Diaphorina citri psyllid: psy17493


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MEIQINTKSKYIEVPNFVSSMPQVSRERGEQLAIEYGIKFMETSAKNSINVEDAFFTLARDIKAQTEKKLEASNPPKGGIHVKSSEPNRKPPSWLSKCSIL
cEEEEccccccccccccccccccccHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEECc
MEIQINTKSKYIEVPNFVSSMPQVSRERGEQLAIEYGIKFMETSAKNSINVEDAFFTLARDI***********************************C***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIQINTKSKYIEVPNFVSSMPQVSRERGEQLAIEYGIKFMETSAKNSINVEDAFFTLARDIKAQTEKKLEASNPPKGGIHVKSSEPNRKPPSWLSKCSIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein Rab-8A May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.confidentP61007
Ras-related protein Rab-8A May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.confidentP61006
Ras-related protein Rab-8A May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization.confidentQ5R4A3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006904 [BP]vesicle docking involved in exocytosisprobableGO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0022406, GO:0048278, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009893 [BP]positive regulation of metabolic processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0032880 [BP]regulation of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0031346 [BP]positive regulation of cell projection organizationprobableGO:0051130, GO:0051128, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0031344, GO:0048522
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045046 [BP]protein import into peroxisome membraneprobableGO:0033036, GO:0008104, GO:0015919, GO:0072663, GO:0072662, GO:0006612, GO:0051641, GO:0044699, GO:0071806, GO:0070727, GO:0006886, GO:0016043, GO:0051179, GO:0065002, GO:0071840, GO:0006810, GO:0072594, GO:0043574, GO:0034613, GO:0006625, GO:0017038, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0055085, GO:0044743, GO:0016482, GO:0006996, GO:0007031, GO:0071702, GO:0046907, GO:0015031, GO:0044763, GO:0009987
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0034332 [BP]adherens junction organizationprobableGO:0034330, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0008150, GO:0044699
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005932 [CC]microtubule basal bodyprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0051286 [CC]cell tipprobableGO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0051461 [BP]positive regulation of corticotropin secretionprobableGO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0051459, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0044057, GO:0065007, GO:0048518, GO:0051050, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0051239, GO:0046887, GO:0032879, GO:0044060, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0042384 [BP]cilium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0048210 [BP]Golgi vesicle fusion to target membraneprobableGO:0006906, GO:0061025, GO:0061024, GO:0006944, GO:0044699, GO:0016044, GO:0016043, GO:0071840, GO:0009987, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006996, GO:0016192, GO:0046907, GO:0016050, GO:0048284, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FU5, chain C
Confidence level:very confident
Coverage over the Query: 7-68
View the alignment between query and template
View the model in PyMOL
Template: 3BBP, chain A
Confidence level:confident
Coverage over the Query: 23-62
View the alignment between query and template
View the model in PyMOL