RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17504
         (196 letters)



>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9
          family.  The second LIM domain of Lhx2 and Lhx9 family:
          Lhx2 and Lhx9 are highly homologous LHX regulatory
          proteins. They belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Although Lhx2 and Lhx9 are highly homologous, they
          seems to play regulatory roles in different organs.  In
          animals, Lhx2 plays important roles in eye, cerebral
          cortex, limb, the olfactory organs, and erythrocyte
          development. Lhx2 gene knockout mice exhibit impaired
          patterning of the cortical hem and the telencephalon of
          the developing brain, and a lack of development in
          olfactory structures. Lhx9 is expressed in several
          regions of the developing mouse brain, the spinal cord,
          the pancreas, in limb mesenchyme, and in the urogenital
          region. Lhx9 plays critical roles in gonad development.
           Homozygous mice lacking functional Lhx9 alleles
          exhibit numerous urogenital defects, such as gonadal
          agenesis, infertility, and undetectable levels of
          testosterone and estradiol coupled with high FSH
          levels. Lhx9 null mice are phenotypically female, even
          those that are genotypically male. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 59

 Score =  106 bits (266), Expect = 1e-30
 Identities = 37/50 (74%), Positives = 43/50 (86%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +GIS+SELVMRARDLVFHL+CFTC +C   LTKGD FGMRD ++YCR HY
Sbjct: 10 LGISASELVMRARDLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCRLHY 59


>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2.  The second
          LIM domain of Lhx2: Lhx2 belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          In animals, Lhx2 plays important roles in eye, cerebral
          cortex, limb, the olfactory organs, and erythrocyte
          development. Lhx2 gene knockout mice exhibit impaired
          patterning of the cortical hem and the telencephalon of
          the developing brain, and a lack of development in
          olfactory structures. The Lhx2 protein has been shown
          to bind to the mouse M71 olfactory receptor promoter.
          Similar to other LIM domains, this domain family is
          50-60 amino acids in size and shares two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 59

 Score = 80.1 bits (197), Expect = 2e-20
 Identities = 32/50 (64%), Positives = 43/50 (86%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +GIS+SE+VMRARDLV+HL+CFTC +C  +LT GD FGM+D ++YCR H+
Sbjct: 10 LGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDNLVYCRLHF 59


>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9.  The second
          LIM domain of Lhx9: Lhx9 belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx9 is highly homologous to Lhx2. It is expressed in
          several regions of the developing mouse brain, the
          spinal cord, the pancreas, in limb mesenchyme, and in
          the urogenital region. Lhx9 plays critical roles in
          gonad development.  Homozygous mice lacking functional
          Lhx9 alleles exhibit numerous urogenital defects, such
          as gonadal agenesis, infertility, and undetectable
          levels of testosterone and estradiol coupled with high
          FSH levels. Lhx9 null mice have reduced levels of the
          Sf1 nuclear receptor that is required for
          gonadogenesis, and recent studies have shown that Lhx9
          is able to activate the Sf1/FtzF1 gene. Lhx9 null mice
          are phenotypically female, even those that are
          genotypically male.  As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 59

 Score = 75.1 bits (184), Expect = 2e-18
 Identities = 30/50 (60%), Positives = 40/50 (80%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +GIS+SE+VMRAR+ V+HL CFTC +C   LT GD FGM+D ++YCR H+
Sbjct: 10 LGISASEMVMRARESVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRAHF 59


>gnl|CDD|215907 pfam00412, LIM, LIM domain.  This family represents two copies of
          the LIM structural domain.
          Length = 58

 Score = 63.9 bits (156), Expect = 4e-14
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 2  GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILR 54
           I   ELV RA   V+H  CF C  CG  L  GD F  +D  +YC+  Y  L 
Sbjct: 7  PIYDRELVRRALGKVWHPECFRCAVCGKPLGPGDFF-EKDGKLYCKHDYFKLF 58


>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and
          Lmx1b.  The second LIM domain of Lmx1a and Lmx1b: Lmx1a
          and Lmx1b belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs such as the pituitary gland and the pancreas.
          Mouse Lmx1a is expressed in multiple tissues, including
          the roof plate of the neural tube, the developing
          brain, the otic vesicles, the notochord, and the
          pancreas. In mouse, mutations in Lmx1a result in
          failure of the roof plate to develop.  Lmx1a may act
          upstream of other roof plate markers such as MafB,
          Gdf7, Bmp6, and Bmp7. Further characterization of these
          mice reveals numerous defects including disorganized
          cerebellum, hippocampus, and cortex; altered
          pigmentation; female sterility, skeletal defects, and
          behavioral abnormalities.  In the mouse, Lmx1b
          functions in the developing limbs and eyes, the
          kidneys, the brain, and in cranial mesenchyme. The
          disruption of Lmx1b gene results kidney and limb
          defects. In the brain, Lmx1b is important for
          generation of mesencephalic dopamine neurons and the
          differentiation of serotonergic neurons. In the mouse
          eye, Lmx1b regulates anterior segment (cornea, iris,
          ciliary body, trabecular meshwork, and lens)
          development. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 55

 Score = 61.3 bits (149), Expect = 3e-13
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          I+ SELVMRA + V+HL CF C  C   L KGD F +++  + C+  Y
Sbjct: 8  IAPSELVMRALENVYHLRCFCCCVCERQLQKGDEFVLKEGQLLCKSDY 55


>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH).  The
          second LIM domain of Arrowhead (AWH): Arrowhead belongs
          to the LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Members of LHX family are found in the
          nucleus and act as transcription factors or cofactors.
          LHX proteins are critical for the development of
          specialized cells in multiple tissue types, including
          the nervous system, skeletal muscle, the heart, the
          kidneys, and endocrine organs such as the pituitary
          gland and the pancreas. During embryogenesis of
          Drosophila, Arrowhead is expressed in each abdominal
          segment and in the labial segment. Late in embryonic
          development, expression of arrowhead is refined to the
          abdominal histoblasts and salivary gland imaginal ring
          cells themselves. The Arrowhead gene required for
          establishment of a subset of imaginal tissues: the
          abdominal histoblasts and the salivary gland imaginal
          rings. As in other LIM domains, this domain family is
          50-60 amino acids in size and shares two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 55

 Score = 59.7 bits (145), Expect = 1e-12
 Identities = 21/49 (42%), Positives = 32/49 (65%)

Query: 2  GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
           IS+S+ V RARD V+HL CF C +C   L+ G+ F + ++ + C+ HY
Sbjct: 7  NISASDWVRRARDHVYHLACFACDACKRQLSTGEEFALIEDRVLCKAHY 55


>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain. 
          Length = 57

 Score = 59.4 bits (145), Expect = 1e-12
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 151 KRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN 196
           +R RT+F   QL  ++  F  N+ P A++ ++LA+K GL++R ++ 
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKV 46


>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1,
          Mec-3.  Zinc-binding domain family. Some LIM domains
          bind protein partners via tyrosine-containing motifs.
          LIM domains are found in many key regulators of
          developmental pathways.
          Length = 54

 Score = 59.3 bits (144), Expect = 2e-12
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 2  GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPH 49
           I  +E V+RA   V+H  CF C +CG  L+ GD F  +D  +YC+  
Sbjct: 8  PIYGTERVLRALGKVWHPECFKCATCGKPLS-GDTFFEKDGKLYCKDC 54


>gnl|CDD|197696 smart00389, HOX, Homeodomain.  DNA-binding factors that are
           involved in the transcriptional regulation of key
           developmental processes.
          Length = 57

 Score = 58.8 bits (143), Expect = 3e-12
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 150 TKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN 196
            +R RTSF   QL  ++  F  N  P  ++ ++LA+K GLS+R ++ 
Sbjct: 1   KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKV 47


>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2.  The second
          LIM domain of Isl2: Isl is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain. LHX
          proteins are critical for the development of
          specialized cells in multiple tissue types, including
          the nervous system, skeletal muscle, the heart, the
          kidneys, and endocrine organs, such as the pituitary
          gland and the pancreas. Isl proteins are found in the
          nucleus and act as transcription factors or cofactors.
          Isl1 and Isl2 are the two conserved members of this
          family. Mouse Isl2 is expressed in the retinal ganglion
          cells and the developing spinal cord where it plays a
          role in motor neuron development. Isl2 may be able to
          bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 58.8 bits (142), Expect = 3e-12
 Identities = 24/47 (51%), Positives = 31/47 (65%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCR 47
          +G SSS+LVMRARD V+H+ CF C  C   L  GD F +R+  + CR
Sbjct: 6  LGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFCLREHELLCR 52


>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also
          known as Lim1) and Lhx5.  The second LIM domain of Lhx1
          (also known as Lim1) and Lhx5. Lhx1 and Lhx5 are
          closely related members of LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx1 is required for regulating the vertebrate head
          organizer, the nervous system, and female reproductive
          tract development. During embryogenesis in the mouse,
          Lhx1 is expressed early in mesodermal tissue, then
          later during urogenital, kidney, liver, and nervous
          system development. In the adult, expression is
          restricted to the kidney and brain. A mouse embryos
          with Lhx1 gene knockout cannot grow normal anterior
          head structures, kidneys, and gonads, but with normally
          developed trunk and tail morphology. In the developing
          nervous system, Lhx1 is required to direct the
          trajectories of motor axons in the limb. Lhx1 null
          female mice lack the oviducts and uterus.  Lhx5 protein
          may play complementary or overlapping roles with Lhx1.
          The expression of Lhx5 in the anterior portion of the
          mouse neural tube suggests a role in patterning of the
          forebrain. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 56

 Score = 56.6 bits (137), Expect = 2e-11
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGD-LFGMRDEMIYCRPHY 50
           GIS ++LV RARD VFHL+CFTC+ C   L+ G+ L+ + +    C+  Y
Sbjct: 6  QGISPNDLVRRARDKVFHLNCFTCMVCRKQLSTGEELYILDENKFICKEDY 56


>gnl|CDD|238039 cd00086, homeodomain, Homeodomain;  DNA binding domains involved in
           the transcriptional regulation of key eukaryotic
           developmental processes; may bind to DNA as monomers or
           as homo- and/or heterodimers, in a sequence-specific
           manner.
          Length = 59

 Score = 56.9 bits (138), Expect = 2e-11
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 151 KRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQN 196
           +R RT F   QL  ++  F  N  P  ++ ++LA++ GL++R ++ 
Sbjct: 1   RRKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKI 46


>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain
          only protein 4).  The second LIM domain of LMO4 (LIM
          domain only protein 4): LMO4 is a nuclear protein that
          plays important roles in transcriptional regulation and
          development. LMO4 is involved in various functions in
          tumorigenesis and cellular differentiation. LMO4
          proteins regulate gene expression by interacting with a
          wide variety of transcription factors and cofactors to
          form large transcription complexes. It can interact
          with Smad proteins, and associate with the promoter of
          the PAI-1 (plasminogen activator inhibitor-1) gene in a
          TGFbeta (transforming growth factor beta)-dependent
          manner. LMO4 can also form a complex with transcription
          regulator CREB (cAMP response element-binding protein)
          and interact with CLIM1 and CLIM2. In breast tissue,
          LMO4 interacts with multiple proteins, including the
          cofactor CtIP [CtBP (C-terminal binding
          protein)-interacting protein], the breast and ovarian
          tumor suppressor BRCA1 (breast-cancer susceptibility
          gene 1) and the LIM-domain-binding protein LDB1.
          Functionally, LMO4 is shown to repress BRCA1-mediated
          transcription activation, thus invoking a potential
          role for LMO4 as a negative regulator of BRCA1 in
          sporadic breast cancer.  LMO4 also forms complex to
          both ERa (oestrogen receptor alpha), MTA1 (metastasis
          tumor antigen 1), and HDACs (histone deacetylases),
          implying that LMO4 is also a component of the MTA1
          corepressor complex. Over-expressed LMO4 represses ERa
          transactivation functions in an HDAC-dependent manner,
          and contributes to the process of breast cancer
          progression by allowing the development of Era-negative
          phenotypes. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 56.0 bits (135), Expect = 3e-11
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          I +SELVMRA+  V+HL CFTC +C   L  GD F   +  ++C
Sbjct: 8  IPASELVMRAQGNVYHLKCFTCSTCHNQLVPGDRFHYVNGSLFC 51


>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX
          protein family.  The second LIM domain of Isl: Isl is a
          member of LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Isl1 and Isl2 are the two conserved
          members of this family. Proteins in this group are
          found in the nucleus and act as transcription factors
          or cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Isl-1 is one of
          the LHX proteins isolated originally by virtue of its
          ability to bind DNA sequences from the 5'-flanking
          region of the rat insulin gene in pancreatic
          insulin-producing cells. Mice deficient in Isl-1 fail
          to form the dorsal exocrine pancreas and islet cells
          fail to differentiate. On the other hand, Isl-1 takes
          part in the pituitary development by activating the
          gonadotropin-releasing hormone receptor gene together
          with LHX3 and steroidogenic factor 1. Mouse Isl2 is
          expressed in the retinal ganglion cells and the
          developing spinal cord where it plays a role in motor
          neuron development. Same as Isl1, Isl2 may also be able
          to bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 55.5 bits (134), Expect = 4e-11
 Identities = 18/46 (39%), Positives = 29/46 (63%)

Query: 2  GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCR 47
            S ++ VMRAR  ++H+ CF C +C   L  GD F +RD+ ++C+
Sbjct: 7  SFSKNDFVMRARTKIYHIECFRCSACSRQLIPGDEFALRDDGLFCK 52


>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain,
          containing two zinc fingers.  LIM domains are
          identified in a diverse group of proteins with wide
          variety of biological functions, including gene
          expression regulation, cell fate determination,
          cytoskeleton organization, tumor formation and
          development. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes. They perform their functions through
          interactions with other protein partners. LIM domains
          are 50-60 amino acids in size and share two
          characteristic highly conserved zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. The consensus sequence of LIM
          domain has been defined as
          C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
          21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 53

 Score = 55.0 bits (133), Expect = 7e-11
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          ++RA    +H  CF C  CG  L     F  +D   YC   Y
Sbjct: 13 LLRALGKKWHPECFKCSVCGKPLGGDS-FYEKDGKPYCEKCY 53


>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b.  The second
          LIM domain of Lhx3b. Lhx3b is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx3b is one of the two isoforms of Lhx3. The Lhx3 gene
          is expressed in the ventral spinal cord, the pons, the
          medulla oblongata, and the pineal gland of the
          developing nervous system during mouse embryogenesis,
          and transcripts are found in the emergent pituitary
          gland. Lhx3 functions in concert with other
          transcription factors to specify interneuron and motor
          neuron fates during development. Lhx3 proteins have
          been demonstrated to directly bind to the promoters of
          several pituitary hormone gene promoters. The Lhx3 gene
          encodes two isoforms, LHX3a and LHX3b that differ in
          their amino-terminal sequences, where Lhx3a has longer
          N-terminal.  They show differential activation of
          pituitary hormone genes and distinct DNA binding
          properties. In human, Lhx3a trans-activated the
          alpha-glycoprotein subunit promoter and genes
          containing a high-affinity Lhx3 binding site more
          effectively than the hLhx3b isoform. In addition,
          hLhx3a induce transcription of the TSHbeta-subunit gene
          by acting on pituitary POU domain factor, Pit-1, while
          hLhx3b does not.  As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 57

 Score = 51.6 bits (123), Expect = 2e-09
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFG-MRDEMIYCRPHY 50
           GI  +++V RA+D V+HLHCF CI C   L  GD F  M D  + C+  Y
Sbjct: 7  QGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEFYLMEDSRLVCKADY 57


>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4
          family.  The second LIM domain of Lhx3-Lhx4 family:
          Lhx3 and Lhx4 belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          The LHX3 and LHX4 LIM-homeodomain transcription factors
          play essential roles in pituitary gland and nervous
          system development. Although LHX3 and LHX4 share marked
          sequence homology, the genes have different expression
          patterns. They play overlapping, but distinct functions
          during the establishment of the specialized cells of
          the mammalian pituitary gland and the nervous system.
          Lhx3 proteins have been demonstrated the ability to
          directly bind to the promoters/enhancers of several
          pituitary hormone gene promoters to cause increased
          transcription.Lhx3a and Lhx3b, whose mRNAs have
          distinct temporal expression profiles during
          development, are two isoforms of Lhx3. LHX4 plays
          essential roles in pituitary gland and nervous system
          development. In mice, the lhx4 gene is expressed in the
          developing hindbrain, cerebral cortex, pituitary gland,
          and spinal cord. LHX4 shows significant sequence
          similarity to LHX3, particularly to isoforms Lhx3a. In
          gene regulation experiments, the LHX4 protein exhibits
          regulation roles towards pituitary genes, acting on
          their promoters/enhancers. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 56

 Score = 51.2 bits (123), Expect = 2e-09
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFG-MRDEMIYCRPHY 50
           GI  +++V RA+D V+HL CF C  C   L  GD F  M D+ + C+  Y
Sbjct: 6  EGIPPTQVVRRAQDNVYHLECFACFMCKRQLETGDEFYLMEDDRLVCKKDY 56


>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6.  The second
          LIM domain of Lhx6. Lhx6 is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs such as the pituitary gland and the pancreas.
          Lhx6 functions in brain and nervous system.  It is
          expressed at high levels in several regions of the
          embryonic mouse CNS, including the telencephalon and
          hypothalamus, and the first branchial arch. Lhx6 is
          proposed to have a role in patterning of the mandible
          and maxilla, and in signaling during odontogenesis. In
          brain sections, knockdown of Lhx6 gene blocks the
          normal migration of neurons to the cortex. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 50.9 bits (121), Expect = 3e-09
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          I +S+ V RAR   +HL CF C SC   L+ G+ FG+ +E + CR HY
Sbjct: 8  IYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHY 55


>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3
          (LIM domain only protein 1 and 3).  The second LIM
          domain of LMO1 and LMO3 (LIM domain only protein 1 and
          3): LMO1 and LMO3 are highly homologous and belong to
          the LMO protein family. LMO1 and LMO3 are nuclear
          protein that plays important roles in transcriptional
          regulation and development. As LIM domains lack
          intrinsic DNA-binding activity, nuclear LMOs are
          involved in transcriptional regulation by forming
          complexes with other transcription factors or
          cofactors. For example, LMO1 interacts with the the
          bHLH domain of  bHLH transcription factor, TAL1 (T-cell
          acute leukemia1)/SCL (stem cell leukemia) . LMO1
          inhibits the expression of TAL1/SCL target genes.  LMO3
          facilitates p53 binding to its response elements, which
          suggests that LMO3 acts as a co-repressor of p53,
          suppressing p53-dependent transcriptional regulation.
          In addition, LMO3 interacts with neuronal transcription
          factor, HEN2, and acts as an oncogene in neuroblastoma.
          Another binding partner of LMO3 is calcium- and
          integrin-binding protein CIB, which binds via the
          second LIM domain (LIM2) of LMO3. One role of the
          CIB/LMO3 complex is to inhibit cell proliferation.
          Although LMO1 and LMO3 are highly homologous proteins,
          they play different roles in the regulation of the
          pituitary glycoprotein hormone alpha-subunit (alpha
          GSU) gene. Alpha GSU promoter activity was markedly
          repressed by LMO1 but activated by LMO3. All LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 50.4 bits (120), Expect = 4e-09
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          I + E+VMRA+D V+HL CF C  C      GD F +++ MI C+  Y
Sbjct: 8  IPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDY 55


>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8. 
          The second LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
          belong to the LHX protein family, which features two
          tandem N-terminal LIM domains and a C-terminal DNA
          binding homeodomain. Members of LHX family are found in
          the nucleus and act as transcription factors or
          cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs such as
          the pituitary gland and the pancreas.  Studies using
          mutant mice have revealed roles for Lhx7 and Lhx8 in
          the development of cholinergic neurons in the
          telencephalon and in basal forebrain development. Mice
          lacking alleles of the LIM-homeobox gene Lhx7 or Lhx8
          display dramatically reduced number of forebrain
          cholinergic neurons. In addition, Lhx7 mutation affects
          male and female mice differently, with females
          appearing more affected than males. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 55

 Score = 49.7 bits (118), Expect = 7e-09
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          I S++ V RA+  V+HL CF C SC   L+ G+ F + +E + CR HY
Sbjct: 8  IHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHY 55


>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4.  The second
          LIM domain of Lhx4. Lhx4 belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          LHX4 plays essential roles in pituitary gland and
          nervous system development. In mice, the lhx4 gene is
          expressed in the developing hindbrain, cerebral cortex,
          pituitary gland, and spinal cord. LHX4 shows
          significant sequence similarity to LHX3, particularly
          to isoforms Lhx3a. In gene regulation experiments, the
          LHX4 protein exhibits regulation roles towards
          pituitary genes, acting on their promoters/enhancers.
          As in other LIM domains, this domain family is 50-60
          amino acids in size and shares two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 56

 Score = 49.2 bits (117), Expect = 1e-08
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 2  GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFG-MRDEMIYCRPHY 50
          GI  +++V +A+D V+HLHCF CI C   L  GD F  M D  + C+  Y
Sbjct: 7  GIPPTQVVRKAQDFVYHLHCFACIICSRQLATGDEFYLMEDGRLVCKEDY 56


>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx).  The
          second LIM domain of dLMO (Beaderx): dLMO is a nuclear
          protein that plays important roles in transcriptional
          regulation and development. In Drosophila dLMO
          modulates the activity of LIM-homeodomain protein
          Apterous (Ap), which regulates the formation of the
          dorsal-ventral axis of the Drosophila wing. Biochemical
          analysis shows that dLMO protein influences the
          activity of Apterous by binding of its cofactor Chip.
          Further studies shown that dLMO proteins might function
          in an evolutionarily conserved mechanism involved in
          patterning the appendages. All LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 55

 Score = 46.8 bits (111), Expect = 1e-07
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          I + E+VMRAR  V+HL CF C  C      GD F + +  I C   Y
Sbjct: 8  IPAFEMVMRARTNVYHLECFACQRCNHRFCVGDRFYLCENKILCEYDY 55


>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM
          (abLIM) proteins.  The first LIM domain of actin
          binding LIM (abLIM) proteins:  Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 41.1 bits (97), Expect = 1e-05
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          V+R +D  FH+ CFTC  CG  L +G  F +++   YC   Y
Sbjct: 12 VLRVQDKYFHIKCFTCKVCGCDLAQGGFF-VKEGEYYCTDDY 52


>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain
          only protein 2).  The second LIM domain of LMO2 (LIM
          domain only protein 2): LMO2 is a nuclear protein that 
          plays important roles in transcriptional regulation and
          development. The two tandem LIM domains of LMO2 support
          the assembly of a crucial cell-regulatory complex by
          interacting with both the TAL1-E47 and GATA1
          transcription factors to form a DNA-binding complex
          that is capable of transcriptional activation. LMOs
          have also been shown to be involved in oncogenesis.
          LMO1 and LMO2 are activated in T-cell acute
          lymphoblastic leukemia by distinct chromosomal
          translocations. LMO2 was also shown to be involved in
          erythropoiesis and is required for the hematopoiesis in
          the adult animals. All LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 40.0 bits (93), Expect = 3e-05
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 3  ISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          I + E+ MR +D V+HL CF C +C      GD + + +  I C
Sbjct: 8  IRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVC 51


>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid
          receptor-interacting protein 6 (TRIP6).  The first LIM
          domain of Thyroid receptor-interacting protein 6
          (TRIP6): TRIP6 is a member of the zyxin LIM protein
          family and contains three LIM zinc-binding domains at
          the C-terminal. TRIP6 protein localizes to focal
          adhesion sites and along actin stress fibers.
          Recruitment of this protein to the plasma membrane
          occurs in a lysophosphatidic acid (LPA)-dependent
          manner. TRIP6 recruits a number of molecules involved
          in actin assembly, cell motility, survival and
          transcriptional control. The function of TRIP6 in cell
          motility is regulated by Src-dependent phosphorylation
          at a Tyr residue. The phosphorylation activates the
          coupling to the Crk SH2 domain, which is required for
          the function of TRIP6 in promoting lysophosphatidic
          acid (LPA)-induced cell migration. TRIP6 can shuttle to
          the nucleus to serve as a coactivator of AP-1 and
          NF-kappaB transcriptional factors. Moreover, TRIP6 can
          form a ternary complex with the NHERF2 PDZ protein and
          LPA2 receptor to regulate LPA-induced activation of ERK
          and AKT, rendering cells resistant to chemotherapy.
          Recent evidence shows that TRIP6 antagonizes
          Fas-Induced apoptosis by enhancing the antiapoptotic
          effect of LPA in cells. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 54

 Score = 38.5 bits (90), Expect = 9e-05
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A D VFH+ CFTC++C   L +G  F   ++  YC P Y
Sbjct: 17 AMDQVFHVDCFTCMTCNGKL-RGQPFYAVEKKAYCEPCY 54


>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL.  The LIM domain of RIL:
          RIL contains an N-terminal PDZ domain, a LIM domain,
          and a short consensus C-terminal region. It is the
          smallest molecule in the ALP LIM domain containing
          protein family. RIL was identified in rat fibroblasts
          and in human lymphocytes. The LIM domain interacts with
          the AMPA glutamate receptor in dendritic spines. The
          consensus C-terminus interacts with PTP-BL, a
          submembranous protein tyrosine phosphatase and the PDZ
          domain is responsible to interact with alpha-actinin
          molecules. LIM domains are 50-60 amino acids in size
          and share two characteristic zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 38.4 bits (89), Expect = 9e-05
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPH 49
          +++ARD ++H  CF C  CG+ L +   F + DE +YC  H
Sbjct: 12 IVKARDKLYHPECFMCDDCGLNLKQRGYFFI-DEQLYCETH 51


>gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain
          Kinase ).  The second LIM domain of LIMK (LIM domain
          Kinase ): LIMK protein family is  comprised of two
          members LIMK1 and LIMK2. LIMK contains two LIM domains,
          a PDZ domain and a kinase domain. LIMK is involved in
          the regulation of actin polymerization and microtubule
          disassembly. LIMK influences architecture of the actin
          cytoskeleton by regulating the activity of the cofilin
          family proteins cofilin1, cofilin2, and destrin. The
          mechanism of the activation is to phosphorylates
          cofilin on serine 3 and inactivates its actin-severing
          activity, and altering the rate of actin
          depolymerization. LIMKs can function in both cytoplasm
          and nucleus and are expressed in all tissues. Both
          LIMK1 and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. However,
          LIMK1 and LIMk2 have different cellular locations.
          While LIMK1 localizes mainly at focal adhesions, LIMK2
          is found in cytoplasmic punctae, suggesting that they
          may have different cellular functions. The LIM domains
          of LIMK have been shown to play an important role in
          regulating kinase activity and likely also contribute
          to LIMK function by acting as sites of
          protein-to-protein interactions. All LIM domains are
          50-60 amino acids in size and share two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 37.7 bits (88), Expect = 2e-04
 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 12/53 (22%)

Query: 8  LVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDYCG 60
           VM A D  FH  CF+C SC   +  GD + +            + R + YCG
Sbjct: 11 PVMVAGDHKFHPECFSCSSCKAFIGDGDSYAL------------VERSKLYCG 51


>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule
          interacting with CasL) like family.  The LIM domain of
          Mical (molecule interacting with CasL) like family:
          Known members of this family includes  LIM domain
          containing proteins; Mical (molecule interacting with
          CasL), pollen specific protein SF3, Eplin, xin
          actin-binding repeat-containing protein 2 (XIRP2) and
          Ltd-1. The members of this family function mainly at
          the cytoskeleton and focal adhesions. They interact
          with transcription factors or other signaling molecules
          to play roles in muscle development, neuronal
          differentiation, cell growth and mobility.  Eplin has
          also found to be tumor suppressor. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs..
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 36.5 bits (85), Expect = 5e-04
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 16 VFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +FH  CF C  C   L  G+   +  + +YC+PH+
Sbjct: 20 LFHKSCFRCSHCNKTLRLGNYASLEGK-LYCKPHF 53


>gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain
          Kinase 1).  The second LIM domain of LIMK1 (LIM domain
          Kinase 1): LIMK1 belongs to the LIMK protein family,
          which comprises LIMK1 and LIMK2. LIMK contains two LIM
          domains, a PDZ domain, and a kinase domain. LIMK is
          involved in the regulation of actin polymerization and
          microtubule disassembly. LIMK influences architecture
          of the actin cytoskeleton by regulating the activity of
          the cofilin family proteins cofilin1, cofilin2, and
          destrin. The mechanism of the activation is to
          phosphorylates cofilin on serine 3 and inactivates its
          actin-severing activity, and altering the rate of actin
          depolymerization. LIMKs can function in both cytoplasm
          and nucleus. Both LIMK1 and LIMK2 can act in the
          nucleus to suppress Rac/Cdc42-dependent cyclin D1
          expression. LIMK1 is expressed in all tissues and is
          localized to focal adhesions in the cell. LIMK1 can
          form homodimers upon binding of HSP90 and is activated
          by Rho effector Rho kinase and MAPKAPK2. LIMK1 is
          important for normal central nervous system
          development, and its deletion has been implicated in
          the development of the human genetic disorder Williams
          syndrome. Moreover, LIMK1 up-regulates the promoter
          activity of urokinase type plasminogen activator and
          induces its mRNA and protein expression in breast
          cancer cells. The LIM domains have been shown to play
          an important role in regulating kinase activity and
          likely also contribute to LIMK function by acting as
          sites of protein-to-protein interactions. All LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 36.4 bits (84), Expect = 6e-04
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 5  SSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEM-IYC 46
          ++ LVM A +  +H  CF+C+ CG  +  GD + + +   +YC
Sbjct: 9  TTGLVMVAGEQKYHPECFSCLRCGAFIGDGDTYALVEHSKLYC 51


>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX
          protein family.  The first LIM domain of Isl: Isl is a
          member of LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Isl1 and Isl2 are the two conserved
          members of this family. Proteins in this group are
          found in the nucleus and act as transcription factors
          or cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Isl-1 is one of
          the LHX proteins isolated originally by virtue of its
          ability to bind DNA sequences from the 5'-flanking
          region of the rat insulin gene in pancreatic
          insulin-producing cells. Mice deficient in Isl-1 fail
          to form the dorsal exocrine pancreas and islet cells
          fail to differentiate. On the other hand, Isl-1 takes
          part in the pituitary development by activating the
          gonadotropin-releasing hormone receptor gene together
          with LHX3 and steroidogenic factor 1. Mouse Is l2 is
          expressed in the retinal ganglion cells and the
          developing spinal cord where it plays a role in motor
          neuron development. Same as Isl1, Isl2 may also be able
          to bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 35.8 bits (83), Expect = 0.001
 Identities = 14/39 (35%), Positives = 18/39 (46%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A DL +H  C  C  CG  L +     +RD   YC+  Y
Sbjct: 17 APDLEWHAACLKCAECGQYLDETCTCFVRDGKTYCKRDY 55


>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of
          proteins with unknown function.  This model represents
          a LIM domain subfamily of Eplin-like family.  This
          family shows highest homology to the LIM domains on
          Eplin and XIRP2 protein families. Epithelial Protein
          Lost in Neoplasm is a cytoskeleton-associated tumor
          suppressor whose expression inversely correlates with
          cell growth, motility, invasion and cancer mortality.
          Xirp2 is expressed in muscles and is an important
          effector of the Ang II signaling pathway in the heart.
          As in other LIM domains, this domain family is 50-60
          amino acids in size and shares two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 53

 Score = 35.3 bits (81), Expect = 0.001
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A  LVFH  CF C  C   L+ G    +  E  YC+PH+
Sbjct: 16 ADKLVFHNSCFCCKHCNAKLSLGSYAALHGEF-YCKPHF 53


>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like
          family.  The second LIM domain of Enigma-like family:
          The Enigma LIM domain family is comprised of three
          members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
          These subfamily members contain a single PDZ domain at
          the N-terminus and three LIM domains at the C-terminus.
          Enigma was initially characterized in humans and is
          expressed in multiple tissues, such as skeletal muscle,
          heart, bone and brain. The third LIM domain
          specifically interacts with the insulin receptor and
          the second LIM domain interacts with the receptor
          tyrosine kinase Ret and the adaptor protein APS.  Thus
          Enigma is implicated in signal transduction processes,
          such as mitogenic activity, insulin related actin
          organization, and glucose metabolism. The second
          member, ENH protein, was first identified in rat brain.
           It has been shown that ENH interacts with protein
          kinase D1 (PKD1) via its LIM domains and forms a
          complex with PKD1 and the alpha1C subunit of cardiac
          L-type voltage-gated calcium channel in rat neonatal
          cardiomyocytes. The N-terminal PDZ domain interacts
          with alpha-actinin at the Z-line. ZASP/Cypher is
          required for maintenance of Z-line structure during
          muscle contraction, but not required for Z-line
          assembly. In heart, Cypher/ZASP plays a structural role
          through its interaction with cytoskeletal Z-line
          proteins. In addition, there is increasing evidence
          that Cypher/ZASP also performs signaling functions.
          Studies reveal that Cypher/ZASP interacts with and
          directs PKC to the Z-line, where PKC phosphorylates
          downstream signaling targets. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 35.5 bits (82), Expect = 0.001
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          VM A    +H+ CF C +C   +    LF M D   YC   Y
Sbjct: 12 VMHALKQTWHVSCFVCAACKQPI-GNSLFHMEDGEPYCEKDY 52


>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin.
           The first LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the Testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 58

 Score = 35.5 bits (82), Expect = 0.001
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 14 DLVFHLHCFTCISCGILLTKGDL-FGMRDEMIYCRPHY 50
           L++H  CF C +C  LL   DL + + D+ IYC  HY
Sbjct: 23 SLLWHPACFRCSTCEELLV--DLTYCVHDDQIYCERHY 58


>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The second LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 34.3 bits (79), Expect = 0.004
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H+  FTC  C  +    D +   +  IYC  HY
Sbjct: 20 YHVEHFTCSVCPTVFGPNDSYYEHEGKIYCHYHY 53


>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated
          LIM protein) family.  This family represents the LIM
          domain of ALP (actinin-associated LIM protein) family.
          Four proteins: ALP, CLP36, RIL, and Mystique have been
          classified into the ALP subfamily of LIM domain
          proteins. Each member of the subfamily contains an
          N-terminal PDZ domain and a C-terminal LIM domain.
          Functionally, these proteins bind to alpha-actinin
          through their PDZ domains and bind or other signaling
          molecules through their LIM domains. ALP proteins have
          been implicated in cardiac and skeletal muscle
          structure, function and disease, platelet, and
          epithelial cell motility. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 33.9 bits (78), Expect = 0.004
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPH 49
          V++ARD   H  CF C  CG+ L     F + DE +YC  H
Sbjct: 12 VVKARDKNRHPECFVCADCGLNLKNKGYFFIEDE-LYCETH 51


>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein
          (CRP) family.  The LIM domains of Cysteine Rich Protein
          (CRP) family: Cysteine-rich proteins (CRPs) are
          characterized by the presence of two LIM domains linked
          to a short glycine-rich repeats (GRRs). The known CRP
          family members include CRP1, CRP2, and CRP3/MLP. CRP1,
          CRP2 and CRP3 share a conserved nuclear targeting
          signal (K/R-K/R-Y-G-P-K), which supports the fact that
          these proteins function not only in the cytoplasm but
          also in the nucleus. CRPs control regulatory pathways
          during cellular differentiation, and involve in complex
          transcription control, and the organization as well as
          the arrangement of the myofibrillar/cytoskeletal
          network. CRP1, CRP2, and CRP3/MLP are involved in
          promoting protein assembly along the actin-based
          cytoskeleton. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 33.7 bits (78), Expect = 0.004
 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H  CFTC  C   L    L    D  IYC+  Y
Sbjct: 21 WHKSCFTCAVCNKRLDSTTL-AEHDGEIYCKSCY 53


>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function.
          The first Lim domain of a LIM domain containing
          protein: The functions of the proteins are unknown. The
          members of this family contain two copies of LIM
          domain. The LIM domain is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 58

 Score = 33.8 bits (78), Expect = 0.005
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H  CF C +CG          + D+  YC+ HY
Sbjct: 24 WHRECFVCTTCGCPFQFSVPCYVLDDKPYCQQHY 57


>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin.
           The third LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 33.7 bits (77), Expect = 0.005
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYE 51
          +GI S +L    +D  +H  CF C  C I L     FG + + IYC   Y+
Sbjct: 12 IGIDSKDL--SYKDKHWHEACFLCSKCKISLVDKP-FGSKADRIYCGNCYD 59


>gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP,
          actinin-associated LIM protein.  This family represents
          the LIM domain of ALP, actinin-associated LIM protein.
          ALP contains an N-terminal PDZ domain, a C-terminal LIM
          domain and an ALP-subfamily-specific 34-amino-acid
          motif termed ALP-like motif (AM), which contains a
          putative consensus protein kinase C (PKC)
          phosphorylation site and two alpha-helices. ALP
          proteins are found in heart and in skeletal muscle. ALP
          may act as a signaling molecule which is regulated by
          PKC-dependent signaling. ALP plays an essential role in
          the development of RV (right ventricle) chamber. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 33.7 bits (77), Expect = 0.006
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPH 49
          V++ARD   H  CF C  C + L +   F +  ++ YC  H
Sbjct: 12 VVKARDKYRHPECFVCSDCNLNLKQKGYFFVEGQL-YCEAH 51


>gnl|CDD|188849 cd09465, LIM2_LIMK2, The second LIM domain of LIMK2 (LIM domain
          Kinase 2).  The second LIM domain of LIMK2 (LIM domain
          Kinase 2): LIMK2 is a member of the LIMK protein
          family, which comprises LIMK1 and LIMK2. LIMK contains
          two LIM domains, a PDZ domain, and a kinase domain.
          LIMK is involved in the regulation of actin
          polymerization and microtubule disassembly. LIMK
          influences architecture of the actin cytoskeleton by
          regulating the activity of the cofilin family proteins
          cofilin1, cofilin2, and destrin. The mechanism of the
          activation is to phosphorylates cofilin on serine 3 and
          inactivates its actin-severing activity, altering the
          rate of actin depolymerisation. LIMK activity is
          activated by phosphorylation of a threonine residue
          within the activation loop of the kinase by
          p21-activated kinases 1 and 4 and by Rho kinase. LIMKs
          can function in both cytoplasm and nucleus. Both LIMK1
          and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. LIMK2 is
          expressed in all tissues. While LIMK1 localizes mainly
          at focal adhesions, LIMK2 is found in cytoplasmic
          punctae, suggesting that they may have different
          cellular functions. The activity of LIM kinase 2 to
          regulate cofilin phosphorylation is inhibited by the
          direct binding of Par-3. LIMK2 activation promotes cell
          cycle progression. The phenotype of Limk2 knockout mice
          shows a defect in spermatogenesis. The LIM domains have
          been shown to play an important role in regulating
          kinase activity and likely also contribute to LIMK
          function by acting as sites of protein-to-protein
          interactions. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 59

 Score = 33.8 bits (77), Expect = 0.006
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGM-RDEMIYC 46
           M A +  +H  CF C+SC +++  GD + + +   +YC
Sbjct: 17 AMVAGEYKYHPECFACMSCKVIIEDGDTYALVQHTTLYC 55


>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma.  The
          second LIM domain of Enigma: Enigma was initially
          characterized in humans as a protein containing three
          LIM domains at the C-terminus and a PDZ domain at
          N-terminus.  The third LIM domain specifically
          interacts with the insulin receptor and the second LIM
          domain interacts with the receptor tyrosine kinase Ret
          and the adaptor protein APS.  Thus Enigma is implicated
          in signal transduction processes, such as mitogenic
          activity, insulin related actin organization, and
          glucose metabolism. Enigma is expressed in multiple
          tissues, such as skeletal muscle, heart, bone and
          brain.  LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 52

 Score = 33.4 bits (76), Expect = 0.006
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +M A  + +H+HCFTC +C   + +   F M +   YC   Y
Sbjct: 12 IMHALKMTWHVHCFTCAACKTPI-RNRAFYMEEGAPYCERDY 52


>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred
          partner (LPP).  The first LIM domain of lipoma
          preferred partner (LPP): LPP is a member of the zyxin
          LIM protein family and contains three LIM zinc-binding
          domains at the C-terminal and proline-rich region at
          the N-terminal.  LPP initially identified as the most
          frequent translocation partner of HMGA2 (High Mobility
          Group A2) in a subgroup of benign tumors of adipose
          tissue (lipomas). It was also shown to be rearranged in
          a number of other soft tissues, as well as in a case of
          acute monoblastic leukemia. In addition to its
          involvement in tumors, LPP was inedited as a smooth
          muscle restricted LIM protein that plays an important
          role in SMC migration. LPP is localized at sites of
          cell adhesion, cell-cell contacts and transiently in
          the nucleus. In nucleus, it acts as a coactivator for
          the ETS domain transcription factor PEA3. In addition
          to PEA3, it interacts with alpha-actinin,vasodilator
          stimulated phosphoprotein (VASP),Palladin, and Scrib.
          The  LIM domains are the main focal adhesion targeting
          elements and that the proline- rich region, which
          harbors binding sites for alpha-actinin and
          vasodilator- stimulated phosphoprotein (VASP), has a
          weak targeting capacity. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 54

 Score = 33.2 bits (76), Expect = 0.008
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A D V+H+ CFTC  C I L +G  F   D   YC   Y
Sbjct: 17 AMDQVYHISCFTCHQCQINL-QGKPFYALDGKPYCEEDY 54


>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific
          protein SF3.  The first Lim domain of pollen specific
          protein SF3: SF3 is a Lim protein that is found
          exclusively in mature plant pollen grains. It contains
          two LIM domains. The exact function of SF3 is unknown.
          It may be a transcription factor required for the
          expression of late pollen genes. It is possible that
          SF3 protein is involved in controlling pollen-specific
          processes such as male gamete maturation, pollen tube
          formation, or even fertilization. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 63

 Score = 33.6 bits (77), Expect = 0.008
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 10 MRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEIL 53
          + A  +V+H  CF C  C   L   +   M + ++YC+PH+E L
Sbjct: 18 LSADGVVYHKSCFRCSHCKGTLKLSNYSSM-EGVLYCKPHFEQL 60


>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial
          Protein Lost in Neoplasm (Eplin).  The Lim domain of
          Epithelial Protein Lost in Neoplasm (Eplin): Epithelial
          Protein Lost in Neoplasm is a cytoskeleton-associated
          tumor suppressor whose expression inversely correlates
          with cell growth, motility, invasion and cancer
          mortality.  Eplin interacts and stabilizes F-actin
          filaments and stress fibers, which correlates with its
          ability to suppress anchorage independent growth. In
          epithelial cells, Eplin is required for formation of
          the F-actin adhesion belt by binding to the
          E-cadherin-catenin complex through alpha-catenin. Eplin
          is expressed in two isoforms, a longer Eplin-beta and a
          shorter Eplin-alpha. Eplin-alpha mRNA is detected in
          various tissues and cell lines, but is absent or down
          regulated in cancer cells. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 33.3 bits (76), Expect = 0.008
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A   ++H  CF C  C   L+ G    +    IYC+PH+
Sbjct: 16 ANQQIYHNSCFRCSYCNTKLSLGTYASLHGN-IYCKPHF 53


>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein
          Lost in Neoplasm (Eplin) like proteins.  The Lim domain
          of Epithelial Protein Lost in Neoplasm (Eplin) like
          proteins: This family contains Epithelial Protein Lost
          in Neoplasm in Neoplasm (Eplin), xin actin-binding
          repeat-containing protein 2 (XIRP2) and a group of
          protein with unknown function.  The members of this
          family all contain a single LIM domain. Epithelial
          Protein Lost in Neoplasm is a cytoskeleton-associated
          tumor suppressor whose expression inversely correlates
          with cell growth, motility, invasion and cancer
          mortality.  Eplin interacts and stabilizes F-actin
          filaments and stress fibers, which correlates with its
          ability to suppress anchorage independent growth. In
          epithelial cells, Eplin is required for formation of
          the F-actin adhesion belt by binding to the
          E-cadherin-catenin complex through alpha-catenin. Eplin
          is expressed in two isoforms, a longer Eplin-beta and a
          shorter Eplin-alpha. Eplin-alpha mRNA is detected in
          various tissues and cell lines, but is absent or down
          regulated in cancer cells. Xirp2 contains a LIM domain
          and Xin re peats for binding to and stabilising
          F-actin. Xirp2 is expressed in muscles and is
          significantly induced in the heart in response to
          systemic administration of angiotensin II. Xirp2 is an
          important effector of the Ang II signaling pathway in
          the heart. The expression of Xirp2 is activated by
          myocyte enhancer factor (MEF)2A, whose  transcriptional
          activity is stimulated by angiotersin II. Thus, Xirp2
          plays important pathological roles in the angiotensin
          II induced hypertension. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 32.8 bits (75), Expect = 0.009
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A    FH  CF C  C   L+ G+   +   + YC+PH+
Sbjct: 16 ADKQNFHKSCFRCEHCNSKLSLGNYASLHGRI-YCKPHF 53


>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin.  The first
          LIM domain of Zyxin: Zyxin exhibits three copies of the
          LIM domain, an extensive proline-rich domain and a
          nuclear export signal.  Localized at sites of cell
          substratum adhesion in fibroblasts, Zyxin interacts
          with alpha-actinin, members of the cysteine-rich
          protein (CRP) family, proteins that display Src
          homology 3 (SH3) domains and Ena/VASP family members.
          Zyxin and its partners have been implicated in the
          spatial control of actin filament assembly as well as
          in pathways important for cell differentiation. In
          addition to its functions at focal adhesion plaques,
          recent work has shown that zyxin moves from the sites
          of cell contacts to the nucleus, where it directly
          participates in the regulation of gene expression. As
          in other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 87

 Score = 33.3 bits (76), Expect = 0.014
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 2  GISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
           +S ++  +RA   +FH+ CFTC  C   L +G  F   +   YC   Y
Sbjct: 40 PLSRTQPAVRALGHLFHVTCFTCHQCEQQL-QGQQFYSLEGKPYCEECY 87


>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain
          family which are found on Mical (molecule interacting
          with CasL) like proteins.  The LIM domain on proteins
          of unknown function: This domain belongs to the LIM
          domain family which are found on Mical (molecule
          interacting with CasL)-like proteins. Known members of
          the Mical-like family includes single LIM domain
          containing proteins, Mical (molecule interacting with
          CasL), pollen specific protein SF3, Eplin, xin
          actin-binding repeat-containing protein 2 (XIRP2), and
          Ltd-1. The members of this family function mainly at
          the cytoskeleton and focal adhesions. They interact
          with transcription factors or other signaling molecules
          to play roles in muscle development, neuronal
          differentiation, cell growth, and mobility.  As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 53

 Score = 32.4 bits (74), Expect = 0.014
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A   ++H +CF C  C   L K D +   +  +YC+ H+
Sbjct: 16 AEKHIYHKNCFRCKDCNKQL-KVDNYQSHEGNLYCKVHF 53


>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase
          domains protein (Ltd-1).  The LIM domain of LIM and
          transglutaminase domains protein (Ltd-1): This family
          includes mouse Ky protein and Caenorhabditis elegans
          Ltd-1 protein. The members of this family consists a
          N-terminal  Lim domain and a C-terminal
          transglutaminase domain. The mouse Ky protein has
          putative function in muscle development. The mouse with
          ky mutant exhibits combined posterior and lateral
          curvature of the spine. The Ltd-1 gene in C. elegans is
          expressed in developing hypodermal cells from the
          twofold stage embryo through adulthood. These data
          define the ltd-1 gene as a novel marker for C. elegans
          epithelial cell development. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 55

 Score = 32.0 bits (73), Expect = 0.018
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%)

Query: 17 FHLHCFTCISCGILLT-KGDLFGMRDEMIYCRPH 49
          +H  CF C  CG  L+ K   F   D  +YC  H
Sbjct: 21 YHKGCFKCRECGTRLSLKTFTFVQGDGEVYCARH 54


>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM
          (abLIM) proteins.  The third LIM domain of actin
          binding LIM (abLIM) proteins: Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 31.9 bits (73), Expect = 0.019
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          A D  +H+ CF C  CG +LT G+  G +D   YC   Y
Sbjct: 16 ALDKQWHVWCFKCKECGKVLT-GEYMG-KDGKPYCERDY 52


>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM
          domains protein (FHL).  The third LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and an N-terminal single zinc finger domain with
          a consensus sequence equivalent to the C-terminal half
          of a LIM domain. LIMPETin is an exception, containing
          six LIM domains. FHL1, 2 and 3 are predominantly
          expressed in muscle tissues, and FHL5 is highly
          expressed in male germ cells.  FHL proteins exert their
          roles as transcription co-activators or co-repressors
          through a wide array of interaction partners. For
          example, FHL1 binds to Myosin-binding protein C,
          regulating myosin filament formation and sarcomere
          assembly. FHL2 has shown to interact with more than 50
          different proteins, including receptors, structural
          proteins, transcription factors and cofactors, signal
          transducers, splicing factors, DNA replication and
          repair enzymes, and metabolic enzymes. FHL3 int eracts
          with many transcription factors, such as CREB,
          BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 31.9 bits (73), Expect = 0.021
 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%)

Query: 13 RDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCR 47
          RD  +H  CF C  C   L  G  F  RDE  YC 
Sbjct: 16 RDQPWHKECFVCTGCKKQLA-GQRFTSRDEYPYCV 49


>gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting
          with CasL).  The LIM domain of Mical (molecule
          interacting with CasL): MICAL is a large, multidomain,
          cytosolic protein with a single LIM domain, a calponin
          homology (CH) domain and a flavoprotein monooxygenase
          domain. In Drosophila, MICAL is expressed in axons,
          interacts with the neuronal A (PlexA)  receptor and is
          required for Semapho-rin 1a (Sema-1a)-PlexA-mediated
          repulsive axon guidance.  The LIM domain and calporin
          homology domain are known for interactions with the
          cytoskeleton, cytoskeletal adaptor proteins, and other
          signaling proteins. The flavoprotein monooxygenase (MO)
          is required for semaphorin-plexin repulsive axon
          guidance during axonal pathfinding in the Drosophila
          neuromuscular system. In addition, MICAL was
          characterized to interact with Rab13 and Rab8 to
          coordinate the assembly of tight junctions and adherens
          junctions in epithelial cells. Thus, MICAL was also
          named junctional Rab13-binding protein (JRAB). As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 55

 Score = 31.9 bits (73), Expect = 0.021
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGD-LFGMRDEMIYCRPHY 50
          A  L FH  CF C  CG  L  G   F   D   YC+PH+
Sbjct: 16 AEGLFFHRSCFKCSYCGTTLRLGAYAFDRDDGKFYCKPHF 55


>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin.
           The fifth LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 32.1 bits (73), Expect = 0.022
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          +H  CFTC +C   L  G  F  RDE  YC
Sbjct: 20 WHRECFTCTNCSKSLA-GQRFTSRDEKPYC 48


>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP). 
          The LIM domain of LIM and SH3 Protein (LASP):  LASP
          family contains two highly homologous members, LASP-1
          and LASP-2. LASP contains a LIM motif at its amino
          terminus, a src homology 3 (SH3) domains at its
          C-terminal part, and a nebulin-like region in the
          middle. LASP-1 and -2 are highly conserved in their
          LIM, nebulin-like, and SH3 domains ,but differ
          significantly at their linker regions. Both proteins
          are ubiquitously expressed and involved in cytoskeletal
          architecture, especially in the organization of focal
          adhesions. LASP-1 and LASP-2, are important during
          early embryo- and fetogenesis and are highly expressed
          in the central nervous system of the adult. However,
          only LASP-1 seems to participate significantly in
          neuronal differentiation and plays an important
          functional role in migration and proliferation of
          certain cancer cells while the role of LASP-2 is more
          structural. The expression of LASP-1 in breast tumors
          is increased significantly. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 32.0 bits (73), Expect = 0.023
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 14 DLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          D ++H  CF C  CG+ L   +  G  ++  YC  HY
Sbjct: 18 DKIWHKGCFKCEVCGMTLNMKNYKGY-NKKPYCNAHY 53


>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor
           [Transcription].
          Length = 156

 Score = 33.6 bits (77), Expect = 0.027
 Identities = 21/116 (18%), Positives = 38/116 (32%), Gaps = 22/116 (18%)

Query: 80  VQKGRPRKRKLSVDSPTPPSEDINANVMRIPSTTLEMLHSGDLSSSMESLSYESGAGNSS 139
           VQ  +P     S   P   +     N           + +       +S        + S
Sbjct: 3   VQPMQPLSALESQRMPQIRTIKTTKNKR--------EVEA------ADSEMKLERKQDGS 48

Query: 140 PGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQLAQKTGLSKRVLQ 195
                 S  ++KR RT+    QL  ++  F IN  P +    +L+    +  + +Q
Sbjct: 49  ------SPPKSKRRRTT--DEQLMVLEREFEINPYPSSITRIKLSLLLNMPPKSVQ 96


>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like
          family.  The first LIM domain of Testin_like family:
          This family includes testin, prickle, dyxin and
          LIMPETin. Structurally, testin and prickle proteins
          contain three LIM domains at C-terminal; LIMPETin has
          six LIM domains; and dyxin presents only two LIM
          domains. However, all members of the family contain a
          PET protein-protein interaction domain.  Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Prickles have been implicated in roles of
          regulating tissue polarity or planar cell polarity
          (PCP).  Dyxin involves in lung and heart development by
          interaction with GATA6 and blocking GATA6 activated
          target genes. LIMPETin might be the recombinant product
          of genes coding testin and four and half LIM proteins
          and its function is not well understood. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 58

 Score = 31.8 bits (73), Expect = 0.028
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 14 DLVFHLHCFTCISCGILLTKGDL-FGMRDEMIYCRPHY 50
          D  +H  CF C +C  LL   DL +   D  IYC  HY
Sbjct: 23 DACWHPGCFVCETCNELLV--DLIYFYHDGKIYCGRHY 58


>gnl|CDD|188780 cd09394, LIM1_Rga, The first LIM domain of  Rga GTPase-Activating
          Proteins.  The first LIM domain of  Rga
          GTPase-Activating Proteins: The members of this family
          contain two tandem repeats of LIM domains and a
          Rho-type GTPase activating protein (RhoGap) domain. Rga
          activates GTPases during polarized morphogenesis. In
          yeast, a known regulating target of Rga is  CDC42p, a
          small GTPase. The LIM domain is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 55

 Score = 31.6 bits (72), Expect = 0.031
 Identities = 8/21 (38%), Positives = 11/21 (52%)

Query: 17 FHLHCFTCISCGILLTKGDLF 37
          +H+HCF C  C   L+    F
Sbjct: 21 WHIHCFKCYKCDKKLSCDSNF 41


>gnl|CDD|188832 cd09448, LIM_CLP36, This family represents the LIM domain of
          CLP36.  This family represents the LIM domain of CLP36.
           CLP36 has also been named as CLIM1, Elfin, or PDLIM1.
          CLP36 contains a C-terminal LIM domain and an
          N-terminal PDZ domain. CLP36 is highly expressed in
          heart and is present in many other tissues including
          lung, liver, spleen, and blood. CLP36 has been
          implicated in many processes including hypoxia and
          regulation of actin stress fibers. CLP36 co-localizes
          with alpha-actinin-2 at the Z-lines in myocardium. In
          addition, CLP36 binds to alpha-actinin-1 and
          alpha-actinin-4, and associates with F-actin filaments
          and stress fibers. CLP36 might be involved in not only
          the function of sarcomeres in muscle cells, but also in
          actin stress fiber-mediated cellular processes, such as
          cell shape, migration, polarit, and cytokinesis in
          non-muscle cells. LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 52

 Score = 31.4 bits (71), Expect = 0.036
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 8  LVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPH 49
          + ++ RD   H  C+ C  CG  L +   F + D+ IYC  H
Sbjct: 11 VFVKIRDKPRHPECYVCTDCGTNLKQKGHFFVEDQ-IYCEKH 51


>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like
          proteins.  The first LIM domain of Ajuba-like proteins:
          Ajuba like LIM protein family includes three highly
          homologous proteins Ajuba, Limd1, and WTIP. Members of
          the family contain three tandem C-terminal LIM domains
          and a proline-rich N-terminal region. This family of
          proteins functions as scaffolds, participating in the
          assembly of numerous protein complexes. In the
          cytoplasm, Ajuba binds Grb2 to modulate
          serum-stimulated ERK activation. Ajuba also recruits
          the TNF receptor-associated factor 6 (TRAF6) to p62 and
          activates PKCKappa activity. Ajuba interacts with
          alpha-catenin and F-actin to contribute to the
          formation or stabilization of adheren junctions by
          linking adhesive receptors to the actin cytoskeleton.
          Although Ajuba is a cytoplasmic protein, it can shuttle
          into the nucleus. In nucleus, Ajuba functions as a
          corepressor for the zinc finger-protein Snail. It binds
          to the SNAG repression domain of Snail through its LIM
          region.  Arginine methyltransferase-5 (Prmt5), a
          protein in the complex, is recruited to Snai l through
          an interaction with Ajuba. This ternary complex
          functions to repress E-cadherin, a Snail target gene.
          In addition, Ajuba contains functional nuclear-receptor
          interacting motifs and selectively interacts with
          retinoic acid receptors (RARs) and rexinoid receptor
          (RXRs) to negatively regulate retinoic acid signaling.
          Wtip, the Wt1-interacting protein, was originally
          identified as an interaction partner of the Wilms
          tumour protein 1 (WT1). Wtip is involved in kidney and
          neural crest development. Wtip interacts with the
          receptor tyrosine kinase Ror2 and inhibits canonical
          Wnt signaling. LIMD1 was reported to inhibit cell
          growth and metastases. The inhibition may be mediated
          through an interaction with the protein
          barrier-to-autointegration (BAF), a component of
          SWI/SNF chromatin-remodeling protein; or through the
          interaction with retinoblastoma protein (pRB),
          resulting in inhibition of E2F-mediated transcription,
          and expression of the majority of genes with E2F1-
          responsive elements. Recently, Limd1 was shown to
          interact with the p62/sequestosome protein and
          influence IL-1 and RANKL signaling by facilitating the
          assembly of a p62/TRAF6/a-PKC multi-protein complex.
          The Limd1-p62 interaction affects both NF-kappaB and
          AP-1 activity in epithelial cells and osteoclasts.
          Moreover, LIMD1 functions as tumor repressor to block
          lung tumor cell line in vitro and in vivo. Recent
          studies revealed that LIM proteins Wtip, LIMD1 and
          Ajuba interact with components of RNA induced silencing
          complexes (RISC) as well as eIF4E and the mRNA m7GTP
          cap-protein complex and are required for
          microRNA-mediated gene silencing.  As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 54

 Score = 31.2 bits (71), Expect = 0.039
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 11 RARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +A   ++H +CFTC SCG  L +G  F   +  +YC   Y
Sbjct: 16 QAMGNLYHTNCFTCCSCGRTL-RGKAFYNVNGKVYCEEDY 54


>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM
          domains protein 1 (FHL1).  The second LIM domain of
          Four and a half LIM domains protein 1 (FHL1):  FHL1 is
          heavily expressed in skeletal and cardiac muscles. It
          plays important roles in muscle growth,
          differentiation, and sarcomere assembly by acting as a
          modulator of transcription factors. Defects in FHL1
          gene are responsible for a number of Muscular
          dystrophy-like muscle disorders. It has been detected
          that FHL1 binds to Myosin-binding protein C, regulating
          myosin filament formation and sarcomere assembly. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 58

 Score = 31.3 bits (71), Expect = 0.040
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%)

Query: 16 VFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEIL 53
          V+H  CFTC +C   +     F  + E  YC P +E  
Sbjct: 21 VWHKDCFTCSNCKQPIGTKSFF-PKGEDFYCVPCHEKK 57


>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The first LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 57

 Score = 30.7 bits (70), Expect = 0.066
 Identities = 11/18 (61%), Positives = 12/18 (66%)

Query: 11 RARDLVFHLHCFTCISCG 28
          RA   V+HL CFTC  CG
Sbjct: 14 RALGDVYHLDCFTCHDCG 31


>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function. 
          LIM domain in proteins of unknown function: LIM domains
          are identified in a diverse group of proteins with wide
          variety of biological functions, including gene
          expression regulation, cell fate determination,
          cytoskeleton organization, tumor formation, and
          development. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes. They perform their functions through
          interactions with other protein partners. The LIM
          domains are 50-60 amino acids in size and share two
          characteristic highly conserved zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. The consensus sequence of LIM
          domain has been defined as
          C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
          21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 61

 Score = 30.5 bits (69), Expect = 0.074
 Identities = 11/31 (35%), Positives = 14/31 (45%)

Query: 16 VFHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          V+H  CF C  CG+ LT G  +        C
Sbjct: 24 VYHRTCFKCARCGVQLTPGSFYETEYGSYCC 54


>gnl|CDD|188820 cd09436, LIM3_TRIP6, The third LIM domain of Thyroid
          receptor-interacting protein 6 (TRIP6).  The third LIM
          domain of Thyroid receptor-interacting protein 6
          (TRIP6): TRIP6 is a member of the zyxin LIM protein
          family and contains three LIM zinc-binding domains at
          the C-terminal. TRIP6 protein localizes to focal
          adhesion sites and along actin stress fibers.
          Recruitment of this protein to the plasma membrane
          occurs in a lysophosphatidic acid (LPA)-dependent
          manner. TRIP6 recruits a number of molecules involved
          in actin assembly, cell motility, survival and
          transcriptional control. The function of TRIP6 in cell
          motility is regulated by Src-dependent phosphorylation
          at a Tyr residue. The phosphorylation activates the
          coupling to the Crk SH2 domain, which is required for
          the function of TRIP6 in promoting lysophosphatidic
          acid (LPA)-induced cell migration. TRIP6 can shuttle to
          the nucleus to serve as a coactivator of AP-1 and
          NF-kappaB transcriptional factors. Moreover, TRIP6 can
          form a ternary complex with the NHERF2 PDZ protein and
          LPA2 receptor to regulate LPA-induced activation of ERK
          and AKT, rendering cells resistant to chemotherapy.
          Recent evidence shows that TRIP6 antagonizes
          Fas-Induced apoptosis by enhancing the antiapoptotic
          effect of LPA in cells. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 66

 Score = 30.7 bits (69), Expect = 0.086
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGD 35
          A D  FH+ C+ C  CG LL++GD
Sbjct: 22 ALDRDFHVQCYRCEDCGSLLSEGD 45


>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b.  The first
          LIM domain of Lmx1b: Lmx1b belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          In mouse, Lmx1b functions in the developing limbs and
          eyes, the kidneys, the brain, and in cranial
          mesenchyme. The disruption of Lmx1b gene results kidney
          and limb defects. In the brain, Lmx1b is important for
          generation of mesencephalic dopamine neurons and the
          differentiation of serotonergic neurons. In the mouse
          eye, Lmx1b regulates anterior segment (cornea, iris,
          ciliary body, trabecular meshwork, and lens)
          development. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 30.0 bits (68), Expect = 0.10
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 2/42 (4%)

Query: 10 MRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYE 51
          +R  +  +H  C  C  C   LT    F  RD  +YC+  Y+
Sbjct: 14 LRVNERSWHEECLQCSVCQQPLTTSCYF--RDRKLYCKQDYQ 53


>gnl|CDD|217776 pfam03878, YIF1, YIF1.  YIF1 (Yip1 interacting factor) is an
           integral membrane protein that is required for membrane
           fusion of ER derived vesicles. It also plays a role in
           the biogenesis of ER derived COPII transport vesicles.
          Length = 240

 Score = 32.4 bits (74), Expect = 0.10
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 84  RPRKRKLSVDSPTPPSEDINANVMRIP 110
           R  +R    +SP PP  D+NA  + IP
Sbjct: 64  RDWERIYDRESPLPPRYDVNAPDLYIP 90


>gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin.  The first
          LIM domain of Testin: Testin contains three C-terminal
          LIM domains and a PET protein-protein interaction
          domain at the N-terminal.   Testin is a cytoskeleton
          associated focal adhesion protein that localizes along
          actin stress fibers, at cell-cell-contact areas, and at
          focal adhesion plaques. Testin interacts with a variety
          of cytoskeletal proteins, including zyxin, mena, VASP,
          talin, and actin and it is involved in cell motility
          and adhesion events. Knockout mice experiments reveal
          that tumor repressor function of Testin. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 58

 Score = 30.1 bits (68), Expect = 0.11
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 14 DLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          D ++H  CF C +CG LL     F  ++  +YC  HY
Sbjct: 23 DKLWHPACFVCSTCGELLVDMIYF-WKNGKLYCGRHY 58


>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog
          (ENH) family.  The second LIM domain of the Enigma
          Homolog (ENH) family: ENH was initially identified in
          rat brain. Same as enigma, it contains three LIM
          domains at the C-terminus and a PDZ domain at
          N-terminus. ENH is implicated in signal transduction
          processes involving protein kinases.  It has also been
          shown that ENH interacts with protein kinase D1 (PKD1)
          via its LIM domains and forms a complex with PKD1 and
          the alpha1C subunit of cardiac L-type voltage-gated
          calcium channel in rat neonatal cardiomyocytes. The
          N-terminal PDZ domain interacts with alpha-actinin at
          the Z-line. ENH is expressed in multiple tissues, such
          as skeletal muscle, heart, bone, and brain. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 30.0 bits (67), Expect = 0.13
 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          V+ A    +H+ CF C++C   + + ++F + D   YC   Y
Sbjct: 12 VINALKQTWHVSCFVCVACHNPI-RNNVFHLEDGEPYCETDY 52


>gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin.  The
          second LIM domain of Testin: Testin contains three
          C-terminal LIM domains and a PET protein-protein
          interaction domain at the N-terminal. Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Knockout mice experiments reveal that tumor
          repressor function of testin. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 29.8 bits (67), Expect = 0.14
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 11 RARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +A +  +HL  F C  C  +L  G+++ M ++   C+P Y
Sbjct: 17 QAENQNWHLKHFCCFDCDNILA-GEIYVMVNDKPVCKPCY 55


>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle.  The
          first LIM domain of Prickle: Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain.
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells.  Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 29.9 bits (68), Expect = 0.14
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 18 HLHCFTCISCGILLTKGDLFGM-RDEMIYCRPHY 50
          H  CF C +C  LL   DL    +D  +YC  H+
Sbjct: 27 HPACFVCSTCKELLV--DLIYFYQDGKVYCGRHH 58


>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like
          family.  The second LIM domain of Testin-like family:
          This family includes testin, prickle, dyxin and
          LIMPETin. Structurally, testin and prickle proteins
          contain three LIM domains at C-terminal; LIMPETin has
          six LIM domains; and dyxin presents only two LIM
          domains. However, all members of the family contain a
          PET protein-protein interaction domain.  Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Prickles have been implicated in roles of
          regulating tissue polarity or planar cell polarity
          (PCP).  Dyxin involves in lung and heart development by
          interaction with GATA6 and blocking GATA6 activated
          target genes. LIMPETin might be the recombinant product
          of genes coding testin and four and half LIM proteins
          and its function is not well understood. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 56

 Score = 29.5 bits (67), Expect = 0.16
 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 1/41 (2%)

Query: 11 RARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYE 51
          +A    +HL  F C  C   L  G  + +R+   YC   YE
Sbjct: 17 QAEGKNWHLKHFCCFQCDEPLG-GQRYVLREGKPYCLDCYE 56


>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM
          (abLIM) proteins.  The second LIM domain of actin
          binding LIM (abLIM) proteins:  Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 29.6 bits (67), Expect = 0.17
 Identities = 8/30 (26%), Positives = 10/30 (33%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          +H  CF C  C      GD      +   C
Sbjct: 23 YHPKCFVCSVCRQPFPPGDRVTFNGKECLC 52


>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid
          receptor-interacting protein 6 (TRIP6).  The second LIM
          domain of Thyroid receptor-interacting protein 6
          (TRIP6): TRIP6 is a member of the zyxin LIM protein
          family and contains three LIM zinc-binding domains at
          the C-terminal. TRIP6 protein localizes to focal
          adhesion sites and along actin stress fibers.
          Recruitment of this protein to the plasma membrane
          occurs in a lysophosphatidic acid (LPA)-dependent
          manner. TRIP6 recruits a number of molecules involved
          in actin assembly, cell motility, survival and
          transcriptional control. The function of TRIP6 in cell
          motility is regulated by Src-dependent phosphorylation
          at a Tyr residue. The phosphorylation activates the
          coupling to the Crk SH2 domain, which is required for
          the function of TRIP6 in promoting lysophosphatidic
          acid (LPA)-induced cell migration. TRIP6 can shuttle to
          the nucleus to serve as a coactivator of AP-1 and
          NF-kappaB transcriptional factors. Moreover, TRIP6 can
          form a ternary complex with the NHERF2 PDZ protein and
          LPA2 receptor to regulate LPA-induced activation of ERK
          and AKT, rendering cells resistant to chemotherapy.
          Recent evidence shows that TRIP6 antagonizes
          Fas-Induced apoptosis by enhancing the antiapoptotic
          effect of LPA in cells. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 29.5 bits (66), Expect = 0.18
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 7  ELVMRARDLVFHLHCFTCISC 27
          E ++RA    +H HCFTC+ C
Sbjct: 10 ERILRATGKAYHPHCFTCVVC 30


>gnl|CDD|188821 cd09437, LIM3_LPP, The third LIM domain of lipoma preferred
          partner (LPP).  The third LIM domain of lipoma
          preferred partner (LPP): LPP is a member of the zyxin
          LIM protein family and contains three LIM zinc-binding
          domains at the C-terminal and proline-rich region at
          the N-terminal.  LPP initially identified as the most
          frequent translocation partner of HMGA2 (High Mobility
          Group A2) in a subgroup of benign tumors of adipose
          tissue (lipomas). It was also shown to be rearranged in
          a number of other soft tissues, as well as in a case of
          acute monoblastic leukemia. In addition to its
          involvement in tumors, LPP was inedited as a smooth
          muscle restricted LIM protein that plays an important
          role in SMC migration. LPP is localized at sites of
          cell adhesion, cell-cell contacts and transiently in
          the nucleus. In nucleus, it acts as a coactivator for
          the ETS domain transcription factor PEA3. In addition
          to PEA3, it interacts with alpha-actinin,vasodilator
          stimulated phosphoprotein (VASP), Palladin, and Scrib.
          The LIM domains are the main focal adhesion targeting
          elements and that the proline- rich region, which
          harbors binding sites for alpha-actinin and
          vasodilator- stimulated phosphoprotein (VASP), has a
          weak targeting capacity. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 68

 Score = 29.4 bits (66), Expect = 0.22
 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 3/39 (7%)

Query: 12 ARDLVFHLHCFTCISCGILL---TKGDLFGMRDEMIYCR 47
          A D  FH+ C+ C  CG+LL    +G      D+ + C+
Sbjct: 22 ALDRSFHVQCYKCEDCGLLLSSEAEGRGCYPLDDHVLCK 60


>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain
          Kinase ).  The first LIM domain of LIMK (LIM domain
          Kinase ): LIMK protein family is  comprised of two
          members LIMK1 and LIMK2. LIMK contains two LIM domains,
          a PDZ domain and a kinase domain. LIMK is involved in
          the regulation of actin polymerization and microtubule
          disassembly. LIMK influences architecture of the actin
          cytoskeleton by regulating the activity of the cofilin
          family proteins cofilin1, cofilin2, and destrin. The
          mechanism of the activation is to phosphorylates
          cofilin on serine 3 and inactivates its actin-severing
          activity, and altering the rate of actin
          depolymerisation. LIMKs can function in both cytoplasm
          and nucleus and are expressed in all tissues. Both
          LIMK1 and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. However,
          LIMK1 and LIMk2 have different cellular locations.
          While LIMK1 localizes mainly at focal adhesions, LIMK2
          is found in cytoplasmic punctae, suggesting that they
          may have different cellular functions. The LIM domains
          of LIMK have been shown to play an important role in
          regulating kinase activity and likely also contribute
          to LIMK function by acting as sites of
          protein-to-protein interactions. All LIM domains are
          50-60 amino acids in size and share two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 29.0 bits (65), Expect = 0.22
 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 2/34 (5%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H  CF C  C   L+  + +  +D  +YCR  Y
Sbjct: 21 WHCDCFRCSVCSDSLS--NWYFEKDGKLYCRKDY 52


>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM
          domains protein (FHL).  The second LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and an N-terminal single zinc finger domain with
          a consensus sequence equivalent to the C-terminal half
          of a LIM domain. LIMPETin is an exception, containing
          six LIM domains. FHL1, 2 and 3 are predominantly
          expressed in muscle tissues, and FHL5 is highly
          expressed in male germ cells.  FHL proteins exert their
          roles as transcription co-activators or co-repressors
          through a wide array of interaction partners. For
          example, FHL1 binds to Myosin-binding protein C,
          regulating myosin filament formation and sarcomere
          assembly. FHL2 has shown to interact with more than 50
          different proteins, including receptors, structural
          proteins, transcription factors and cofactors, signal
          transducers, splicing factors, DNA replication and
          repair enzymes, and metabolic enzymes. FHL3 int eracts
          with many transcription factors, such as CREB,
          BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 29.2 bits (66), Expect = 0.24
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H  CFTC  C   +     F  +D+ IYC P Y
Sbjct: 22 WHEKCFTCSECKKPIG-TKSFIPKDDKIYCVPCY 54


>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein
          LIMPETin.  The fourth LIM domain of protein LIMPETin:
          LIMPETin contains 6 LIM domains at the C-terminal and
          an N-terminal PET domain. Four of the six LIM domains
          are highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the Testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 28.9 bits (65), Expect = 0.27
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 17 FHLHCFTCISCGILL-TKGDLFGMRDEMIYCRPHY 50
          +H  CF C  C   + TK   F  +D+ +YC P Y
Sbjct: 22 WHEKCFCCCECKQPIGTKS--FIPKDDDVYCVPCY 54


>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the
          filamin-binding LIM protein-1 (FBLP-1).  The second LIM
          domain of the filamin-binding LIM protein-1 (FBLP-1):
          Fblp-1 contains a proline-rich domain near its N
          terminus and two LIM domains at its C terminus. FBLP-1
          mRNA was detected in a variety of tissues and cells
          including platelets and endothelial cells. FBLP-1 binds
          to Filamins. The association between filamin B and
          FBLP-1 may play an unknown role in cytoskeletal
          function, cell adhesion, and cell motility. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 28.9 bits (65), Expect = 0.29
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 7  ELVMRARDLVFHLHCFTCISCG 28
          E ++RA    +H  CFTC++CG
Sbjct: 10 EHIIRALGKGYHPPCFTCVTCG 31


>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain
          Kinase 2).  The first LIM domain of LIMK2 (LIM domain
          Kinase 2): LIMK2 is a member of the LIMK protein
          family, which comprises LIMK1 and LIMK2. LIMK contains
          two LIM domains, a PDZ domain, and a kinase domain.
          LIMK is involved in the regulation of actin
          polymerization and microtubule disassembly. LIMK
          influences architecture of the actin cytoskeleton by
          regulating the activity of the cofilin family proteins
          cofilin1, cofilin2, and destrin. The mechanism of the
          activation is to phosphorylates cofilin on serine 3 and
          inactivates its actin-severing activity, altering the
          rate of actin depolymerization. LIMK activity is
          activated by phosphorylation of a threonine residue
          within the activation loop of the kinase by
          p21-activated kinases 1 and 4 and by Rho kinase. LIMKs
          can function in both cytoplasm and nucleus. Both LIMK1
          and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. LIMK2 is
          expressed in all tissues. While LIMK1 localizes mainly
          at focal adhesions, LIMK2 is found in cytoplasmic
          punctae, suggesting that they may have different
          cellular functions. The activity of LIM kinase 2 to
          regulate cofilin phosphorylation is inhibited by the
          direct binding of Par-3. LIMK2 activation promotes cell
          cycle progression. The phenotype of Limk2 knockout mice
          shows a defect in spermatogenesis. The LIM domains have
          been shown to play an important role in regulating
          kinase activity and likely also contribute to LIMK
          function by acting as sites of protein-to-protein
          interactions. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 28.7 bits (64), Expect = 0.30
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H  CF C  C  LLT  + +  +D  +YC  HY
Sbjct: 21 WHNSCFQCSVCQDLLT--NWYYEKDGKLYCHKHY 52


>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3.  The
          first LIM domain of Prickle 3/LIM domain only 6 (LM06):
          Prickle contains three C-terminal LIM domains and a
          N-terminal PET domain.  Prickles have been implicated
          in roles of regulating tissue polarity or planar cell
          polarity (PCP).  PCP establishment requires the
          conserved Frizzled/Dishevelled PCP pathway. Prickle
          interacts with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells. Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 28.7 bits (64), Expect = 0.31
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 17 FHLHCFTCISCGILLTKGDL-FGMRDEMIYCRPHY 50
          +H  CF C SC  LL   DL +  +D  IYC  H+
Sbjct: 26 WHPQCFQCASCQELLV--DLIYFYQDGKIYCGRHH 58


>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4
          family.  The first LIM domain of Lhx3-Lhx4 family: Lhx3
          and Lhx4 belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          The LHX3 and LHX4 LIM-homeodomain transcription factors
          play essential roles in pituitary gland and nervous
          system development. Although LHX3 and LHX4 share marked
          sequence homology, the genes have different expression
          patterns. They play overlapping, but distinct functions
          during the establishment of the specialized cells of
          the mammalian pituitary gland and the nervous system.
          Lhx3 proteins have been demonstrated the ability to
          directly bind to the promoters/enhancers of several
          pituitary hormone gene promoters to cause increased
          transcription. Lhx3a and Lhx3b, whose mRNAs have
          distinct temporal expression profiles during
          development, are two isoforms of Lhx3. LHX4 plays
          essential roles in pituitary gland and nervous system
          development. In mice, the lhx4 gene is expressed in the
          developing hindbrain, cerebral cortex, pituitary gland,
          and spinal cord. LHX4 shows significant sequence
          similarity to LHX3, particularly to isoforms Lhx3a. In
          gene regulation experiments, the LHX4 protein exhibits
          regulation roles towards pituitary genes, acting on
          their promoters/enhancers. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 52

 Score = 28.5 bits (64), Expect = 0.36
 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 2/39 (5%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCR 47
          +++  D  +H  C  C  CG  LT  D    R+  +YC+
Sbjct: 13 ILKVLDRTWHAKCLKCNDCGAQLT--DKCFARNGHVYCK 49


>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8.
          The first LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
          belong to the LHX protein family, which features two
          tandem N-terminal LIM domains and a C-terminal DNA
          binding homeodomain. Members of LHX family are found in
          the nucleus and act as transcription factors or
          cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs such as
          the pituitary gland and the pancreas.  Studies using
          mutant mice have revealed roles for Lhx7 and Lhx8 in
          the development of cholinergic neurons in the
          telencephalon and in basal forebrain development. Mice
          lacking alleles of the LIM-homeobox gene Lhx7 or Lhx8
          display dramatically reduced number of forebrain
          cholinergic neurons. In addition, Lhx7 mutation affects
          male and female mice differently, with females
          appearing more affected than males. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 56

 Score = 28.8 bits (64), Expect = 0.37
 Identities = 11/42 (26%), Positives = 23/42 (54%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +++  DL +H+ C +C  C   L +     ++D+ I+C+  Y
Sbjct: 14 LLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDY 55


>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma.  The first
          LIM domain of Enigma: Enigma was initially
          characterized in humans as a protein containing three
          LIM domains at the C-terminus and a PDZ domain at
          N-terminus.  The third LIM domain specifically
          interacts with the insulin receptor and the second LIM
          domain interacts with the receptor tyrosine kinase Ret
          and the adaptor protein APS. Thus Enigma is implicated
          in signal transduction processes such as mitogenic
          activity, insulin related actin organization, and
          glucose metabolism. Enigma is expressed in multiple
          tissues, such as skeletal muscle, heart, bone and
          brain.  LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 52

 Score = 28.2 bits (63), Expect = 0.40
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 9  VMRARDLV-----FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          ++R R LV     +H   FTC  C  +L +G  F  +   I+C   Y
Sbjct: 7  IIRGRYLVALGRSYHPEEFTCSQCKKVLDEGGFFEEKGS-IFCPKCY 52


>gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a.  The first
          LIM domain of Lmx1a: Lmx1a belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Mouse Lmx1a is expressed in multiple tissues, including
          the roof plate of the neural tube, the developing
          brain, the otic vesicles, the notochord, and the
          pancreas. Human Lmx1a can be found in pancreas,
          skeletal muscle, adipose tissue, developing brain,
          mammary glands, and pituitary.  The functions of Lmx1a
          in the developing nervous system were revealed by
          studies of mutant mouse. In mouse, mutations in Lmx1a
          result in failure of the roof plate to develop.  Lmx1a
          may act upstream of other roof plate markers such as
          MafB, Gdf7, Bmp 6, and Bmp7. Further characterization
          of these mice reveals numerous defects including
          disorganized cerebellum, hippocampus, and cortex;
          altered pigmentation; female sterility; skeletal
          defects; and behavioral abnormalities. Within
          pancreatic cells, the Lmx1a protein interacts
          synergistically with the bHLH transcription factor E47
          to activate the insulin gene enhancer/promoter. As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 52

 Score = 28.2 bits (63), Expect = 0.41
 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          ++R  D ++H  C  C SC   L     +  RD+ +YC+  Y
Sbjct: 13 LLRVNDSLWHERCLQCASCKEPLETTCFY--RDKKLYCKEDY 52


>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma
          subfamily with unknown function.  The third LIM domain
          of an Enigma subfamily with unknown function: The
          Enigma LIM domain family is comprised of three
          characterized members: Enigma, ENH, and Cypher
          (mouse)/ZASP (human). These subfamily members contain a
          single PDZ domain at the N-terminus and three LIM
          domains at the C-terminus. They serve as adaptor
          proteins, where the PDZ domain tethers the protein to
          the cytoskeleton and the LIM domains, recruit signaling
          proteins to implement corresponding functions. The
          members of the enigma family have been implicated in
          regulating or organizing cytoskeletal structure, as
          well as involving multiple signaling pathways. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 27.9 bits (62), Expect = 0.56
 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPH 49
          +H  CF C  C + L +G  F  +    +C+ H
Sbjct: 22 YHSQCFNCTRCNVNL-EGQSFYAKGGRPFCKLH 53


>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred
          partner (LPP).  The second LIM domain of lipoma
          preferred partner (LPP): LPP is a member of the zyxin
          LIM protein family and contains three LIM zinc-binding
          domains at the C-terminal and proline-rich region at
          the N-terminal.  LPP initially identified as the most
          frequent translocation partner of HMGA2 (High Mobility
          Group A2) in a subgroup of benign tumors of adipose
          tissue (lipomas). It was also shown to be rearranged in
          a number of other soft tissues, as well as in a case of
          acute monoblastic leukemia. In addition to its
          involvement in tumors, LPP was inedited as a smooth
          muscle restricted LIM protein that plays an important
          role in SMC migration. LPP is localized at sites of
          cell adhesion, cell-cell contacts and transiently in
          the nucleus. In nucleus, it acts as a coactivator for
          the ETS domain transcription factor PEA3. In addition
          to PEA3, it interacts with alpha-actinin,vasodilator
          stimulated phosphoprotein (VASP),Palladin, and Scrib.
          The  LIM domains are the main focal adhesion targeting
          elements and that the proline- rich region, which
          harbors binding sites for alpha-actinin and
          vasodilator- stimulated phosphoprotein (VASP), has a
          weak targeting capacity. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 60

 Score = 27.9 bits (62), Expect = 0.80
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 7  ELVMRARDLVFHLHCFTCISCG 28
          + ++RA    +H  CFTC+ CG
Sbjct: 10 DRILRATGKPYHPQCFTCVVCG 31


>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2.  The
          first LIM domain of Prickle 2: Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain.
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells. Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 27.2 bits (60), Expect = 1.1
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 17 FHLHCFTCISCGILLTKGDL-FGMRDEMIYCRPHY 50
          +H  CF C  C  LL   DL +  +D  IYC  H+
Sbjct: 26 WHPQCFVCSVCNELLV--DLIYFYQDGKIYCGRHH 58


>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM
          domains protein 1 (FHL1).  The third LIM domain of Four
          and a half LIM domains protein 1 (FHL1):  FHL1 is
          heavily expressed in skeletal and cardiac muscles. It
          plays important roles in muscle growth,
          differentiation, and sarcomere assembly by acting as a
          modulator of transcription factors. Defects in FHL1
          gene are responsible for a number of Muscular
          dystrophy-like muscle disorders. It has been detected
          that FHL1 binds to Myosin-binding protein C, regulating
          myosin filament formation and sarcomere assembly. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 27.1 bits (60), Expect = 1.1
 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%)

Query: 13 RDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          +D  +H  CF C SC   L  G  F   ++  YC
Sbjct: 16 QDQPWHSECFVCSSCSKKLA-GQRFTAVEDQYYC 48


>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a.  The first
          LIM domain of Lhx3a: Lhx3a is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx3a is one of the two isoforms of Lhx3. The Lhx3 gene
          is expressed in the ventral spinal cord, the pons, the
          medulla oblongata, and the pineal gland of the
          developing nervous system during mouse embryogenesis,
          and transcripts are found in the emergent pituitary
          gland. Lhx3 functions in concert with other
          transcription factors to specify interneuron and motor
          neuron fates during development. Lhx3 proteins have
          been demonstrated to directly bind to the promoters of
          several pituitary hormone gene promoters. The Lhx3 gene
          encodes two isoforms, LHX3a and LHX3b that differ in
          their amino-terminal sequences, where Lhx3a has longer
          N-terminal.  They show differential activation of
          pituitary hormone genes and distinct DNA binding
          properties. In human, Lhx3a trans-activated the
          alpha-glycoprotein subunit promoter and genes
          containing a high-affinity Lhx3 binding site more
          effectively than the hLhx3b isoform. In addition,
          hLhx3a induce transcription of the TSHbeta-subunit gene
          by acting on pituitary POU domain factor, Pit-1, while
          hLhx3b does not. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 56

 Score = 27.0 bits (60), Expect = 1.2
 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 2/39 (5%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCR 47
          +++ +D  +H  C  C+ C   LT  D    R   +YC+
Sbjct: 16 ILKVQDKPWHSKCLKCVDCQAQLT--DKCFSRGGQVYCK 52


>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin
          like protein family.  The third LIM domain of the
          paxillin like protein family: This family consists of
          paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 26.5 bits (59), Expect = 1.6
 Identities = 13/45 (28%), Positives = 18/45 (40%), Gaps = 1/45 (2%)

Query: 6  SELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
           E  + A +  +H  CF C  C      G  F   + + YC  HY
Sbjct: 9  LENYISALNTQWHPECFVCRECHKPFINGSFFEH-EGLPYCETHY 52


>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain
          Kinase 1).  The first LIM domain of LIMK1 (LIM domain
          Kinase 1): LIMK1 belongs to the LIMK protein family,
          which comprises LIMK1 and LIMK2. LIMK contains two LIM
          domains, a PDZ domain, and a kinase domain. LIMK is
          involved in the regulation of actin polymerization and
          microtubule disassembly. LIMK influences architecture
          of the actin cytoskeleton by regulating the activity of
          the cofilin family proteins cofilin1, cofilin2, and
          destrin. The mechanism of the activation is to
          phosphorylates cofilin on serine 3 and inactivates its
          actin-severing activity, and altering the rate of actin
          depolymerization. LIMKs can function in both cytoplasm
          and nucleus. Both LIMK1 and LIMK2 can act in the
          nucleus to suppress Rac/Cdc42-dependent cyclin D1
          expression. LIMK1 is expressed in all tissues and is
          localized to focal adhesions in the cell. LIMK1 can
          form homodimers upon binding of HSP90 and is activated
          by Rho effector Rho kinase and MAPKAPK2. LIMK1 is
          important for normal central nervous system
          development, and its deletion has been implicated in
          the development of the human genetic disorder Williams
          syndrome. Moreover, LIMK1 up-regulates the promoter
          activity of urokinase type plasminogen activator and
          induces its mRNA and protein expression in breast
          cancer cells. The LIM domains have been shown to play
          an important role in regulating kinase activity and
          likely also contribute to LIMK function by acting as
          sites of protein-to-protein interactions. All LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 74

 Score = 27.2 bits (60), Expect = 1.6
 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 10 MRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          ++A +  +H  CF C  CG  L+    +  +D  ++C+  Y
Sbjct: 35 LQALNSDWHADCFRCCECGASLSH--WYYEKDGRLFCKKDY 73


>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit;
           Provisional.
          Length = 242

 Score = 28.4 bits (64), Expect = 1.8
 Identities = 15/67 (22%), Positives = 25/67 (37%), Gaps = 27/67 (40%)

Query: 133 SGAGNSS----------PGSGVHSHQRTKRMRTSFKHHQLRTMKSYFNINQNPDAKDLKQ 182
           SGAG SS          P SG                  L    ++F+ ++ P  K +++
Sbjct: 37  SGAGKSSLLRVLNLLEMPRSG-----------------TLNIAGNHFDFSKTPSDKAIRE 79

Query: 183 LAQKTGL 189
           L +  G+
Sbjct: 80  LRRNVGM 86


>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM
          domains protein (FHL).  The first LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and  an N-terminal single zinc finger domain
          with a consensus sequence equivalent to the C-terminal
          half of a LIM domain. LIMPETin is an exception,
          containing six LIM domains. FHL1, 2 and 3 are
          predominantly expressed in muscle tissues, and FHL5 is
          highly expressed in male germ cells.  FHL proteins
          exert their roles as transcription co-activators or
          co-repressors through a wide array of interaction
          partners. For example, FHL1 binds to Myosin-binding
          protein C, regulating myosin filament formation and
          sarcomere assembly. FHL2 has shown to interact with
          more than 50 different proteins, including receptors,
          structural proteins, transcription factors and
          cofactors, signal transducers, splicing factors, DNA
          replication and repair enzymes, and metabolic enzymes.
          FHL3 int eracts with many transcription factors, such
          as CREB, BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 26.6 bits (59), Expect = 2.0
 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          +G  S +L  + R   +H  CF C  C   L     F  +DE + C
Sbjct: 12 IGCDSKDLSYKDRH--WHEGCFKCFKCQRSLVDKP-FAAKDEDLLC 54


>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM
          domains protein 1 (FHL1).  The fourth LIM domain of
          Four and a half LIM domains protein 1 (FHL1):  FHL1 is
          heavily expressed in skeletal and cardiac muscles. It
          plays important roles in muscle growth,
          differentiation, and sarcomere assembly by acting as a
          modulator of transcription factors. Defects in FHL1
          gene are responsible for a number of Muscular
          dystrophy-like muscle disorders. It has been detected
          that FHL1 binds to Myosin-binding protein C, regulating
          myosin filament formation and sarcomere assembly. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 64

 Score = 26.6 bits (59), Expect = 2.1
 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 1/30 (3%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYC 46
          +H +CF C  C + L     F   +  IYC
Sbjct: 29 WHDYCFNCKKCSLNLAN-KRFVFHNGQIYC 57


>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1.  The Lim domain of DA1:
          DA1 contains one copy of LIM domain and a domain of
          unknown function. DA1 is predicted as an ubiquitin
          receptor, which sets final seed and organ size by
          restricting the period of cell proliferation. The LIM
          domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 26.4 bits (59), Expect = 2.1
 Identities = 6/13 (46%), Positives = 8/13 (61%)

Query: 16 VFHLHCFTCISCG 28
          V+H  CF C +C 
Sbjct: 20 VWHPECFRCHACR 32


>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin.  The
          second LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 26.5 bits (58), Expect = 2.2
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          V+ A D  +H   F C  CG      + F  +D   YCR  Y
Sbjct: 12 VVTALDRTWHPEHFFCAQCGAFFGP-EGFHEKDGKAYCRKDY 52


>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin.  The
          third LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells. Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 26.3 bits (58), Expect = 2.6
 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%)

Query: 10 MRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          + A + V+H  CF C  C    T G  F + D    C  HY
Sbjct: 13 LSAANGVWHPECFVCSDCLKPFTDGSFFEL-DGRPLCELHY 52


>gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1.  The
          first LIM domain of Prickle 1. Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in mainly expressed in
          fetal brain, adult cartilage, pancreatic islet, and
          some types of timorous cells. In addition, Prickle 1
          regulates cell movements during gastrulation and
          neuronal migration through interaction with the
          noncanonical Wnt11/Wnt5 pathway in zebrafish. Mutations
          in prickle 1 have been linked to progressive myoclonus
          epilepsy.  LIM domains are 50-60 amino acids in size
          and share two characteristic zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 59

 Score = 26.4 bits (58), Expect = 2.7
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 17 FHLHCFTCISCGILLTKGDL-FGMRDEMIYCRPHY 50
          +H  CF C +C  LL   DL +  +D  I+C  H+
Sbjct: 26 WHPSCFVCFTCNELLV--DLIYFYQDGKIHCGRHH 58


>gnl|CDD|188060 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxyl carrier
           protein.  This model is designed to identify biotin
           carboxyl carrier protein as a peptide of acetyl-CoA
           carboxylase. Scoring below the trusted cutoff is a
           related protein encoded in a region associated with
           polyketide synthesis in the prokaryote Saccharopolyspora
           hirsuta, and a reported chloroplast-encoded biotin
           carboxyl carrier protein that may be highly derived from
           the last common ancestral sequence. Scoring below the
           noise cutoff are biotin carboxyl carrier domains of
           other enzymes such as pyruvate carboxylase.The gene name
           is accB or fabE [Fatty acid and phospholipid metabolism,
           Biosynthesis].
          Length = 156

 Score = 27.5 bits (61), Expect = 2.9
 Identities = 14/72 (19%), Positives = 26/72 (36%), Gaps = 6/72 (8%)

Query: 41  DEMIYCRPHYE--ILRHRDYCGSAEIEQPMSPRPAPWQPTTVQKGRPRKRKLSVDSPTPP 98
            E+      +E  + +       + ++Q  +P PA   P       P     +V +P P 
Sbjct: 19  TELELKEEEFEVRLSKAAAAAKKSAVQQAAAPVPAQ-VPAAPSAQAPAP---AVCAPAPA 74

Query: 99  SEDINANVMRIP 110
             D   + +R P
Sbjct: 75  KADKKGHFVRSP 86


>gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6.  The first LIM
          domain of Lhx6. Lhx6 is a member of LHX protein family,
          which features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs such as the pituitary gland and the pancreas.
          Lhx6 functions in the brain and nervous system.  It is
          expressed at high levels in several regions of the
          embryonic mouse CNS, including the telencephalon and
          hypothalamus, and the first branchial arch. Lhx6 is
          proposed to have a role in patterning of the mandible
          and maxilla, and in signaling during odontogenesis. In
          brain sections, knockdown of Lhx6 gene blocks the
          normal migration of neurons to the cortex. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 54

 Score = 26.1 bits (57), Expect = 3.0
 Identities = 9/42 (21%), Positives = 24/42 (57%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +++  +L++H+ C  C  C   L + +   ++++ I+C+  Y
Sbjct: 13 LLKVNNLIWHVRCLECSVCRTSLRQHNSCYIKNKEIFCKMDY 54


>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The third LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 56

 Score = 25.7 bits (57), Expect = 3.6
 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 3/33 (9%)

Query: 18 HLHCFTCISCGILLT---KGDLFGMRDEMIYCR 47
          HL CFTC  C   ++       F  +D+ I C 
Sbjct: 21 HLKCFTCSRCHREISSELSDAAFNNKDQRILCS 53


>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM
          domains protein (FHL).  The fourth LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and an N-terminal single zinc finger domain with
          a consensus sequence equivalent to the C-terminal half
          of a LIM domain. LIMPETin is an exception, containing
          six LIM domains. FHL1, 2 and 3 are predominantly
          expressed in muscle tissues, and FHL5 is highly
          expressed in male germ cells.  FHL proteins exert their
          roles as transcription co-activators or co-repressors
          through a wide array of interaction partners. For
          example, FHL1 binds to Myosin-binding protein C,
          regulating myosin filament formation and sarcomere
          assembly. FHL2 has shown to interact with more than 50
          different proteins, including receptors, structural
          proteins, transcription factors and cofactors, signal
          transducers, splicing factors, DNA replication and
          repair enzymes, and metabolic enzymes. FHL3 interacts
          with many transcription factors, such as CREB,
          BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 25.8 bits (57), Expect = 4.0
 Identities = 10/30 (33%), Positives = 13/30 (43%), Gaps = 1/30 (3%)

Query: 18 HLHCFTCISCGILLTKGDLFGMRDEMIYCR 47
          H  CF C  C + L  G  F  + + I C 
Sbjct: 25 HSDCFNCGKCSVSLV-GQGFLTQRDEILCP 53


>gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific
          protein SF3.  The second Lim domain of pollen specific
          protein SF3: SF3 is a Lim protein that is found
          exclusively in mature plant pollen grains. It contains
          two LIM domains. The exact function of SF3 is unknown.
          It may be a transcription factor required for the
          expression of late pollen genes. It is possible that
          SF3 protein is involved in controlling pollen-specific
          processes such as male gamete maturation, pollen tube
          formation, or even fertilization. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 61

 Score = 25.5 bits (56), Expect = 4.6
 Identities = 8/34 (23%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +H  CF C   G  ++  + +   +  +YC+ H+
Sbjct: 21 YHKSCFKCSHGGCTISPSN-YAAHEGRLYCKHHH 53


>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein
          2 (CRP2).  The first LIM domain of Cysteine Rich
          Protein 2 (CRP2): The CRP family members include CRP1,
          CRP2, CRP3/MLP and TLP. CRP1, CRP2 and CRP3 share a
          conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
          which supports the fact that these proteins function
          not only in the cytoplasm but also in the nucleus. CRPs
          control regulatory pathways during cellular
          differentiation, and involve in complex transcription
          circuits, and the organization as well as the
          arrangement of the myofibrillar/cytoskeletal network.
          CRP2 specifically binds to protein inhibitor of
          activated STAT-1 (PIAS1) and a novel human protein
          designed CRP2BP (for CRP2 binding partner). PIAS1
          specifically inhibits the STAT-1 pathway and CRP2BP is
          homologous to members of the histone acetyltransferase
          family raising the possibility that CRP2 is a modulator
          of cytokine-controlled pathways or is functionally
          active in the transcriptional regulatory network. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 25.3 bits (55), Expect = 4.8
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 17 FHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          FH  CF C+ C   L    +  + D+ IYC+  Y
Sbjct: 22 FHKCCFLCMVCRKNLDSTTV-AIHDQEIYCKSCY 54


>gnl|CDD|220880 pfam10812, DUF2561, Protein of unknown function (DUF2561).  This
           family of proteins with unknown function appears to be
           restricted to Mycobacterium spp.
          Length = 207

 Score = 27.1 bits (60), Expect = 5.0
 Identities = 9/45 (20%), Positives = 16/45 (35%), Gaps = 2/45 (4%)

Query: 71  RPAPWQPTTVQKGRPRK--RKLSVDSPTPPSEDINANVMRIPSTT 113
           R A  +P    +G  R+  + +        +E  +      PS T
Sbjct: 89  RMADDEPPPRSQGLRRRPGQPVRAGYAAARTEKESVPATHAPSRT 133


>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain.  This is a homeobox
           transcription factor KN domain conserved from fungi to
           human and plants.
          Length = 40

 Score = 24.8 bits (55), Expect = 5.3
 Identities = 8/22 (36%), Positives = 16/22 (72%)

Query: 175 PDAKDLKQLAQKTGLSKRVLQN 196
           P  ++  +LA++TGLS++ + N
Sbjct: 11  PSEEEKSELARQTGLSRKQIDN 32


>gnl|CDD|188785 cd09401, LIM_TLP_like, The  LIM domains of thymus LIM protein
          (TLP).  The LIM domain of thymus LIM protein (TLP) like
          proteins:  This family includes the LIM domains of TLP
          and CRIP (Cysteine-Rich Intestinal Protein). TLP is the
          distant member of the CRP family of proteins. TLP has
          two isomers (TLP-A and TLP-B) and sharing approximately
          30% with each of the three other CRPs.  Like CRP1, CRP2
          and CRP3/MLP, TLP has two LIM domains, connected by a
          flexible linker region. Unlike the CRPs, TLP lacks the
          nuclear targeting signal (K/R-K/R-Y-G-P-K) and is
          localized solely in the cytoplasm. TLP is specifically
          expressed in the thymus in a subset of cortical
          epithelial cells.  TLP has a role in development of
          normal thymus and in controlling the development and
          differentiation of thymic epithelial cells. CRIP is a
          short LIM protein with only one LIM domain. CRIP gene
          is developmentally regulated and can be induced by
          glucocorticoid hormones during the first three
          postnatal weeks. The domain shows close sequence
          homology to LIM domain of thymus LIM protein. However,
          unlike the TLP proteins which have two LIM domains, the
          members of this family have only one LIM domain. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 25.4 bits (56), Expect = 5.4
 Identities = 10/33 (30%), Positives = 11/33 (33%), Gaps = 1/33 (3%)

Query: 18 HLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          H  C  C  C   LT G      +   YC   Y
Sbjct: 22 HKPCLRCEKCKKTLTPG-QHSEHEGKPYCNKCY 53


>gnl|CDD|217601 pfam03534, SpvB, Salmonella virulence plasmid 65kDa B protein. 
          Length = 293

 Score = 27.3 bits (61), Expect = 5.7
 Identities = 12/30 (40%), Positives = 14/30 (46%)

Query: 128 SLSYESGAGNSSPGSGVHSHQRTKRMRTSF 157
           +L+Y SGAGN   G G          RTS 
Sbjct: 29  ALNYSSGAGNGPFGLGWQLGVMAISRRTSK 58


>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM
          domains protein 3 (FHL3).  The second LIM domain of
          Four and a half LIM domains protein 3 (FHL3):  FHL3 is
          highly expressed in the skeleton and cardiac muscles
          and possesses the transactivation and repression
          activities. FHL3 interacts with many transcription
          factors, such as CREB, BKLF/KLF3, CtBP2, MyoD, and
          MZF_1. Moreover, FHL3 interacts with alpha- and
          beta-subunits of the muscle alpha7beta1 integrin
          receptor. FHL3 was also proved to possess the
          auto-activation ability and was confirmed that the
          second zinc finger motif in fourth LIM domain was
          responsible for the auto-activation of FHL3. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 58

 Score = 25.2 bits (55), Expect = 5.8
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 1/36 (2%)

Query: 16 VFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYE 51
           +H HCF C  C   +        +DE  YC P YE
Sbjct: 24 TWHEHCFICHGCEQPIGSRSFIPDKDEH-YCVPCYE 58


>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH).  The
          first LIM domain of Arrowhead (AWH): Arrowhead belongs
          to the LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Members of LHX family are found in the
          nucleus and act as transcription factors or cofactors.
          LHX proteins are critical for the development of
          specialized cells in multiple tissue types, including
          the nervous system, skeletal muscle, the heart, the
          kidneys, and endocrine organs, such as the pituitary
          gland and the pancreas. During embryogenesis of
          Drosophila, Arrowhead is expressed in each abdominal
          segment and in the labial segment. Late in embryonic
          development, expression of arrowhead is refined to the
          abdominal histoblasts and salivary gland imaginal ring
          cells themselves. The Arrowhead gene required for
          establishment of a subset of imaginal tissues: the
          abdominal histoblasts and the salivary gland imaginal
          rings. As in other LIM domains, this domain family is
          50-60 amino acids in size and shares two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 54

 Score = 25.0 bits (55), Expect = 6.1
 Identities = 11/33 (33%), Positives = 14/33 (42%)

Query: 18 HLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          H+ C  C  C   L +      RD  IYC+  Y
Sbjct: 22 HVSCLRCCVCQTPLERQPSCFTRDRQIYCKADY 54


>gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH.  The
          fifth LIM domain of protein PINCH:  PINCH plays pivotal
          roles in the assembly of focal adhesions (FAs),
          regulating diverse functions in cell adhesion, growth,
          and differentiation through LIM-mediated
          protein-protein interactions. PINCH comprises an array
          of five LIM domains that interact with integrin-linked
          kinase (ILK), Nck2 (also called Nckbeta or Grb4) and
          other interaction partners.  These interactions are
          essential for triggering the FA assembly and for
          relaying diverse mechanical and biochemical signals
          between Cell-extracellular matrix and the actin
          cytoskeleton. LIM domains are 50-60 amino acids in size
          and share two characteristic zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 54

 Score = 25.0 bits (55), Expect = 6.2
 Identities = 9/32 (28%), Positives = 12/32 (37%)

Query: 20 HCFTCISCGILLTKGDLFGMRDEMIYCRPHYE 51
            F+C  C   LT    F   D    C+  Y+
Sbjct: 23 DHFSCSFCDTKLTLKSKFYEFDMKPVCKKCYD 54


>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin.  The second
          LIM domain of Zyxin: Zyxin exhibits three copies of the
          LIM domain, an extensive proline-rich domain and a
          nuclear export signal.  Localized at sites of
          cellsubstratum adhesion in fibroblasts, Zyxin interacts
          with alpha-actinin, members of the cysteine-rich
          protein (CRP) family, proteins that display Src
          homology 3 (SH3) domains and Ena/VASP family members.
          Zyxin and its partners have been implicated in the
          spatial control of actin filament assembly as well as
          in pathways important for cell differentiation. In
          addition to its functions at focal adhesion plaques,
          recent work has shown that zyxin moves from the sites
          of cell contacts to the nucleus, where it directly
          participates in the regulation of gene expression. As
          in other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors o r scaffolds to support the
          assembly of multimeric protein.
          Length = 60

 Score = 25.3 bits (55), Expect = 6.2
 Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 4/53 (7%)

Query: 6  SELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHYEILRHRDY 58
          ++ +++A    +H  CFTC+ C   L        +    +C   Y    HR Y
Sbjct: 9  TDRMLKATGKSYHPQCFTCVVCKCPLEGESFIVDQANQPHCVNDY----HRRY 57


>gnl|CDD|99987 cd03817, GT1_UGDG_like, This family is most closely related to the
           GT1 family of glycosyltransferases.
           UDP-glucose-diacylglycerol glucosyltransferase (UGDG;
           also known as 1,2-diacylglycerol 3-glucosyltransferase)
           catalyzes the transfer of glucose from UDP-glucose to
           1,2-diacylglycerol forming
           3-D-glucosyl-1,2-diacylglycerol.
          Length = 374

 Score = 27.2 bits (61), Expect = 6.3
 Identities = 8/19 (42%), Positives = 16/19 (84%)

Query: 175 PDAKDLKQLAQKTGLSKRV 193
           P+ ++L++LA++ GL+ RV
Sbjct: 243 PEREELEELARELGLADRV 261


>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R;
           Provisional.
          Length = 1123

 Score = 27.2 bits (61), Expect = 6.4
 Identities = 12/70 (17%), Positives = 31/70 (44%), Gaps = 20/70 (28%)

Query: 147 HQRTKRM-----RTS--------FKHHQLRTMKSY---FNIN----QNPDAKDLKQLAQK 186
            +R +R+     R++        FK  ++   +++   ++I     + P+ +    +A  
Sbjct: 460 AKRFRRILFLVDRSALGEQAEDAFKDTKIEGDQTFASIYDIKGLEDKFPEDETKVHVATV 519

Query: 187 TGLSKRVLQN 196
            G+ KR+L +
Sbjct: 520 QGMVKRILYS 529


>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9
          family.  The first LIM domain of Lhx2 and Lhx9 family:
          Lhx2 and Lhx9 are highly homologous LHX regulatory
          proteins. They belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Although Lhx2 and Lhx9 are highly homologous, they
          seems to play regulatory roles in different organs.  In
          animals, Lhx2 plays important roles in eye, cerebral
          cortex, limb, the olfactory organs, and erythrocyte
          development. Lhx2 gene knockout mice exhibit impaired
          patterning of the cortical hem and the telencephalon of
          the developing brain, and a lack of development in
          olfactory structures. Lhx9 is expressed in several
          regions of the developing mouse brain , the spinal
          cord, the pancreas, in limb mesenchyme, and in the
          urogenital region. Lhx9 plays critical roles in gonad
          development.  Homozygous mice lacking functional Lhx9
          alleles exhibit numerous urogenital defects, such as
          gonadal agenesis, infertility, and undetectable levels
          of testosterone and estradiol coupled with high FSH
          levels. Lhx9 null mice are phenotypically female, even
          those that are genotypically male. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 54

 Score = 25.0 bits (55), Expect = 6.5
 Identities = 13/42 (30%), Positives = 17/42 (40%)

Query: 9  VMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
           + A D  +H  C  C  C + L        RD  IYC+  Y
Sbjct: 13 YLLAVDRQWHASCLKCCECRLPLDSELSCFSRDGNIYCKEDY 54


>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like
          proteins.  The second LIM domain of Ajuba-like
          proteins: Ajuba like LIM protein family includes three
          highly homologous proteins Ajuba, Limd1, and WTIP.
          Members of the family contain three tandem C-terminal
          LIM domains and a proline-rich N-terminal region. This
          family of proteins functions as scaffolds,
          participating in the assembly of numerous protein
          complexes. In the cytoplasm, Ajuba binds Grb2 to
          modulate serum-stimulated ERK activation. Ajuba also
          recruits the TNF receptor-associated factor 6 (TRAF6)
          to p62 and activates PKCKappa activity. Ajuba interacts
          with alpha-catenin and F-actin to contribute to the
          formation or stabilization of adheren junctions by
          linking adhesive receptors to the actin cytoskeleton.
          Although Ajuba is a cytoplasmic protein, it can shuttle
          into the nucleus. In nucleus, Ajuba functions as a
          corepressor for the zinc finger-protein Snail. It binds
          to the SNAG repression domain of Snail through its LIM
          region.  Arginine methyltransferase-5 (Prmt5), a
          protein in the complex, is recruited to Snai l through
          an interaction with Ajuba. This ternary complex
          functions to repress E-cadherin, a Snail target gene.
          In addition, Ajuba contains functional nuclear-receptor
          interacting motifs and selectively interacts with
          retinoic acid receptors (RARs) and rexinoid receptor
          (RXRs) to negatively regulate retinoic acid signaling.
          Wtip, the Wt1-interacting protein, was originally
          identified as an interaction partner of the Wilms
          tumour protein 1 (WT1). Wtip is involved in kidney and
          neural crest development. Wtip interacts with the
          receptor tyrosine kinase Ror2 and inhibits canonical
          Wnt signaling. LIMD1 was reported to inhibit cell
          growth and metastases. The inhibition may be mediated
          through an interaction with the protein
          barrier-to-autointegration (BAF), a component of
          SWI/SNF chromatin-remodeling protein; or through the
          interaction with retinoblastoma protein (pRB),
          resulting in inhibition of E2F-mediated transcription,
          and expression of the majority of genes with E2F1-
          responsive elements. Recently, Limd1 was shown to
          interact with the p62/sequestosome protein and
          influence IL-1 and RANKL signaling by facilitating the
          assembly of a p62/TRAF6/a-PKC multi-protein complex.
          The Limd1-p62 interaction affects both NF-kappaB and
          AP-1 activity in epithelial cells and osteoclasts.
          Moreover, LIMD1 functions as tumor repressor to block
          lung tumor cell line in vitro and in vivo. Recent
          studies revealed that LIM proteins Wtip, LIMD1 and
          Ajuba interact with components of RNA induced silencing
          complexes (RISC) as well as eIF4E and the mRNA m7GTP
          cap-protein complex and are required for
          microRNA-mediated gene silencing.  As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 25.0 bits (55), Expect = 7.6
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 7  ELVMRARDLVFHLHCFTCISCGILLTKGDLFGM-RDEMIYCRPHY 50
          E++++A    +H  CF C  C   L  G  F +  +  IYC   Y
Sbjct: 10 EMILQALGKSYHPGCFRCCVCNECL-DGVPFTVDVENNIYCVKDY 53


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
          Provisional.
          Length = 353

 Score = 26.7 bits (59), Expect = 8.4
 Identities = 14/46 (30%), Positives = 16/46 (34%), Gaps = 12/46 (26%)

Query: 66 QPMSPRPAPWQPTTVQKGRPRKR------------KLSVDSPTPPS 99
          QP    P P       K RPR+R             L+V  P PP 
Sbjct: 5  QPPPGVPLPSTARHTTKSRPRRRPDLTLPLPQRDPSLAVPLPLPPP 50


>gnl|CDD|188743 cd09357, LIM3_Zyxin_like, The third LIM domain of Zyxin-like
          family.  The third LIM domain of Zyxin like family:
          This family includes Ajuba, Limd1, WTIP, Zyxin, LPP,
          and Trip6 LIM proteins. Members of Zyxin family contain
          three tandem C-terminal LIM domains, and a proline-rich
          N-terminal region.  Zyxin proteins are detected
          primarily in focal adhesion plaques. They function as
          scaffolds, participating in the assembly of multiple
          interactions and signal transduction networks, which
          regulate cell adhesion, spreading, and motility. They
          can also shuffle into nucleus.  In nucleus, zyxin
          proteins affect gene transcription by interaction with
          a variety of nuclear proteins, including several
          transcription factors, playing regulating roles in cell
          proliferation, differentiation and apoptosis. As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 63

 Score = 25.1 bits (55), Expect = 8.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 12 ARDLVFHLHCFTCISCGILLTKGD 35
          A D  FH++C+ C  CG+LL+  D
Sbjct: 22 ALDRSFHVNCYKCEDCGMLLSSED 45


>gnl|CDD|188807 cd09423, LIM1_FHL3, The first LIM domain of Four and a half LIM
          domains protein 3 (FHL3).  The first LIM domain of Four
          and a half LIM domains protein 3 (FHL3):  FHL3 is
          highly expressed in the skeleton and cardiac muscles
          and possesses the transactivation and repression
          activities. FHL3 interacts with many transcription
          factors, such as CREB, BKLF/KLF3, CtBP2, MyoD, and
          MZF_1. Moreover, FHL3 interacts with alpha- and
          beta-subunits of the muscle alpha7beta1 integrin
          receptor. FHL3 was also proved to possess the
          auto-activation ability and was confirmed that the
          second zinc finger motif in fourth LIM domain was
          responsible for the auto-activation of FHL3. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 59

 Score = 24.9 bits (54), Expect = 8.7
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 3/50 (6%)

Query: 1  MGISSSELVMRARDLVFHLHCFTCISCGILLTKGDLFGMRDEMIYCRPHY 50
          +G  S EL    R   +H HCF C  C   L   + F  +DE + C   Y
Sbjct: 12 IGHDSRELYYEDRH--YHEHCFRCFRCDRSLAD-EPFTCQDEELLCNDCY 58


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.131    0.394 

Gapped
Lambda     K      H
   0.267   0.0760    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 9,687,588
Number of extensions: 853569
Number of successful extensions: 997
Number of sequences better than 10.0: 1
Number of HSP's gapped: 984
Number of HSP's successfully gapped: 125
Length of query: 196
Length of database: 10,937,602
Length adjustment: 92
Effective length of query: 104
Effective length of database: 6,857,034
Effective search space: 713131536
Effective search space used: 713131536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (25.3 bits)