLIDKLLRSFPD 39
           GGTG  +G LL+++L   +P 
Sbjct: 141 GGTGSGLGSLLLERLREEYPK 161


>gnl|CDD|179820 PRK04313, PRK04313, 30S ribosomal protein S4e; Validated.
          Length = 237

 Score = 23.6 bits (52), Expect = 8.7
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 15/48 (31%)

Query: 13  DGQILVTG--------GTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKG 52
           +G++LV G          G M     D +  S P+ G  Y ++ D+KG
Sbjct: 63  EGKVLVDGRVRKDYKFPVGLM-----DVI--SIPETGEYYRVLPDEKG 103


>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase;
          Provisional.
          Length = 266

 Score = 23.8 bits (52), Expect = 9.0
 Identities = 14/65 (21%), Positives = 26/65 (40%), Gaps = 19/65 (29%)

Query: 16 ILVTGGTGFMGKLLIDKLLRSFPDIGAIYIMVRDKKGSSPE--------------ERVKN 61
          I+VTGG+  +G  ++ +LL +    GA  +   D  G   +              E V +
Sbjct: 12 IIVTGGSSGIGLAIVKELLAN----GANVVNA-DIHGGDGQHENYQFVPTDVSSAEEVNH 66

Query: 62 MLNSV 66
           +  +
Sbjct: 67 TVAEI 71


>gnl|CDD|213512 TIGR00174, miaA, tRNA dimethylallyltransferase.  Alternate names
           include delta(2)-isopentenylpyrophosphate transferase,
           IPP transferase, 2-methylthio-N6-isopentyladenosine tRNA
           modification enzyme. Catalyzes the first step in the
           modification of an adenosine near the anticodon to
           2-methylthio-N6-isopentyladenosine. Understanding of
           substrate specificity has changed [Protein synthesis,
           tRNA and rRNA base modification].
          Length = 287

 Score = 23.9 bits (52), Expect = 9.1
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 2   QEEQKVDDFYRDGQI-LVTGGTGFMGKLLIDKL 33
           Q    + D    G+I L+ GGTG   K L++ L
Sbjct: 76  QALNAIADITARGKIPLLVGGTGLYLKALLEGL 108


>gnl|CDD|216659 pfam01715, IPPT, IPP transferase.  This is a family of IPP
          transferases EC:2.5.1.8 also known as tRNA
          delta(2)-isopentenylpyrophosphate transferase. These
          enzymes modify both cytoplasmic and mitochondrial tRNAs
          at A(37) to give isopentenyl A(37).
          Length = 253

 Score = 23.4 bits (51), Expect = 9.9
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 4  EQKVDDFYRDGQI-LVTGGTGFMGKLLIDKL 33
           + + +    G+I L+ GGTG   K L+D L
Sbjct: 46 LEAIAEIRARGKIPLLVGGTGLYFKALLDGL 76


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.319    0.140    0.391 

Gapped
Lambda     K      H
   0.267   0.0728    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,573,736
Number of extensions: 276046
Number of successful extensions: 513
Number of sequences better than 10.0: 1
Number of HSP's gapped: 511
Number of HSP's successfully gapped: 112
Length of query: 67
Length of database: 10,937,602
Length adjustment: 38
Effective length of query: 29
Effective length of database: 9,252,150
Effective search space: 268312350
Effective search space used: 268312350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.2 bits)