Diaphorina citri psyllid: psy17517


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
ALAQNQSAQAFLGPENPEEPYLQGVNYNCVAPGKRFQPMTNLSGGEKTVAALALLFAIHRIATIRSLGLEDLRSMALAQNQSAQAFLGPENPEEPYLQGVNYNCVAPGKRFQPMTNLSGGEKTVAALALLFAIHSYHPAPFFVLDEIDAALDNTNIGKVASYI
ccccccccEEEEEEccccccccccccEEECccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCEEEEccccccccccccEEEECccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHcc
**AQNQSAQAFLGPENPEEPYLQGVNYNCVAPGKRFQPMTNLSGGEKTVAALALLFAIHRIATIRSLGLEDLRSMALAQNQSAQAFLGPENPEEPYLQGVNYNCVAPGKRFQPMTNLSGGEKTVAALALLFAIHSYHPAPFFVLDEIDAALDNTNIGKVASYI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALAQNQSAQAFLGPENPEEPYLQGVNYNCVAPGKRFQPMTNLSGGEKTVAALALLFAIHRIATIRSLGLEDLRSMALAQNQSAQAFLGPENPEEPYLQGVNYNCVAPGKRFQPMTNLSGGEKTVAALALLFAIHSYHPAPFFVLDEIDAALDNTNIGKVASYI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, and works as a downstream effector in the ATM/NBS1 branch of S-phase checkpoint (By similarity). Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.confidentQ9CU62
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.confidentQ9Z1M9
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, and works as a downstream effector in the ATM/NBS1 branch of S-phase checkpoint (By similarity). Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.confidentO97593

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingconfidentGO:0003674
GO:0031981 [CC]nuclear lumenconfidentGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0030893 [CC]meiotic cohesin complexconfidentGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0008278, GO:0044422
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0000800 [CC]lateral elementprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0000795, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0035327 [CC]transcriptionally active chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032876 [BP]negative regulation of DNA endoreduplicationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0010948, GO:0090329, GO:0050789, GO:0051052, GO:0010605, GO:0019222, GO:0010564, GO:2000113, GO:0060255, GO:0065007, GO:0031326, GO:0048519, GO:0051053, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008156, GO:0008150, GO:0051171, GO:0051172, GO:0032875, GO:0051726, GO:2000104, GO:0006275, GO:0010556, GO:0010558, GO:0048523
GO:0000075 [BP]cell cycle checkpointprobableGO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901988, GO:0048519, GO:0050789, GO:0048523
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0034991 [CC]nuclear meiotic cohesin complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0008278, GO:0044446, GO:0031981, GO:0005634, GO:0043226, GO:0044454, GO:0005694, GO:0030893, GO:0000793, GO:0000794, GO:0000798, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0042770 [BP]signal transduction in response to DNA damageprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0036033 [MF]mediator complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0000236 [BP]mitotic prometaphaseprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0007049, GO:0022403
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0008280 [CC]cohesin core heterodimerprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0008278, GO:0044422
GO:0016322 [BP]neuron remodelingprobableGO:0032502, GO:0030154, GO:0048468, GO:0007569, GO:0010259, GO:0007275, GO:0044699, GO:0042551, GO:0048869, GO:0008150, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0000087 [BP]M phase of mitotic cell cycleprobableGO:0044699, GO:0000279, GO:0000278, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0007049
GO:0000796 [CC]condensin complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0007076 [BP]mitotic chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0016043, GO:0007067, GO:0044699, GO:0006139, GO:0044260, GO:1901360, GO:0000280, GO:0006323, GO:0071704, GO:0071840, GO:0000278, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0007059, GO:0046483, GO:0006996, GO:0030261, GO:0007049, GO:0000070, GO:0000819, GO:0051276, GO:0044237, GO:0043170, GO:0048285, GO:0006259, GO:0044763
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000777 [CC]condensed chromosome kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0000793, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000779, GO:0043229, GO:0043228, GO:0044422, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0000776
GO:0006310 [BP]DNA recombinationprobableGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0007091 [BP]metaphase/anaphase transition of mitotic cell cycleprobableGO:0006996, GO:0044699, GO:0000278, GO:0008150, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0044770, GO:0044772, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0044784, GO:0007049
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007064 [BP]mitotic sister chromatid cohesionprobableGO:0006996, GO:0044699, GO:0000070, GO:0000819, GO:0051276, GO:0000280, GO:0000278, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0071840, GO:0007059, GO:0007067, GO:0007049, GO:0007062
GO:0007126 [BP]meiosisprobableGO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0034990 [CC]nuclear mitotic cohesin complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0008278, GO:0044446, GO:0031981, GO:0005634, GO:0043226, GO:0044454, GO:0005694, GO:0030892, GO:0000793, GO:0000794, GO:0000798, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0016319 [BP]mushroom body developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0010165 [BP]response to X-rayprobableGO:0008150, GO:0009314, GO:0050896, GO:0010212, GO:0009628
GO:0003680 [MF]AT DNA bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0032116 [CC]SMC loading complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0000217 [MF]DNA secondary structure bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KTA, chain B
Confidence level:very confident
Coverage over the Query: 97-162
View the alignment between query and template
View the model in PyMOL
Template: 4F4C, chain A
Confidence level:very confident
Coverage over the Query: 8-162
View the alignment between query and template
View the model in PyMOL