BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17526
         (70 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation
           Factor Viia Mutant In Complex With Soluble Tissue Factor
          Length = 254

 Score = 25.8 bits (55), Expect = 6.4,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 6/32 (18%)

Query: 30  VSGLYSWCQGCSHGGH------LSHMQEWFMK 55
           ++G+ SW QGC+  GH      +S   EW  K
Sbjct: 206 LTGIVSWGQGCATVGHFGVYTRVSQYIEWLQK 237


>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation
           Factor Viia With Human Recombinant Soluble Tissue Factor
 pdb|1QFK|H Chain H, Structure Of Human Factor Viia And Its Implications For
           The Triggering Of Blood Coagulation
 pdb|1CVW|H Chain H, Crystal Structure Of Active Site-inhibited Human
           Coagulation Factor Viia (des-gla)
 pdb|1FAK|H Chain H, Human Tissue Factor Complexed With Coagulation Factor Viia
           Inhibited With A Bpti-Mutant
 pdb|1DVA|H Chain H, Crystal Structure Of The Complex Between The Peptide
           Exosite Inhibitor E-76 And Coagulation Factor Viia
 pdb|1DVA|I Chain I, Crystal Structure Of The Complex Between The Peptide
           Exosite Inhibitor E-76 And Coagulation Factor Viia
 pdb|1JBU|H Chain H, Coagulation Factor Vii Zymogen (Egf2PROTEASE) IN COMPLEX
           WITH Inhibitory Exosite Peptide A-183
 pdb|1KLI|H Chain H, Cofactor-And Substrate-Assisted Activation Of Factor Viia
 pdb|1KLJ|H Chain H, Crystal Structure Of Uninhibited Factor Viia
 pdb|1J9C|H Chain H, Crystal Structure Of Tissue Factor-Factor Viia Complex
 pdb|1W0Y|H Chain H, Tf7a_3771 Complex
 pdb|1YGC|H Chain H, Short Factor Viia With A Small Molecule Inhibitor
 pdb|1Z6J|H Chain H, Crystal Structure Of A Ternary Complex Of Factor
           Viia/tissue Factor/pyrazinone Inhibitor
 pdb|1W2K|H Chain H, Tf7a_4380 Complex
 pdb|1WQV|H Chain H, Human Factor Viia-Tissue Factor Complexed With
           Propylsulfonamide-D- Thr-Met-P-Aminobenzamidine
 pdb|1W7X|H Chain H, Factor7- 413 Complex
 pdb|1W8B|H Chain H, Factor7 - 413 Complex
 pdb|1WSS|H Chain H, Human Factor Viia-Tissue Factor In Complex With Peprid
           Mimetic Inhibitor That Has Two Charge Groups In P2 And
           P4
 pdb|1WTG|H Chain H, Human Factor Viia-Tissue Factor Complexed With
           Ethylsulfonamide-D-Biphenylalanine-Gln-P-
           Aminobenzamidine
 pdb|1WUN|H Chain H, Human Factor Viia-Tissue Factor Complexed With
           Ethylsulfonamide-D-Trp-Gln-P-Aminobenzamidine
 pdb|1WV7|H Chain H, Human Factor Viia-tissue Factor Complexed With
           Ethylsulfonamide-d-5-propoxy-trp-gln-p-aminobenzamidine
 pdb|2B7D|H Chain H, Factor Viia Inhibitors: Chemical Optimization, Preclinical
           Pharmacokinetics, Pharmacodynamics, And Efficacy In A
           Baboon Thrombosis Model
 pdb|2F9B|H Chain H, Discovery Of Novel Heterocyclic Factor Viia Inhibitors
 pdb|2FLB|H Chain H, Discovery Of A Novel Hydroxy Pyrazole Based Factor Ixa
           Inhibitor
 pdb|2A2Q|H Chain H, Complex Of Active-Site Inhibited Human Coagulation Factor
           Viia With Human Soluble Tissue Factor In The Presence Of
           Ca2+, Mg2+, Na+, And Zn2+
 pdb|2AER|H Chain H, Crystal Structure Of Benzamidine-Factor ViiaSOLUBLE TISSUE
           Factor Complex.
 pdb|2AEI|H Chain H, Crystal Structure Of A Ternary Complex Of Factor
           ViiaTISSUE FACTOR And
           2-[[6-[3-(Aminoiminomethyl)phenoxy]-3,
           5-Difluro-4-[(1-Methyl-3-
           Phenylpropyl)amino]-2-Pyridinyl]oxy]-Benzoic Acid
 pdb|2FIR|H Chain H, Crystal Structure Of Dfpr-ViiaSTF
 pdb|2C4F|H Chain H, Crystal Structure Of Factor Vii.Stf Complexed With
           Pd0297121
 pdb|2FLR|H Chain H, Novel 5-azaindole Factor Viia Inhibitors
 pdb|2B8O|H Chain H, Crystal Structure Of Glu-gly-arg-chloromethyl
           Ketone-factor Viia/soluble Tissue Factor Complex
 pdb|2PUQ|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation
           Factor Viia In Complex With Soluble Tissue Factor
 pdb|2EC9|H Chain H, Crystal Structure Analysis Of Human Factor Viia , Souluble
           Tissue Factor Complexed With Bcx-3607
 pdb|2ZP0|H Chain H, Human Factor Viia-Tissue Factor Complexed With
           Benzylsulfonamide-D- Ile-Gln-P-Aminobenzamidine
 pdb|2ZWL|H Chain H, Human Factor Viia-Tissue Factor Complexed With Highly
           Selective Peptide Inhibitor
 pdb|2ZZU|H Chain H, Human Factor Viia-Tissue Factor Complexed With
           Ethylsulfonamide-D-5-
           (3-Carboxybenzyloxy)-Trp-Gln-P-Aminobenzamidine
 pdb|3TH2|H Chain H, Mg2+ Is Required For Optimal Folding Of The
           Gamma-Carboxyglutamic Acid (Gla) Domains Of Vitamin
           K-Dependent Clotting Factors At Physiological Ca2+
 pdb|3TH3|H Chain H, Mg2+ Is Required For Optimal Folding Of The
           Gamma-Carboxyglutamic Acid (Gla) Domains Of Vitamin
           K-Dependent Clotting Factors At Physiological Ca2+
 pdb|3TH4|H Chain H, Mg2+ Is Required For Optimal Folding Of The
           Gamma-Carboxyglutamic Acid (Gla) Domains Of Vitamin
           K-Dependent Clotting Factors At Physiological Ca2+
 pdb|1O5D|H Chain H, Dissecting And Designing Inhibitor Selectivity
           Determinants At The S1 Site Using An Artificial Ala190
           Protease (Ala190 Upa)
 pdb|2BZ6|H Chain H, Orally Available Factor7a Inhibitor
 pdb|4ISI|H Chain H, Structure Of Factor Viia In Complex With The Inhibitor
           (6s)-n-(4-
           Carbamimidoylbenzyl)-1-chloro-3-(cyclobutylamino)-8,
           8-diethyl-4-oxo-
           4,6,7,8-tetrahydropyrrolo[1,2-a]pyrazine-6-carboxamide
          Length = 254

 Score = 25.8 bits (55), Expect = 6.5,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 6/32 (18%)

Query: 30  VSGLYSWCQGCSHGGH------LSHMQEWFMK 55
           ++G+ SW QGC+  GH      +S   EW  K
Sbjct: 206 LTGIVSWGQGCATVGHFGVYTRVSQYIEWLQK 237


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.519 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,429,482
Number of Sequences: 62578
Number of extensions: 79848
Number of successful extensions: 290
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 290
Number of HSP's gapped (non-prelim): 3
length of query: 70
length of database: 14,973,337
effective HSP length: 40
effective length of query: 30
effective length of database: 12,470,217
effective search space: 374106510
effective search space used: 374106510
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)