Query         psy17526
Match_columns 70
No_of_seqs    109 out of 361
Neff          6.3 
Searched_HMMs 46136
Date          Sat Aug 17 00:49:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17526.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17526hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0269|consensus               99.4 4.4E-14 9.6E-19  109.5   2.9   69    1-69    752-829 (839)
  2 KOG0309|consensus               99.3 1.8E-12   4E-17  101.2   1.8   46   24-69   1032-1077(1081)
  3 PF13639 zf-RING_2:  Ring finge  97.6 1.6E-05 3.5E-10   41.4   0.0   37   25-61      5-42  (44)
  4 PF12678 zf-rbx1:  RING-H2 zinc  97.4  0.0001 2.2E-09   42.6   1.7   27   35-61     45-71  (73)
  5 cd00162 RING RING-finger (Real  96.4  0.0029 6.2E-08   31.3   2.1   26   36-61     14-40  (45)
  6 COG5194 APC11 Component of SCF  95.9  0.0064 1.4E-07   36.6   2.0   23   39-61     53-75  (88)
  7 PF13923 zf-C3HC4_2:  Zinc fing  95.8  0.0035 7.5E-08   31.7   0.6   36   25-61      3-38  (39)
  8 smart00184 RING Ring finger. E  95.6   0.014 2.9E-07   27.7   2.3   25   37-61     13-38  (39)
  9 PHA02929 N1R/p28-like protein;  95.4   0.017 3.7E-07   40.4   3.0   27   35-61    195-221 (238)
 10 KOG2930|consensus               94.8   0.017 3.6E-07   36.3   1.4   24   38-61     79-102 (114)
 11 COG5243 HRD1 HRD ubiquitin lig  94.5   0.026 5.7E-07   42.4   2.1   24   38-61    316-339 (491)
 12 PF12861 zf-Apc11:  Anaphase-pr  93.9   0.047   1E-06   32.9   2.0   23   39-61     51-76  (85)
 13 PF13248 zf-ribbon_3:  zinc-rib  93.8   0.042   9E-07   25.8   1.3   21    1-21      1-21  (26)
 14 PF13719 zinc_ribbon_5:  zinc-r  93.2    0.03 6.5E-07   28.4   0.3   35    1-44      1-35  (37)
 15 KOG0802|consensus               92.9   0.061 1.3E-06   40.9   1.7   25   37-61    311-335 (543)
 16 PF11793 FANCL_C:  FANCL C-term  92.8   0.016 3.5E-07   33.1  -1.1   23   33-55     19-43  (70)
 17 KOG4628|consensus               92.6    0.07 1.5E-06   39.3   1.6   41   24-65    233-275 (348)
 18 PF12773 DZR:  Double zinc ribb  92.2   0.057 1.2E-06   28.4   0.6   17    5-21      1-17  (50)
 19 PF00097 zf-C3HC4:  Zinc finger  91.7    0.13 2.9E-06   25.6   1.6   26   36-61     13-40  (41)
 20 PF13717 zinc_ribbon_4:  zinc-r  91.5   0.062 1.3E-06   27.2   0.2   34    1-43      1-34  (36)
 21 PF11789 zf-Nse:  Zinc-finger o  90.5   0.099 2.1E-06   28.9   0.4   27   38-64     28-57  (57)
 22 PF13240 zinc_ribbon_2:  zinc-r  89.4    0.22 4.8E-06   22.9   1.1   17    4-20      1-17  (23)
 23 KOG0827|consensus               87.9    0.32 6.9E-06   36.8   1.6   24   38-61     24-50  (465)
 24 COG5540 RING-finger-containing  87.5     0.3 6.5E-06   35.9   1.3   38   24-61    327-366 (374)
 25 smart00504 Ubox Modified RING   87.0    0.38 8.2E-06   25.8   1.2   24   38-61     17-40  (63)
 26 PF13920 zf-C3HC4_3:  Zinc fing  86.8    0.41 8.9E-06   25.1   1.2   26   36-61     16-42  (50)
 27 PF14634 zf-RING_5:  zinc-RING   86.1    0.73 1.6E-05   23.6   2.0   27   35-61     15-41  (44)
 28 PLN03208 E3 ubiquitin-protein   85.9     0.6 1.3E-05   31.9   2.0   29   24-54     22-50  (193)
 29 COG5219 Uncharacterized conser  84.6    0.68 1.5E-05   38.8   2.1   27   35-61   1489-1517(1525)
 30 smart00744 RINGv The RING-vari  84.5    0.88 1.9E-05   24.2   1.9   21   41-61     25-47  (49)
 31 TIGR00599 rad18 DNA repair pro  83.9     1.1 2.4E-05   33.6   2.7   36   24-61     30-65  (397)
 32 PF09889 DUF2116:  Uncharacteri  80.9    0.84 1.8E-05   25.6   0.9   19    3-21      4-22  (59)
 33 PHA02926 zinc finger-like prot  80.6     1.5 3.3E-05   30.9   2.3   29   33-61    190-224 (242)
 34 KOG0317|consensus               80.4     1.5 3.2E-05   31.8   2.2   26   36-61    253-278 (293)
 35 TIGR02098 MJ0042_CXXC MJ0042 f  75.9     1.2 2.6E-05   22.0   0.6   12    1-12      1-12  (38)
 36 PF06906 DUF1272:  Protein of u  75.4     2.4 5.3E-05   23.7   1.7   43    1-43      4-50  (57)
 37 PF04606 Ogr_Delta:  Ogr/Delta-  75.3     1.4   3E-05   23.2   0.7   34    4-43      1-36  (47)
 38 PF01096 TFIIS_C:  Transcriptio  74.2     1.3 2.9E-05   22.5   0.4   13   31-43     25-37  (39)
 39 PRK14559 putative protein seri  74.1     1.3 2.9E-05   34.9   0.6   43    3-45      2-52  (645)
 40 KOG0320|consensus               73.7     2.5 5.4E-05   28.8   1.8   41   24-65    135-175 (187)
 41 PF15227 zf-C3HC4_4:  zinc fing  73.1     2.8   6E-05   21.5   1.5   24   38-61     14-41  (42)
 42 PRK14890 putative Zn-ribbon RN  72.9     1.9 4.1E-05   24.3   0.9    9    4-12      9-17  (59)
 43 PF10571 UPF0547:  Uncharacteri  72.1     2.5 5.4E-05   19.9   1.1   16    4-19      2-17  (26)
 44 KOG1493|consensus               71.5     1.1 2.3E-05   26.8  -0.3   23   39-61     50-75  (84)
 45 smart00661 RPOL9 RNA polymeras  70.4     3.3 7.1E-05   21.5   1.5   11    4-14      2-12  (52)
 46 PF07649 C1_3:  C1-like domain;  69.5       2 4.4E-05   20.3   0.4   25   25-49      5-30  (30)
 47 PF09297 zf-NADH-PPase:  NADH p  69.1     2.2 4.9E-05   20.5   0.6   11    2-12      3-13  (32)
 48 smart00440 ZnF_C2C2 C2C2 Zinc   68.7     3.5 7.6E-05   21.0   1.3   16   27-43     22-37  (40)
 49 KOG0828|consensus               65.4     3.1 6.7E-05   32.6   1.0   25   37-61    603-628 (636)
 50 PRK05654 acetyl-CoA carboxylas  60.4     9.1  0.0002   27.4   2.6   33   29-65     22-54  (292)
 51 TIGR01206 lysW lysine biosynth  60.0     5.2 0.00011   22.0   1.0   12    1-12      1-12  (54)
 52 TIGR00515 accD acetyl-CoA carb  58.5      10 0.00023   27.1   2.6   32   30-65     22-53  (285)
 53 PF08209 Sgf11:  Sgf11 (transcr  57.4       3 6.4E-05   20.8  -0.3   11    2-12      4-14  (33)
 54 PF14353 CpXC:  CpXC protein     57.2     5.4 0.00012   24.5   0.9   46    3-48      2-52  (128)
 55 PF14392 zf-CCHC_4:  Zinc knuck  56.2     5.5 0.00012   20.9   0.7   17   31-47     28-44  (49)
 56 PF12906 RINGv:  RING-variant d  54.7     5.4 0.00012   20.9   0.5   19   43-61     26-46  (47)
 57 KOG2691|consensus               54.7     6.5 0.00014   24.8   0.9   16   28-43     95-110 (113)
 58 PF06677 Auto_anti-p27:  Sjogre  54.7     5.6 0.00012   20.6   0.5   14    1-14     16-29  (41)
 59 cd04476 RPA1_DBD_C RPA1_DBD_C:  53.5       6 0.00013   25.3   0.6   22    2-23     34-58  (166)
 60 CHL00174 accD acetyl-CoA carbo  52.2     9.8 0.00021   27.5   1.6   38   24-65     28-65  (296)
 61 PF14803 Nudix_N_2:  Nudix N-te  52.2       6 0.00013   19.7   0.4    9    4-12      2-10  (34)
 62 PF06827 zf-FPG_IleRS:  Zinc fi  51.8     4.9 0.00011   18.9   0.0   12    3-14      2-13  (30)
 63 COG1645 Uncharacterized Zn-fin  51.2     5.4 0.00012   25.7   0.2   12    2-13     28-39  (131)
 64 KOG0823|consensus               50.8     9.7 0.00021   26.8   1.4   38   24-64     51-91  (230)
 65 COG1885 Uncharacterized protei  50.0     8.8 0.00019   24.2   0.9   13    2-14     49-61  (115)
 66 smart00834 CxxC_CXXC_SSSS Puta  48.8     8.7 0.00019   18.8   0.7   11    3-13     27-37  (41)
 67 COG2888 Predicted Zn-ribbon RN  47.1     9.3  0.0002   21.7   0.7   10    3-12     10-19  (61)
 68 COG1571 Predicted DNA-binding   46.1      13 0.00027   28.3   1.4   22    2-23    350-374 (421)
 69 KOG2041|consensus               45.5     6.2 0.00013   32.6  -0.3   55    3-61   1118-1179(1189)
 70 PF04981 NMD3:  NMD3 family ;    45.0     9.3  0.0002   26.1   0.6   38    5-42      1-43  (236)
 71 PF04032 Rpr2:  RNAse P Rpr2/Rp  44.6     7.1 0.00015   22.1  -0.1   39    2-42     46-85  (85)
 72 PHA00626 hypothetical protein   44.0      11 0.00025   21.1   0.7   17    3-20      1-18  (59)
 73 KOG1952|consensus               43.4     7.4 0.00016   32.2  -0.1   32   24-55    195-228 (950)
 74 PF01927 Mut7-C:  Mut7-C RNAse   43.1      28  0.0006   22.1   2.5   49    2-51     91-145 (147)
 75 PF03884 DUF329:  Domain of unk  43.0     6.9 0.00015   21.8  -0.3   13    1-13      1-13  (57)
 76 PF07754 DUF1610:  Domain of un  42.7      12 0.00026   17.4   0.6    7    4-10     18-24  (24)
 77 PF13445 zf-RING_UBOX:  RING-ty  42.4      15 0.00033   19.0   1.0   19   38-56     17-35  (43)
 78 COG2816 NPY1 NTP pyrophosphohy  42.2      20 0.00043   25.8   1.9   11    2-12    111-121 (279)
 79 PF01530 zf-C2HC:  Zinc finger,  42.1      13 0.00028   18.3   0.7    8   57-64      2-10  (31)
 80 PRK02048 4-hydroxy-3-methylbut  42.1      10 0.00022   30.1   0.4   11    2-12    518-528 (611)
 81 PF04423 Rad50_zn_hook:  Rad50   40.8     7.6 0.00016   20.6  -0.3   12    4-15     22-33  (54)
 82 PF10122 Mu-like_Com:  Mu-like   40.7     7.4 0.00016   21.3  -0.4   13    3-15      5-17  (51)
 83 PRK14810 formamidopyrimidine-D  40.5      14 0.00031   25.8   1.0    9    4-12    246-254 (272)
 84 PF01396 zf-C4_Topoisom:  Topoi  40.3      13 0.00027   18.8   0.5   10    3-12      2-11  (39)
 85 KOG0826|consensus               40.2      22 0.00048   26.4   1.9   24   33-64    320-344 (357)
 86 KOG1734|consensus               40.1      15 0.00032   26.9   1.0   27   35-61    247-275 (328)
 87 PRK00420 hypothetical protein;  40.1      16 0.00034   22.9   1.0   21    1-21     22-45  (112)
 88 PHA02862 5L protein; Provision  39.9      28 0.00061   23.1   2.2   21   41-61     25-47  (156)
 89 PRK13945 formamidopyrimidine-D  39.8      16 0.00034   25.7   1.1   10    4-13    256-265 (282)
 90 PF04475 DUF555:  Protein of un  39.7      17 0.00036   22.6   1.0   14    2-15     47-60  (102)
 91 PF08746 zf-RING-like:  RING-li  39.0      23 0.00051   18.2   1.4   27   35-61     12-42  (43)
 92 TIGR03826 YvyF flagellar opero  38.6      16 0.00034   23.6   0.9   22    1-23     80-101 (137)
 93 PF07282 OrfB_Zn_ribbon:  Putat  38.2      30 0.00065   18.8   1.9   20   32-51     44-63  (69)
 94 PRK14811 formamidopyrimidine-D  37.9      18 0.00038   25.4   1.1   28    4-43    237-264 (269)
 95 PF13408 Zn_ribbon_recom:  Reco  37.5      12 0.00027   19.3   0.2   10    3-12      6-15  (58)
 96 PF06750 DiS_P_DiS:  Bacterial   37.3      25 0.00055   20.9   1.6   11    2-12     33-43  (92)
 97 PF14260 zf-C4pol:  C4-type zin  37.3      21 0.00046   19.8   1.2   37    5-41      1-52  (73)
 98 PF03942 DTW:  DTW domain;  Int  36.5      24 0.00051   23.3   1.5   19    1-21      1-19  (203)
 99 PRK03922 hypothetical protein;  36.4      20 0.00043   22.6   1.0   14    2-15     49-62  (113)
100 PF03119 DNA_ligase_ZBD:  NAD-d  36.3      13 0.00028   17.6   0.1   10    4-13      1-10  (28)
101 COG1997 RPL43A Ribosomal prote  36.2      22 0.00047   21.6   1.1   20    4-23     37-60  (89)
102 PF13005 zf-IS66:  zinc-finger   35.9      17 0.00036   18.4   0.5   14    3-16      3-16  (47)
103 PRK00398 rpoP DNA-directed RNA  35.4      15 0.00033   18.8   0.4   10    3-12     22-31  (46)
104 PF09723 Zn-ribbon_8:  Zinc rib  34.7      18 0.00039   18.4   0.6    8    3-10     27-34  (42)
105 PRK01103 formamidopyrimidine/5  34.2      21 0.00045   24.9   0.9   10    4-13    247-256 (274)
106 smart00290 ZnF_UBP Ubiquitin C  34.1      29 0.00062   17.6   1.3   22   34-55     11-36  (50)
107 PRK10445 endonuclease VIII; Pr  33.8      22 0.00047   24.8   1.0   11    3-13    236-246 (263)
108 PF13453 zf-TFIIB:  Transcripti  33.5      19 0.00041   18.0   0.5   11    4-14      1-11  (41)
109 COG4068 Uncharacterized protei  33.4      21 0.00046   20.2   0.7   19    3-21      9-27  (64)
110 COG5432 RAD18 RING-finger-cont  33.0      37 0.00081   25.2   2.1   24   38-61     41-64  (391)
111 PF07227 DUF1423:  Protein of u  32.7      18 0.00038   27.8   0.4   30   24-53    132-165 (446)
112 PRK12366 replication factor A;  32.3      17 0.00037   28.6   0.3   23    1-23    531-555 (637)
113 COG0777 AccD Acetyl-CoA carbox  32.3      32  0.0007   25.0   1.7   31   31-65     25-55  (294)
114 KOG2906|consensus               32.3      18 0.00038   22.6   0.3   10    3-12      2-11  (105)
115 PRK09678 DNA-binding transcrip  32.1      43 0.00094   19.3   1.9   35    3-43      2-38  (72)
116 PF10892 DUF2688:  Protein of u  31.7      13 0.00029   20.8  -0.3   11    2-12     10-20  (60)
117 PRK00694 4-hydroxy-3-methylbut  31.2      18  0.0004   28.7   0.3   13    1-13    509-521 (606)
118 PF14787 zf-CCHC_5:  GAG-polypr  30.9      24 0.00051   18.0   0.6   10    3-12      3-12  (36)
119 PF15288 zf-CCHC_6:  Zinc knuck  30.3      30 0.00064   18.0   0.9   19   36-61      3-21  (40)
120 PRK11088 rrmA 23S rRNA methylt  30.1      31 0.00068   23.6   1.3   21    1-21      1-23  (272)
121 PRK05767 rpl44e 50S ribosomal   30.1      26 0.00056   21.3   0.8   12    2-13      8-19  (92)
122 COG4830 RPS26B Ribosomal prote  29.9      25 0.00055   21.9   0.7   20    2-21     20-39  (108)
123 PTZ00157 60S ribosomal protein  29.8      27 0.00057   21.0   0.8   12    2-13      9-20  (84)
124 PTZ00166 DNA polymerase delta   29.7      41 0.00088   28.2   2.0   43    2-45    960-1017(1054)
125 PHA02825 LAP/PHD finger-like p  29.6      64  0.0014   21.6   2.6   23   39-61     24-53  (162)
126 KOG4718|consensus               28.8      51  0.0011   23.2   2.1   27   35-61    195-221 (235)
127 PHA02776 E7 protein; Provision  28.0      34 0.00073   21.1   1.0   38    3-41     59-98  (101)
128 COG2023 RPR2 RNase P subunit R  27.8      25 0.00054   21.9   0.4   36    2-44     56-92  (105)
129 PRK02935 hypothetical protein;  27.2      26 0.00056   22.0   0.4   11    2-12     70-80  (110)
130 PF06524 NOA36:  NOA36 protein;  27.1      33 0.00072   25.0   1.0   39    4-45    173-220 (314)
131 TIGR00577 fpg formamidopyrimid  27.0      22 0.00048   24.8   0.1    9    4-12    247-255 (272)
132 PRK13130 H/ACA RNA-protein com  26.9      43 0.00094   18.5   1.3   11    2-12     17-27  (56)
133 KOG2612|consensus               26.9      31 0.00067   21.2   0.7   12    1-12     73-84  (103)
134 TIGR03037 anthran_nbaC 3-hydro  26.6      62  0.0013   21.4   2.2   33   29-61    109-156 (159)
135 PRK13264 3-hydroxyanthranilate  26.3      60  0.0013   21.9   2.1   35   29-64    115-164 (177)
136 PF08646 Rep_fac-A_C:  Replicat  26.0      28 0.00061   21.7   0.5   22    2-23     18-44  (146)
137 PF11023 DUF2614:  Protein of u  25.6      27 0.00059   22.1   0.3   11    2-12     69-79  (114)
138 PF13913 zf-C2HC_2:  zinc-finge  25.3      37 0.00081   15.3   0.7   10    3-12      3-12  (25)
139 TIGR03823 FliZ flagellar regul  25.2      24 0.00053   23.6   0.1   19    2-21     22-40  (168)
140 TIGR00570 cdk7 CDK-activating   25.2      93   0.002   22.8   3.0   25   39-64     25-50  (309)
141 PLN02925 4-hydroxy-3-methylbut  25.0      31 0.00067   28.1   0.6   14    1-14    633-646 (733)
142 PF02150 RNA_POL_M_15KD:  RNA p  24.9      26 0.00056   17.3   0.1   10    3-12      2-11  (35)
143 PF02148 zf-UBP:  Zn-finger in   24.7      15 0.00032   20.1  -0.9   24   32-55      9-36  (63)
144 PRK11582 flagella biosynthesis  24.3      27 0.00059   23.4   0.2   19    2-21     22-40  (169)
145 PRK08402 replication factor A;  24.2      26 0.00056   25.8   0.0   21    1-21    211-235 (355)
146 PF12677 DUF3797:  Domain of un  24.2      31 0.00067   18.7   0.3   12    1-12     12-23  (49)
147 KOG1941|consensus               24.2      40 0.00086   26.0   1.0   25   37-61    384-410 (518)
148 KOG2114|consensus               24.0      36 0.00078   28.4   0.8   20   39-61    858-877 (933)
149 PRK07218 replication factor A;  23.9      41 0.00089   25.4   1.1   18    2-21    297-314 (423)
150 PF06676 DUF1178:  Protein of u  23.9      29 0.00063   22.7   0.2   28   34-65      2-40  (148)
151 PRK05978 hypothetical protein;  23.4      47   0.001   21.7   1.2   34   27-64     26-59  (148)
152 PF14446 Prok-RING_1:  Prokaryo  23.1      60  0.0013   17.8   1.4   26   24-49      9-36  (54)
153 PF03107 C1_2:  C1 domain;  Int  22.8      12 0.00027   17.6  -1.3   23   25-47      5-28  (30)
154 PF03811 Zn_Tnp_IS1:  InsA N-te  22.8      42  0.0009   16.8   0.6   11    2-12      5-15  (36)
155 PF14690 zf-ISL3:  zinc-finger   22.6      44 0.00096   16.6   0.7   10    3-12      3-12  (47)
156 PF00098 zf-CCHC:  Zinc knuckle  22.3      36 0.00078   14.3   0.3   11   36-46      2-12  (18)
157 COG1631 RPL42A Ribosomal prote  21.9      40 0.00087   20.6   0.5   11    2-12      8-18  (94)
158 COG1998 RPS31 Ribosomal protei  21.9      44 0.00096   18.3   0.7    9    2-10     19-27  (51)
159 PF08271 TF_Zn_Ribbon:  TFIIB z  21.8      46 0.00099   16.7   0.7    9    4-12      2-10  (43)
160 KOG0825|consensus               21.6      65  0.0014   27.1   1.8   31   31-61    135-165 (1134)
161 PRK00418 DNA gyrase inhibitor;  21.4      53  0.0012   18.5   0.9   10    3-12      7-16  (62)
162 PF12760 Zn_Tnp_IS1595:  Transp  21.3      49  0.0011   16.9   0.7    9    3-11     19-27  (46)
163 PF04828 GFA:  Glutathione-depe  21.2      21 0.00045   19.8  -0.8   12    2-13     48-59  (92)
164 PRK11866 2-oxoacid ferredoxin   21.2      59  0.0013   23.1   1.4   25   30-54      3-27  (279)
165 cd02340 ZZ_NBR1_like Zinc fing  20.6      77  0.0017   16.2   1.4   21    3-23      1-21  (43)
166 PRK09628 oorB 2-oxoglutarate-a  20.5      80  0.0017   22.3   1.9   22   34-55     16-37  (277)
167 PF01286 XPA_N:  XPA protein N-  20.4      40 0.00087   16.8   0.3   12    2-13      3-14  (34)
168 PF04564 U-box:  U-box domain;   20.3      62  0.0013   18.0   1.1   23   39-61     21-44  (73)
169 COG3024 Uncharacterized protei  20.1      60  0.0013   18.6   1.0   13    2-14      7-19  (65)
170 COG3791 Uncharacterized conser  20.1      49  0.0011   20.7   0.7   11    2-12     69-79  (133)

No 1  
>KOG0269|consensus
Probab=99.44  E-value=4.4e-14  Score=109.54  Aligned_cols=69  Identities=28%  Similarity=0.624  Sum_probs=61.7

Q ss_pred             CcccCccCCCCCCcC-ccccccch-------HHHHhhhhcccccccCCCCCChHHHHHHHHhCCCCCCC-CCCccccC
Q psy17526          1 MNAHSDRCQHGLGNF-GKLEGKIQ-------MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPT-GCGHYCES   69 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~-~~~C~~~~-------~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~-gC~c~C~~   69 (70)
                      |.+.|++|++++... .|+|+++.       ++|+++|+|+++||+.|+|+||.+|++.||..+..||. +||+.|.+
T Consensus       752 i~~~~~nc~a~~~~~~~~~c~rc~s~a~~~CtVC~~vi~G~~~~c~~C~H~gH~sh~~sw~~~~s~ca~~~C~~~c~~  829 (839)
T KOG0269|consen  752 IHYACPNCDAPMVLTKLWQCDRCESRASAKCTVCDLVIRGVDVWCQVCGHGGHDSHLKSWFFKASPCAKSICPHLCHY  829 (839)
T ss_pred             eeccccccCCccccccceeechHHHHhhcCceeecceeeeeEeecccccccccHHHHHHHHhcCCCCccccCCccccc
Confidence            346899999999544 38999954       78999999999999999999999999999999999998 79999975


No 2  
>KOG0309|consensus
Probab=99.25  E-value=1.8e-12  Score=101.21  Aligned_cols=46  Identities=41%  Similarity=0.917  Sum_probs=44.5

Q ss_pred             HHHHhhhhcccccccCCCCCChHHHHHHHHhCCCCCCCCCCccccC
Q psy17526         24 MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGHYCES   69 (70)
Q Consensus        24 ~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~c~C~~   69 (70)
                      +||+..|+|+..+|.+|+|+||.+|++|||....+||+||||.|.+
T Consensus      1032 ~~C~l~V~gss~~Cg~C~Hv~H~sc~~eWf~~gd~CpsGCGC~C~~ 1077 (1081)
T KOG0309|consen 1032 AICHLAVRGSSNFCGTCGHVGHTSCMMEWFRTGDVCPSGCGCHCLL 1077 (1081)
T ss_pred             eeEeeEeeccchhhccccccccHHHHHHHHhcCCcCCCCCCcCchh
Confidence            8999999999999999999999999999999999999999999964


No 3  
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=97.57  E-value=1.6e-05  Score=41.38  Aligned_cols=37  Identities=30%  Similarity=0.508  Sum_probs=27.0

Q ss_pred             HHHhhhh-cccccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         25 LVFCLVS-GLYSWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        25 iC~~~v~-~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ||.+.+. +-.+.-+.|+|..|.+++++|++++..||+
T Consensus         5 IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~~~~~~CP~   42 (44)
T PF13639_consen    5 ICLEEFEDGEKVVKLPCGHVFHRSCIKEWLKRNNSCPV   42 (44)
T ss_dssp             TTTCBHHTTSCEEEETTSEEEEHHHHHHHHHHSSB-TT
T ss_pred             CCChhhcCCCeEEEccCCCeeCHHHHHHHHHhCCcCCc
Confidence            4544442 334445569999999999999999999997


No 4  
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=97.38  E-value=0.0001  Score=42.62  Aligned_cols=27  Identities=30%  Similarity=0.652  Sum_probs=22.9

Q ss_pred             ccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         35 SWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        35 ~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      +.=..|+|..|.++|++|+..+.+||+
T Consensus        45 i~~~~C~H~FH~~Ci~~Wl~~~~~CP~   71 (73)
T PF12678_consen   45 IVWGPCGHIFHFHCISQWLKQNNTCPL   71 (73)
T ss_dssp             EEEETTSEEEEHHHHHHHHTTSSB-TT
T ss_pred             eEecccCCCEEHHHHHHHHhcCCcCCC
Confidence            334569999999999999999999997


No 5  
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=96.42  E-value=0.0029  Score=31.31  Aligned_cols=26  Identities=27%  Similarity=0.531  Sum_probs=22.4

Q ss_pred             cccCCCCCChHHHHHHHHhC-CCCCCC
Q psy17526         36 WCQGCSHGGHLSHMQEWFMK-NNVCPT   61 (70)
Q Consensus        36 ~C~~C~HggH~~h~~~Wf~~-~~~CP~   61 (70)
                      .-..|+|..|.+++++|++. ...||.
T Consensus        14 ~~~~C~H~~c~~C~~~~~~~~~~~Cp~   40 (45)
T cd00162          14 VLLPCGHVFCRSCIDKWLKSGKNTCPL   40 (45)
T ss_pred             EecCCCChhcHHHHHHHHHhCcCCCCC
Confidence            34569999999999999998 778997


No 6  
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]
Probab=95.88  E-value=0.0064  Score=36.59  Aligned_cols=23  Identities=30%  Similarity=0.693  Sum_probs=21.5

Q ss_pred             CCCCCChHHHHHHHHhCCCCCCC
Q psy17526         39 GCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        39 ~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      .|.|..|.+++..|++...+||.
T Consensus        53 ~CnHaFH~HCI~rWL~Tk~~CPl   75 (88)
T COG5194          53 VCNHAFHDHCIYRWLDTKGVCPL   75 (88)
T ss_pred             ecchHHHHHHHHHHHhhCCCCCC
Confidence            39999999999999999999995


No 7  
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=95.82  E-value=0.0035  Score=31.72  Aligned_cols=36  Identities=17%  Similarity=0.314  Sum_probs=26.8

Q ss_pred             HHHhhhhcccccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         25 LVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        25 iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ||.+.++. .+.-..|||....+++++|+++...||+
T Consensus         3 iC~~~~~~-~~~~~~CGH~fC~~C~~~~~~~~~~CP~   38 (39)
T PF13923_consen    3 ICLDELRD-PVVVTPCGHSFCKECIEKYLEKNPKCPV   38 (39)
T ss_dssp             TTTSB-SS-EEEECTTSEEEEHHHHHHHHHCTSB-TT
T ss_pred             CCCCcccC-cCEECCCCCchhHHHHHHHHHCcCCCcC
Confidence            34444444 3457899999999999999999888986


No 8  
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=95.57  E-value=0.014  Score=27.73  Aligned_cols=25  Identities=32%  Similarity=0.678  Sum_probs=21.1

Q ss_pred             ccCCCCCChHHHHHHHHh-CCCCCCC
Q psy17526         37 CQGCSHGGHLSHMQEWFM-KNNVCPT   61 (70)
Q Consensus        37 C~~C~HggH~~h~~~Wf~-~~~~CP~   61 (70)
                      -+.|+|..|.+++++|++ ....||+
T Consensus        13 ~~~C~H~~c~~C~~~~~~~~~~~CP~   38 (39)
T smart00184       13 VLPCGHTFCRSCIRKWLKSGNNTCPI   38 (39)
T ss_pred             EecCCChHHHHHHHHHHHhCcCCCCC
Confidence            356999999999999998 5667885


No 9  
>PHA02929 N1R/p28-like protein; Provisional
Probab=95.37  E-value=0.017  Score=40.37  Aligned_cols=27  Identities=22%  Similarity=0.533  Sum_probs=24.2

Q ss_pred             ccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         35 SWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        35 ~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ..=..|+|..|..|+.+|.....+||+
T Consensus       195 ~vl~~C~H~FC~~CI~~Wl~~~~tCPl  221 (238)
T PHA02929        195 GILSNCNHVFCIECIDIWKKEKNTCPV  221 (238)
T ss_pred             eecCCCCCcccHHHHHHHHhcCCCCCC
Confidence            345689999999999999999999998


No 10 
>KOG2930|consensus
Probab=94.75  E-value=0.017  Score=36.29  Aligned_cols=24  Identities=33%  Similarity=0.822  Sum_probs=22.5

Q ss_pred             cCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         38 QGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ..|.|..|.++|..|+.+..+||.
T Consensus        79 G~CNHaFH~hCisrWlktr~vCPL  102 (114)
T KOG2930|consen   79 GVCNHAFHFHCISRWLKTRNVCPL  102 (114)
T ss_pred             eecchHHHHHHHHHHHhhcCcCCC
Confidence            469999999999999999999996


No 11 
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]
Probab=94.48  E-value=0.026  Score=42.39  Aligned_cols=24  Identities=29%  Similarity=0.782  Sum_probs=22.8

Q ss_pred             cCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         38 QGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      +.|||..|.+|++.|.++..+||.
T Consensus       316 LpCGHilHl~CLknW~ERqQTCPI  339 (491)
T COG5243         316 LPCGHILHLHCLKNWLERQQTCPI  339 (491)
T ss_pred             ccccceeeHHHHHHHHHhccCCCc
Confidence            579999999999999999999997


No 12 
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=93.90  E-value=0.047  Score=32.88  Aligned_cols=23  Identities=30%  Similarity=0.816  Sum_probs=20.1

Q ss_pred             CCCCCChHHHHHHHHhC---CCCCCC
Q psy17526         39 GCSHGGHLSHMQEWFMK---NNVCPT   61 (70)
Q Consensus        39 ~C~HggH~~h~~~Wf~~---~~~CP~   61 (70)
                      .|+|..|.+++.+|+++   ...||.
T Consensus        51 ~C~H~FH~hCI~kWl~~~~~~~~CPm   76 (85)
T PF12861_consen   51 KCSHNFHMHCILKWLSTQSSKGQCPM   76 (85)
T ss_pred             cCccHHHHHHHHHHHccccCCCCCCC
Confidence            49999999999999997   367885


No 13 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=93.76  E-value=0.042  Score=25.83  Aligned_cols=21  Identities=14%  Similarity=0.199  Sum_probs=15.3

Q ss_pred             CcccCccCCCCCCcCcccccc
Q psy17526          1 MNAHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~~~~C~~   21 (70)
                      |-+.||+||+.++....+|..
T Consensus         1 m~~~Cp~Cg~~~~~~~~fC~~   21 (26)
T PF13248_consen    1 MEMFCPNCGAEIDPDAKFCPN   21 (26)
T ss_pred             CcCCCcccCCcCCcccccChh
Confidence            567899999988666555543


No 14 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.21  E-value=0.03  Score=28.39  Aligned_cols=35  Identities=20%  Similarity=0.172  Sum_probs=22.8

Q ss_pred             CcccCccCCCCCCcCccccccchHHHHhhhhcccccccCCCCCC
Q psy17526          1 MNAHSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQGCSHGG   44 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~~~~C~~~~~iC~~~v~~l~~~C~~C~Hgg   44 (70)
                      |.+.||+|+....-..         -..+..+..+-|.+|+|..
T Consensus         1 M~i~CP~C~~~f~v~~---------~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPD---------DKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             CEEECCCCCceEEcCH---------HHcccCCcEEECCCCCcEe
Confidence            7899999998773221         0023456677788888753


No 15 
>KOG0802|consensus
Probab=92.88  E-value=0.061  Score=40.93  Aligned_cols=25  Identities=36%  Similarity=0.735  Sum_probs=23.3

Q ss_pred             ccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         37 CQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        37 C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      =+.|+|..|.+++++||++...||+
T Consensus       311 rL~C~Hifh~~CL~~W~er~qtCP~  335 (543)
T KOG0802|consen  311 RLPCGHIFHDSCLRSWFERQQTCPT  335 (543)
T ss_pred             eeecccchHHHHHHHHHHHhCcCCc
Confidence            3679999999999999999999997


No 16 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=92.83  E-value=0.016  Score=33.14  Aligned_cols=23  Identities=30%  Similarity=0.674  Sum_probs=12.9

Q ss_pred             cccccc--CCCCCChHHHHHHHHhC
Q psy17526         33 LYSWCQ--GCSHGGHLSHMQEWFMK   55 (70)
Q Consensus        33 l~~~C~--~C~HggH~~h~~~Wf~~   55 (70)
                      ..++|.  +|+...|..+|.+||++
T Consensus        19 p~~~C~n~~C~~~fH~~CL~~wf~~   43 (70)
T PF11793_consen   19 PDVVCPNPSCGKKFHLLCLSEWFLS   43 (70)
T ss_dssp             --B--S-TT----B-SGGGHHHHHH
T ss_pred             CceEcCCcccCCHHHHHHHHHHHHH
Confidence            457787  99999999999999996


No 17 
>KOG4628|consensus
Probab=92.58  E-value=0.07  Score=39.26  Aligned_cols=41  Identities=22%  Similarity=0.516  Sum_probs=29.6

Q ss_pred             HHHH-hhhhcccccccCCCCCChHHHHHHHHhCCC-CCCCCCCc
Q psy17526         24 MLVF-CLVSGLYSWCQGCSHGGHLSHMQEWFMKNN-VCPTGCGH   65 (70)
Q Consensus        24 ~iC~-~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~-~CP~gC~c   65 (70)
                      +||- +-..|--+-=+.|.|-.|.+|+.-|+.+.+ .||+ |..
T Consensus       233 aIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPv-CK~  275 (348)
T KOG4628|consen  233 AICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPV-CKR  275 (348)
T ss_pred             EEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCC-CCC
Confidence            5662 333344444489999999999999999985 5998 543


No 18 
>PF12773 DZR:  Double zinc ribbon
Probab=92.20  E-value=0.057  Score=28.39  Aligned_cols=17  Identities=12%  Similarity=0.069  Sum_probs=10.0

Q ss_pred             CccCCCCCCcCcccccc
Q psy17526          5 SDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         5 C~~C~~~l~~~~~~C~~   21 (70)
                      ||+||++++....+|..
T Consensus         1 Cp~Cg~~~~~~~~fC~~   17 (50)
T PF12773_consen    1 CPHCGTPNPDDAKFCPH   17 (50)
T ss_pred             CCCcCCcCCccccCChh
Confidence            56677776555445543


No 19 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=91.71  E-value=0.13  Score=25.64  Aligned_cols=26  Identities=19%  Similarity=0.459  Sum_probs=22.1

Q ss_pred             cccCCCCCChHHHHHHHHh--CCCCCCC
Q psy17526         36 WCQGCSHGGHLSHMQEWFM--KNNVCPT   61 (70)
Q Consensus        36 ~C~~C~HggH~~h~~~Wf~--~~~~CP~   61 (70)
                      .-..|+|....+++++|++  ....||.
T Consensus        13 ~~~~C~H~fC~~C~~~~~~~~~~~~CP~   40 (41)
T PF00097_consen   13 ILLPCGHSFCRDCLRKWLENSGSVKCPL   40 (41)
T ss_dssp             EETTTSEEEEHHHHHHHHHHTSSSBTTT
T ss_pred             EEecCCCcchHHHHHHHHHhcCCccCCc
Confidence            4578999999999999999  4567885


No 20 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=91.49  E-value=0.062  Score=27.17  Aligned_cols=34  Identities=21%  Similarity=0.188  Sum_probs=21.6

Q ss_pred             CcccCccCCCCCCcCccccccchHHHHhhhhcccccccCCCCC
Q psy17526          1 MNAHSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQGCSHG   43 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~~~~C~~~~~iC~~~v~~l~~~C~~C~Hg   43 (70)
                      |.+.||+|++...-..         -..+-.+..+-|.+|+|.
T Consensus         1 M~i~Cp~C~~~y~i~d---------~~ip~~g~~v~C~~C~~~   34 (36)
T PF13717_consen    1 MIITCPNCQAKYEIDD---------EKIPPKGRKVRCSKCGHV   34 (36)
T ss_pred             CEEECCCCCCEEeCCH---------HHCCCCCcEEECCCCCCE
Confidence            7889999988762221         002335567778888875


No 21 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=90.53  E-value=0.099  Score=28.94  Aligned_cols=27  Identities=22%  Similarity=0.696  Sum_probs=18.6

Q ss_pred             cCCCCCChHHHHHHHHhC--CCCCCC-CCC
Q psy17526         38 QGCSHGGHLSHMQEWFMK--NNVCPT-GCG   64 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~--~~~CP~-gC~   64 (70)
                      ..|+|..=.+.+.+|+++  ...||+ ||.
T Consensus        28 ~~C~H~fek~aI~~~i~~~~~~~CPv~GC~   57 (57)
T PF11789_consen   28 KKCGHTFEKEAILQYIQRNGSKRCPVAGCN   57 (57)
T ss_dssp             SSS--EEEHHHHHHHCTTTS-EE-SCCC-S
T ss_pred             CCCCCeecHHHHHHHHHhcCCCCCCCCCCC
Confidence            389999999999999944  578998 884


No 22 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=89.41  E-value=0.22  Score=22.87  Aligned_cols=17  Identities=12%  Similarity=0.143  Sum_probs=12.2

Q ss_pred             cCccCCCCCCcCccccc
Q psy17526          4 HSDRCQHGLGNFGKLEG   20 (70)
Q Consensus         4 ~C~~C~~~l~~~~~~C~   20 (70)
                      .||+||+.++.....|.
T Consensus         1 ~Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CCcccCCCCCCcCcchh
Confidence            48899999876654554


No 23 
>KOG0827|consensus
Probab=87.85  E-value=0.32  Score=36.77  Aligned_cols=24  Identities=33%  Similarity=0.735  Sum_probs=20.0

Q ss_pred             cCCCCCChHHHHHHHHhC---CCCCCC
Q psy17526         38 QGCSHGGHLSHMQEWFMK---NNVCPT   61 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~---~~~CP~   61 (70)
                      ..|||..|..++.+||+.   ++.||.
T Consensus        24 ~~cGhifh~~cl~qwfe~~Ps~R~cpi   50 (465)
T KOG0827|consen   24 GTCGHIFHTTCLTQWFEGDPSNRGCPI   50 (465)
T ss_pred             cchhhHHHHHHHHHHHccCCccCCCCc
Confidence            459999999999999987   256774


No 24 
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=87.54  E-value=0.3  Score=35.94  Aligned_cols=38  Identities=18%  Similarity=0.464  Sum_probs=30.2

Q ss_pred             HHH-HhhhhcccccccCCCCCChHHHHHHHHhC-CCCCCC
Q psy17526         24 MLV-FCLVSGLYSWCQGCSHGGHLSHMQEWFMK-NNVCPT   61 (70)
Q Consensus        24 ~iC-~~~v~~l~~~C~~C~HggH~~h~~~Wf~~-~~~CP~   61 (70)
                      +|| .+.+++-.+.-+-|.|..|..|+..|... ...||+
T Consensus       327 aICms~fiK~d~~~vlPC~H~FH~~Cv~kW~~~y~~~CPv  366 (374)
T COG5540         327 AICMSNFIKNDRLRVLPCDHRFHVGCVDKWLLGYSNKCPV  366 (374)
T ss_pred             EEEhhhhcccceEEEeccCceechhHHHHHHhhhcccCCc
Confidence            455 24456666778899999999999999995 578998


No 25 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=87.05  E-value=0.38  Score=25.79  Aligned_cols=24  Identities=8%  Similarity=0.295  Sum_probs=21.7

Q ss_pred             cCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         38 QGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ..+||..-.+++.+|++++..||.
T Consensus        17 ~~~G~v~~~~~i~~~~~~~~~cP~   40 (63)
T smart00504       17 LPSGQTYERRAIEKWLLSHGTDPV   40 (63)
T ss_pred             CCCCCEEeHHHHHHHHHHCCCCCC
Confidence            468899999999999999889997


No 26 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=86.75  E-value=0.41  Score=25.06  Aligned_cols=26  Identities=15%  Similarity=0.235  Sum_probs=23.2

Q ss_pred             cccCCCCC-ChHHHHHHHHhCCCCCCC
Q psy17526         36 WCQGCSHG-GHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        36 ~C~~C~Hg-gH~~h~~~Wf~~~~~CP~   61 (70)
                      .-..|+|. .-..++.+|+++...||+
T Consensus        16 ~~~pCgH~~~C~~C~~~~~~~~~~CP~   42 (50)
T PF13920_consen   16 VLLPCGHLCFCEECAERLLKRKKKCPI   42 (50)
T ss_dssp             EEETTCEEEEEHHHHHHHHHTTSBBTT
T ss_pred             EEeCCCChHHHHHHhHHhcccCCCCCc
Confidence            34579999 999999999999999997


No 27 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=86.08  E-value=0.73  Score=23.60  Aligned_cols=27  Identities=19%  Similarity=0.215  Sum_probs=23.6

Q ss_pred             ccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         35 SWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        35 ~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      .+=..|+|....+++.........||+
T Consensus        15 ~~l~~CgH~~C~~C~~~~~~~~~~CP~   41 (44)
T PF14634_consen   15 PRLTSCGHIFCEKCLKKLKGKSVKCPI   41 (44)
T ss_pred             eEEcccCCHHHHHHHHhhcCCCCCCcC
Confidence            566789999999999999877788997


No 28 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=85.87  E-value=0.6  Score=31.89  Aligned_cols=29  Identities=14%  Similarity=0.167  Sum_probs=22.2

Q ss_pred             HHHHhhhhcccccccCCCCCChHHHHHHHHh
Q psy17526         24 MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFM   54 (70)
Q Consensus        24 ~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~   54 (70)
                      .||.+.++...+  ..|+|.....|+.+|+.
T Consensus        22 pICld~~~dPVv--T~CGH~FC~~CI~~wl~   50 (193)
T PLN03208         22 NICLDQVRDPVV--TLCGHLFCWPCIHKWTY   50 (193)
T ss_pred             ccCCCcCCCcEE--cCCCchhHHHHHHHHHH
Confidence            566666555444  57999999999999975


No 29 
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=84.65  E-value=0.68  Score=38.78  Aligned_cols=27  Identities=26%  Similarity=0.717  Sum_probs=24.5

Q ss_pred             ccccCCCCCChHHHHHHHHhC--CCCCCC
Q psy17526         35 SWCQGCSHGGHLSHMQEWFMK--NNVCPT   61 (70)
Q Consensus        35 ~~C~~C~HggH~~h~~~Wf~~--~~~CP~   61 (70)
                      --|..|.|-.|+.|+..||+.  +..||.
T Consensus      1489 krC~TCknKFH~~CLyKWf~Ss~~s~CPl 1517 (1525)
T COG5219        1489 KRCATCKNKFHTRCLYKWFASSARSNCPL 1517 (1525)
T ss_pred             cccchhhhhhhHHHHHHHHHhcCCCCCCc
Confidence            459999999999999999998  478997


No 30 
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
Probab=84.53  E-value=0.88  Score=24.22  Aligned_cols=21  Identities=14%  Similarity=0.409  Sum_probs=17.2

Q ss_pred             CCCChHHHHHHHHhCC--CCCCC
Q psy17526         41 SHGGHLSHMQEWFMKN--NVCPT   61 (70)
Q Consensus        41 ~HggH~~h~~~Wf~~~--~~CP~   61 (70)
                      .|--|.++|+.|++..  ..||+
T Consensus        25 ~~~vH~~Cl~~W~~~~~~~~C~i   47 (49)
T smart00744       25 LKYVHQECLERWINESGNKTCEI   47 (49)
T ss_pred             hhHHHHHHHHHHHHHcCCCcCCC
Confidence            3778999999999764  47887


No 31 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=83.85  E-value=1.1  Score=33.55  Aligned_cols=36  Identities=14%  Similarity=0.155  Sum_probs=28.2

Q ss_pred             HHHHhhhhcccccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         24 MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        24 ~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      .||.+.+..-++  ..|+|-....|+++|+.....||+
T Consensus        30 ~IC~d~~~~Pvi--tpCgH~FCs~CI~~~l~~~~~CP~   65 (397)
T TIGR00599        30 HICKDFFDVPVL--TSCSHTFCSLCIRRCLSNQPKCPL   65 (397)
T ss_pred             CcCchhhhCccC--CCCCCchhHHHHHHHHhCCCCCCC
Confidence            455555544332  689999999999999999888997


No 32 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=80.93  E-value=0.84  Score=25.64  Aligned_cols=19  Identities=11%  Similarity=0.114  Sum_probs=15.6

Q ss_pred             ccCccCCCCCCcCcccccc
Q psy17526          3 AHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~   21 (70)
                      -+|+.||+++|..-..|+.
T Consensus         4 kHC~~CG~~Ip~~~~fCS~   22 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFCSP   22 (59)
T ss_pred             CcCCcCCCcCCcchhhhCH
Confidence            3799999999877667864


No 33 
>PHA02926 zinc finger-like protein; Provisional
Probab=80.60  E-value=1.5  Score=30.85  Aligned_cols=29  Identities=17%  Similarity=0.539  Sum_probs=23.4

Q ss_pred             ccccccCCCCCChHHHHHHHHhCC------CCCCC
Q psy17526         33 LYSWCQGCSHGGHLSHMQEWFMKN------NVCPT   61 (70)
Q Consensus        33 l~~~C~~C~HggH~~h~~~Wf~~~------~~CP~   61 (70)
                      .+-.=.+|+|.....|+++|.+..      ..||.
T Consensus       190 rFGIL~~CnHsFCl~CIr~Wr~~r~~~~~~rsCPi  224 (242)
T PHA02926        190 YFGLLDSCNHIFCITCINIWHRTRRETGASDNCPI  224 (242)
T ss_pred             cccccCCCCchHHHHHHHHHHHhccccCcCCcCCC
Confidence            455667999999999999999863      34986


No 34 
>KOG0317|consensus
Probab=80.42  E-value=1.5  Score=31.79  Aligned_cols=26  Identities=27%  Similarity=0.473  Sum_probs=24.0

Q ss_pred             cccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         36 WCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        36 ~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      .|.-|||..--+|+.+|.....+||.
T Consensus       253 SaTpCGHiFCWsCI~~w~~ek~eCPl  278 (293)
T KOG0317|consen  253 SATPCGHIFCWSCILEWCSEKAECPL  278 (293)
T ss_pred             CcCcCcchHHHHHHHHHHccccCCCc
Confidence            47789999999999999999999997


No 35 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=75.91  E-value=1.2  Score=21.99  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=10.0

Q ss_pred             CcccCccCCCCC
Q psy17526          1 MNAHSDRCQHGL   12 (70)
Q Consensus         1 ~~~~C~~C~~~l   12 (70)
                      |++.||+|+...
T Consensus         1 M~~~CP~C~~~~   12 (38)
T TIGR02098         1 MRIQCPNCKTSF   12 (38)
T ss_pred             CEEECCCCCCEE
Confidence            788999999865


No 36 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=75.37  E-value=2.4  Score=23.72  Aligned_cols=43  Identities=9%  Similarity=0.155  Sum_probs=28.7

Q ss_pred             CcccCccCCCCCCcC---ccccccchHHHHhhhhcc-cccccCCCCC
Q psy17526          1 MNAHSDRCQHGLGNF---GKLEGKIQMLVFCLVSGL-YSWCQGCSHG   43 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~---~~~C~~~~~iC~~~v~~l-~~~C~~C~Hg   43 (70)
                      |+..|..|++.|+..   ..||+-=-+.|.+-+..+ ...|+|||-.
T Consensus         4 lrpnCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGe   50 (57)
T PF06906_consen    4 LRPNCECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGE   50 (57)
T ss_pred             cCCCccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCc
Confidence            678899999999653   367875224444433333 5689999865


No 37 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=75.27  E-value=1.4  Score=23.18  Aligned_cols=34  Identities=24%  Similarity=0.376  Sum_probs=19.7

Q ss_pred             cCccCCCCCCcCccccccchHHHHhhhhcccccccC--CCCC
Q psy17526          4 HSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQG--CSHG   43 (70)
Q Consensus         4 ~C~~C~~~l~~~~~~C~~~~~iC~~~v~~l~~~C~~--C~Hg   43 (70)
                      .||.||.++---.     ...+ ...++.++..|.|  |||-
T Consensus         1 ~CP~Cg~~a~ir~-----S~~~-s~~~~~~Y~qC~N~~Cg~t   36 (47)
T PF04606_consen    1 RCPHCGSKARIRT-----SRQL-SPLTRELYCQCTNPECGHT   36 (47)
T ss_pred             CcCCCCCeeEEEE-----chhh-CcceEEEEEEECCCcCCCE
Confidence            4888888771100     0000 2455778888888  8875


No 38 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=74.24  E-value=1.3  Score=22.50  Aligned_cols=13  Identities=31%  Similarity=0.731  Sum_probs=8.8

Q ss_pred             hcccccccCCCCC
Q psy17526         31 SGLYSWCQGCSHG   43 (70)
Q Consensus        31 ~~l~~~C~~C~Hg   43 (70)
                      ..++..|.+|+|-
T Consensus        25 ~T~fy~C~~C~~~   37 (39)
T PF01096_consen   25 MTLFYVCCNCGHR   37 (39)
T ss_dssp             SEEEEEESSSTEE
T ss_pred             CeEEEEeCCCCCe
Confidence            3456668888873


No 39 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=74.07  E-value=1.3  Score=34.90  Aligned_cols=43  Identities=16%  Similarity=0.081  Sum_probs=29.0

Q ss_pred             ccCccCCCCCCcCccccccch--------HHHHhhhhcccccccCCCCCCh
Q psy17526          3 AHSDRCQHGLGNFGKLEGKIQ--------MLVFCLVSGLYSWCQGCSHGGH   45 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~~~--------~iC~~~v~~l~~~C~~C~HggH   45 (70)
                      ..||+||...+.....|.++.        .-|...+..-.-||.+||+-..
T Consensus         2 ~~Cp~Cg~~n~~~akFC~~CG~~l~~~~Cp~CG~~~~~~~~fC~~CG~~~~   52 (645)
T PRK14559          2 LICPQCQFENPNNNRFCQKCGTSLTHKPCPQCGTEVPVDEAHCPNCGAETG   52 (645)
T ss_pred             CcCCCCCCcCCCCCccccccCCCCCCCcCCCCCCCCCcccccccccCCccc
Confidence            478888888876666676643        2345566666677888877643


No 40 
>KOG0320|consensus
Probab=73.65  E-value=2.5  Score=28.81  Aligned_cols=41  Identities=22%  Similarity=0.328  Sum_probs=32.5

Q ss_pred             HHHHhhhhcccccccCCCCCChHHHHHHHHhCCCCCCCCCCc
Q psy17526         24 MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGH   65 (70)
Q Consensus        24 ~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~c   65 (70)
                      -||-+.+.--..+=.+|||..-..|+++=......||+ |.+
T Consensus       135 PiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~-C~k  175 (187)
T KOG0320|consen  135 PICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPT-CRK  175 (187)
T ss_pred             CceecchhhccccccccchhHHHHHHHHHHHhCCCCCC-ccc
Confidence            35555555555567899999999999999999999999 443


No 41 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=73.09  E-value=2.8  Score=21.47  Aligned_cols=24  Identities=21%  Similarity=0.403  Sum_probs=17.9

Q ss_pred             cCCCCCChHHHHHHHHhCC----CCCCC
Q psy17526         38 QGCSHGGHLSHMQEWFMKN----NVCPT   61 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~~----~~CP~   61 (70)
                      +.|||..-.+++.+|+++.    ..||.
T Consensus        14 l~CGH~FC~~Cl~~~~~~~~~~~~~CP~   41 (42)
T PF15227_consen   14 LPCGHSFCRSCLERLWKEPSGSGFSCPE   41 (42)
T ss_dssp             -SSSSEEEHHHHHHHHCCSSSST---SS
T ss_pred             cCCcCHHHHHHHHHHHHccCCcCCCCcC
Confidence            5899999999999999884    34764


No 42 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=72.88  E-value=1.9  Score=24.33  Aligned_cols=9  Identities=11%  Similarity=0.401  Sum_probs=5.1

Q ss_pred             cCccCCCCC
Q psy17526          4 HSDRCQHGL   12 (70)
Q Consensus         4 ~C~~C~~~l   12 (70)
                      .|..||++|
T Consensus         9 ~CtSCg~~i   17 (59)
T PRK14890          9 KCTSCGIEI   17 (59)
T ss_pred             cccCCCCcc
Confidence            355566555


No 43 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=72.05  E-value=2.5  Score=19.89  Aligned_cols=16  Identities=13%  Similarity=0.198  Sum_probs=9.3

Q ss_pred             cCccCCCCCCcCcccc
Q psy17526          4 HSDRCQHGLGNFGKLE   19 (70)
Q Consensus         4 ~C~~C~~~l~~~~~~C   19 (70)
                      .||.|++.++.....|
T Consensus         2 ~CP~C~~~V~~~~~~C   17 (26)
T PF10571_consen    2 TCPECGAEVPESAKFC   17 (26)
T ss_pred             cCCCCcCCchhhcCcC
Confidence            4677777665554344


No 44 
>KOG1493|consensus
Probab=71.51  E-value=1.1  Score=26.82  Aligned_cols=23  Identities=26%  Similarity=0.642  Sum_probs=18.9

Q ss_pred             CCCCCChHHHHHHHHhC---CCCCCC
Q psy17526         39 GCSHGGHLSHMQEWFMK---NNVCPT   61 (70)
Q Consensus        39 ~C~HggH~~h~~~Wf~~---~~~CP~   61 (70)
                      .|.|-.|++++.+|.+.   ...||.
T Consensus        50 ~C~h~fh~hCI~~wl~~~tsq~~CPm   75 (84)
T KOG1493|consen   50 YCLHAFHAHCILKWLNTPTSQGQCPM   75 (84)
T ss_pred             HHHHHHHHHHHHHHhcCccccccCCc
Confidence            46799999999999987   356885


No 45 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=70.37  E-value=3.3  Score=21.47  Aligned_cols=11  Identities=18%  Similarity=0.268  Sum_probs=8.5

Q ss_pred             cCccCCCCCCc
Q psy17526          4 HSDRCQHGLGN   14 (70)
Q Consensus         4 ~C~~C~~~l~~   14 (70)
                      +||+||..|..
T Consensus         2 FCp~Cg~~l~~   12 (52)
T smart00661        2 FCPKCGNMLIP   12 (52)
T ss_pred             CCCCCCCcccc
Confidence            68999988843


No 46 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=69.48  E-value=2  Score=20.34  Aligned_cols=25  Identities=16%  Similarity=0.262  Sum_probs=10.4

Q ss_pred             HHHhhhhc-ccccccCCCCCChHHHH
Q psy17526         25 LVFCLVSG-LYSWCQGCSHGGHLSHM   49 (70)
Q Consensus        25 iC~~~v~~-l~~~C~~C~HggH~~h~   49 (70)
                      +|.+++.+ ++..|..|.-..|.+++
T Consensus         5 ~C~~~~~~~~~Y~C~~Cdf~lH~~Ca   30 (30)
T PF07649_consen    5 ACGKPIDGGWFYRCSECDFDLHEECA   30 (30)
T ss_dssp             TTS----S--EEE-TTT-----HHHH
T ss_pred             cCCCcCCCCceEECccCCCccChhcC
Confidence            45667777 78889999988888764


No 47 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=69.12  E-value=2.2  Score=20.50  Aligned_cols=11  Identities=18%  Similarity=0.371  Sum_probs=5.7

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +-.|++||.++
T Consensus         3 ~rfC~~CG~~t   13 (32)
T PF09297_consen    3 HRFCGRCGAPT   13 (32)
T ss_dssp             TSB-TTT--BE
T ss_pred             CcccCcCCccc
Confidence            34688888887


No 48 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=68.74  E-value=3.5  Score=21.03  Aligned_cols=16  Identities=19%  Similarity=0.480  Sum_probs=11.6

Q ss_pred             HhhhhcccccccCCCCC
Q psy17526         27 FCLVSGLYSWCQGCSHG   43 (70)
Q Consensus        27 ~~~v~~l~~~C~~C~Hg   43 (70)
                      +++|. ++..|.+|+|-
T Consensus        22 DE~mT-~fy~C~~C~~~   37 (40)
T smart00440       22 DEPMT-VFYVCTKCGHR   37 (40)
T ss_pred             CCCCe-EEEEeCCCCCE
Confidence            45554 78889999984


No 49 
>KOG0828|consensus
Probab=65.42  E-value=3.1  Score=32.58  Aligned_cols=25  Identities=24%  Similarity=0.595  Sum_probs=21.5

Q ss_pred             ccCCCCCChHHHHHHHHhCCC-CCCC
Q psy17526         37 CQGCSHGGHLSHMQEWFMKNN-VCPT   61 (70)
Q Consensus        37 C~~C~HggH~~h~~~Wf~~~~-~CP~   61 (70)
                      -.-|.|..|..+++.|-...+ +||+
T Consensus       603 ~tPC~HifH~~CL~~WMd~ykl~CPv  628 (636)
T KOG0828|consen  603 LTPCHHIFHRQCLLQWMDTYKLICPV  628 (636)
T ss_pred             ccchHHHHHHHHHHHHHhhhcccCCc
Confidence            446889999999999999655 9998


No 50 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=60.41  E-value=9.1  Score=27.42  Aligned_cols=33  Identities=36%  Similarity=0.744  Sum_probs=23.3

Q ss_pred             hhhcccccccCCCCCChHHHHHHHHhCCCCCCCCCCc
Q psy17526         29 LVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGH   65 (70)
Q Consensus        29 ~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~c   65 (70)
                      +-.++|+-|+.|+.--+.   +++..+..+||. |++
T Consensus        22 ~~~~~~~~c~~c~~~~~~---~~l~~~~~vc~~-c~~   54 (292)
T PRK05654         22 VPEGLWTKCPSCGQVLYR---KELEANLNVCPK-CGH   54 (292)
T ss_pred             CCCCCeeECCCccchhhH---HHHHhcCCCCCC-CCC
Confidence            346788888888876554   666666778887 554


No 51 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=59.98  E-value=5.2  Score=21.98  Aligned_cols=12  Identities=17%  Similarity=0.387  Sum_probs=9.7

Q ss_pred             CcccCccCCCCC
Q psy17526          1 MNAHSDRCQHGL   12 (70)
Q Consensus         1 ~~~~C~~C~~~l   12 (70)
                      |...||.||..+
T Consensus         1 ~~~~CP~CG~~i   12 (54)
T TIGR01206         1 MQFECPDCGAEI   12 (54)
T ss_pred             CccCCCCCCCEE
Confidence            456899999987


No 52 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=58.45  E-value=10  Score=27.06  Aligned_cols=32  Identities=28%  Similarity=0.612  Sum_probs=20.5

Q ss_pred             hhcccccccCCCCCChHHHHHHHHhCCCCCCCCCCc
Q psy17526         30 VSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGH   65 (70)
Q Consensus        30 v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~c   65 (70)
                      -.++|+-|+.|+.--+.   +++..+..+||. |++
T Consensus        22 ~~~~~~~c~~c~~~~~~---~~l~~~~~vc~~-c~~   53 (285)
T TIGR00515        22 PEGVWTKCPKCGQVLYT---KELERNLEVCPK-CDH   53 (285)
T ss_pred             CCCCeeECCCCcchhhH---HHHHhhCCCCCC-CCC
Confidence            35577777777766444   556666677776 554


No 53 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=57.36  E-value=3  Score=20.81  Aligned_cols=11  Identities=9%  Similarity=0.308  Sum_probs=8.3

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +..||+|+|++
T Consensus         4 ~~~C~nC~R~v   14 (33)
T PF08209_consen    4 YVECPNCGRPV   14 (33)
T ss_dssp             EEE-TTTSSEE
T ss_pred             eEECCCCcCCc
Confidence            46799999987


No 54 
>PF14353 CpXC:  CpXC protein
Probab=57.17  E-value=5.4  Score=24.55  Aligned_cols=46  Identities=17%  Similarity=0.118  Sum_probs=26.9

Q ss_pred             ccCccCCCCCCcCcccccc---chHHHHhhhhccc--ccccCCCCCChHHH
Q psy17526          3 AHSDRCQHGLGNFGKLEGK---IQMLVFCLVSGLY--SWCQGCSHGGHLSH   48 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~---~~~iC~~~v~~l~--~~C~~C~HggH~~h   48 (70)
                      +.||+|+++..-..|.=-.   -+.+=..++.|-+  +.|++||+.+..++
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEY   52 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCC
Confidence            6799999988544321111   1133344554443  55999999876643


No 55 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=56.22  E-value=5.5  Score=20.93  Aligned_cols=17  Identities=29%  Similarity=0.589  Sum_probs=13.7

Q ss_pred             hcccccccCCCCCChHH
Q psy17526         31 SGLYSWCQGCSHGGHLS   47 (70)
Q Consensus        31 ~~l~~~C~~C~HggH~~   47 (70)
                      .++-.+|..|+.-||..
T Consensus        28 E~lp~~C~~C~~~gH~~   44 (49)
T PF14392_consen   28 ERLPRFCFHCGRIGHSD   44 (49)
T ss_pred             CCcChhhcCCCCcCcCH
Confidence            45667899999999974


No 56 
>PF12906 RINGv:  RING-variant domain; PDB: 2D8S_A 1VYX_A.
Probab=54.67  E-value=5.4  Score=20.90  Aligned_cols=19  Identities=26%  Similarity=0.524  Sum_probs=13.4

Q ss_pred             CChHHHHHHHHhC--CCCCCC
Q psy17526         43 GGHLSHMQEWFMK--NNVCPT   61 (70)
Q Consensus        43 ggH~~h~~~Wf~~--~~~CP~   61 (70)
                      --|.++|++|+..  +..|++
T Consensus        26 ~vH~~CL~~W~~~~~~~~C~~   46 (47)
T PF12906_consen   26 YVHRSCLERWIRESGNRKCEI   46 (47)
T ss_dssp             SEECCHHHHHHHHHT-SB-TT
T ss_pred             hhHHHHHHHHHHhcCCCcCCC
Confidence            4599999999985  456664


No 57 
>KOG2691|consensus
Probab=54.67  E-value=6.5  Score=24.79  Aligned_cols=16  Identities=25%  Similarity=0.474  Sum_probs=12.8

Q ss_pred             hhhhcccccccCCCCC
Q psy17526         28 CLVSGLYSWCQGCSHG   43 (70)
Q Consensus        28 ~~v~~l~~~C~~C~Hg   43 (70)
                      +..-+|+..|.+|+|-
T Consensus        95 d~~m~l~yvC~~C~h~  110 (113)
T KOG2691|consen   95 DEAMRLFYVCCSCGHR  110 (113)
T ss_pred             cceEEEEEEecccccc
Confidence            5666788889999985


No 58 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=54.65  E-value=5.6  Score=20.65  Aligned_cols=14  Identities=21%  Similarity=0.465  Sum_probs=10.9

Q ss_pred             CcccCccCCCCCCc
Q psy17526          1 MNAHSDRCQHGLGN   14 (70)
Q Consensus         1 ~~~~C~~C~~~l~~   14 (70)
                      +...||+|+-||-+
T Consensus        16 L~~~Cp~C~~PL~~   29 (41)
T PF06677_consen   16 LDEHCPDCGTPLMR   29 (41)
T ss_pred             hcCccCCCCCeeEE
Confidence            35689999999943


No 59 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=53.47  E-value=6  Score=25.28  Aligned_cols=22  Identities=9%  Similarity=-0.038  Sum_probs=16.3

Q ss_pred             cccCccCCCCCCcC---ccccccch
Q psy17526          2 NAHSDRCQHGLGNF---GKLEGKIQ   23 (70)
Q Consensus         2 ~~~C~~C~~~l~~~---~~~C~~~~   23 (70)
                      |.+||+|+|.+...   .+.|.++.
T Consensus        34 Y~aC~~C~kkv~~~~~~~~~C~~C~   58 (166)
T cd04476          34 YPACPGCNKKVVEEGNGTYRCEKCN   58 (166)
T ss_pred             EccccccCcccEeCCCCcEECCCCC
Confidence            78999999999432   36787744


No 60 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=52.24  E-value=9.8  Score=27.53  Aligned_cols=38  Identities=21%  Similarity=0.278  Sum_probs=26.1

Q ss_pred             HHHHhhhhcccccccCCCCCChHHHHHHHHhCCCCCCCCCCc
Q psy17526         24 MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGH   65 (70)
Q Consensus        24 ~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~c   65 (70)
                      +++.++-.++|+-|++|+.--..   +++-.+..+||. |++
T Consensus        28 ~~~~~~p~~lw~kc~~C~~~~~~---~~l~~~~~vcp~-c~~   65 (296)
T CHL00174         28 SWNTQKYKHLWVQCENCYGLNYK---KFLKSKMNICEQ-CGY   65 (296)
T ss_pred             ccCCCCCCCCeeECCCccchhhH---HHHHHcCCCCCC-CCC
Confidence            45555667888889888877655   455555678886 554


No 61 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=52.24  E-value=6  Score=19.72  Aligned_cols=9  Identities=22%  Similarity=0.456  Sum_probs=4.3

Q ss_pred             cCccCCCCC
Q psy17526          4 HSDRCQHGL   12 (70)
Q Consensus         4 ~C~~C~~~l   12 (70)
                      +||+||.+|
T Consensus         2 fC~~CG~~l   10 (34)
T PF14803_consen    2 FCPQCGGPL   10 (34)
T ss_dssp             B-TTT--B-
T ss_pred             ccccccChh
Confidence            589999998


No 62 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=51.78  E-value=4.9  Score=18.89  Aligned_cols=12  Identities=17%  Similarity=0.415  Sum_probs=6.2

Q ss_pred             ccCccCCCCCCc
Q psy17526          3 AHSDRCQHGLGN   14 (70)
Q Consensus         3 ~~C~~C~~~l~~   14 (70)
                      ..|++|+..+++
T Consensus         2 ~~C~rC~~~~~~   13 (30)
T PF06827_consen    2 EKCPRCWNYIED   13 (30)
T ss_dssp             SB-TTT--BBEE
T ss_pred             CcCccCCCcceE
Confidence            358888888843


No 63 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=51.18  E-value=5.4  Score=25.73  Aligned_cols=12  Identities=25%  Similarity=0.412  Sum_probs=10.4

Q ss_pred             cccCccCCCCCC
Q psy17526          2 NAHSDRCQHGLG   13 (70)
Q Consensus         2 ~~~C~~C~~~l~   13 (70)
                      ..+||+||.||-
T Consensus        28 ~~hCp~Cg~PLF   39 (131)
T COG1645          28 AKHCPKCGTPLF   39 (131)
T ss_pred             HhhCcccCCcce
Confidence            568999999994


No 64 
>KOG0823|consensus
Probab=50.81  E-value=9.7  Score=26.75  Aligned_cols=38  Identities=18%  Similarity=0.414  Sum_probs=28.3

Q ss_pred             HHHHhhhhcccccccCCCCCChHHHHHHHHhC---CCCCCCCCC
Q psy17526         24 MLVFCLVSGLYSWCQGCSHGGHLSHMQEWFMK---NNVCPTGCG   64 (70)
Q Consensus        24 ~iC~~~v~~l~~~C~~C~HggH~~h~~~Wf~~---~~~CP~gC~   64 (70)
                      .||-+..+.-++-+  |||=.--.|+.+|...   ..+||+ |.
T Consensus        51 NICLd~akdPVvTl--CGHLFCWpClyqWl~~~~~~~~cPV-CK   91 (230)
T KOG0823|consen   51 NICLDLAKDPVVTL--CGHLFCWPCLYQWLQTRPNSKECPV-CK   91 (230)
T ss_pred             eeeccccCCCEEee--cccceehHHHHHHHhhcCCCeeCCc-cc
Confidence            57766665555443  8999999999999987   367898 44


No 65 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=49.96  E-value=8.8  Score=24.17  Aligned_cols=13  Identities=8%  Similarity=0.381  Sum_probs=10.9

Q ss_pred             cccCccCCCCCCc
Q psy17526          2 NAHSDRCQHGLGN   14 (70)
Q Consensus         2 ~~~C~~C~~~l~~   14 (70)
                      ++.||+||.++..
T Consensus        49 ~t~CP~Cg~~~e~   61 (115)
T COG1885          49 STSCPKCGEPFES   61 (115)
T ss_pred             cccCCCCCCccce
Confidence            5899999999843


No 66 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=48.78  E-value=8.7  Score=18.77  Aligned_cols=11  Identities=18%  Similarity=0.362  Sum_probs=6.5

Q ss_pred             ccCccCCCCCC
Q psy17526          3 AHSDRCQHGLG   13 (70)
Q Consensus         3 ~~C~~C~~~l~   13 (70)
                      +.||.||..+.
T Consensus        27 ~~CP~Cg~~~~   37 (41)
T smart00834       27 ATCPECGGDVR   37 (41)
T ss_pred             CCCCCCCCcce
Confidence            45666666543


No 67 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=47.13  E-value=9.3  Score=21.66  Aligned_cols=10  Identities=10%  Similarity=0.378  Sum_probs=6.0

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      ..|..||..|
T Consensus        10 ~~CtSCg~~i   19 (61)
T COG2888          10 PVCTSCGREI   19 (61)
T ss_pred             ceeccCCCEe
Confidence            3566666666


No 68 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=46.13  E-value=13  Score=28.30  Aligned_cols=22  Identities=27%  Similarity=0.289  Sum_probs=16.7

Q ss_pred             cccCccCCCCC---CcCccccccch
Q psy17526          2 NAHSDRCQHGL---GNFGKLEGKIQ   23 (70)
Q Consensus         2 ~~~C~~C~~~l---~~~~~~C~~~~   23 (70)
                      +..||.||+.|   ++.++-|+++.
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg  374 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCG  374 (421)
T ss_pred             CCCCCccCCchhhcCCCCccccccc
Confidence            56899999999   34366788754


No 69 
>KOG2041|consensus
Probab=45.54  E-value=6.2  Score=32.60  Aligned_cols=55  Identities=18%  Similarity=0.379  Sum_probs=38.4

Q ss_pred             ccCccCCCCCCcCccccccch---HHH---Hhh-hhcccccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526          3 AHSDRCQHGLGNFGKLEGKIQ---MLV---FCL-VSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~~~---~iC---~~~-v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ..|..||-++++..-.|+.++   -+|   ..| ....+..|+.|.|+.|.+-+    ++++.||.
T Consensus      1118 vdc~~cg~~i~~~~~~c~ec~~kfP~CiasG~pIt~~~fWlC~~CkH~a~~~EI----s~y~~CPL 1179 (1189)
T KOG2041|consen 1118 VDCSVCGAKIDPYDLQCSECQTKFPVCIASGRPITDNIFWLCPRCKHRAHQHEI----SKYNCCPL 1179 (1189)
T ss_pred             eeeeecCCcCCccCCCChhhcCcCceeeccCCccccceEEEccccccccccccc----cccccCcc
Confidence            457788888877666777755   233   334 45557779999999988654    44678886


No 70 
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=45.04  E-value=9.3  Score=26.11  Aligned_cols=38  Identities=13%  Similarity=0.178  Sum_probs=21.3

Q ss_pred             CccCCCCCCcC-ccccccch----HHHHhhhhcccccccCCCC
Q psy17526          5 SDRCQHGLGNF-GKLEGKIQ----MLVFCLVSGLYSWCQGCSH   42 (70)
Q Consensus         5 C~~C~~~l~~~-~~~C~~~~----~iC~~~v~~l~~~C~~C~H   42 (70)
                      |++||++..+- ..+|..+-    .+-..+-.--..+|..||=
T Consensus         1 C~~CG~~~~~~~~~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~   43 (236)
T PF04981_consen    1 CPRCGREIEPLIDGLCPDCYLKRFDIIEIPDRIEVTICPKCGR   43 (236)
T ss_pred             CCCCCCCCCCcccccChHHhcccCCeeecCCccCceECCCCCC
Confidence            89999988442 23776632    2222222224667877763


No 71 
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=44.55  E-value=7.1  Score=22.11  Aligned_cols=39  Identities=18%  Similarity=0.036  Sum_probs=16.3

Q ss_pred             cccCccCCCCCCcCcccccc-chHHHHhhhhcccccccCCCC
Q psy17526          2 NAHSDRCQHGLGNFGKLEGK-IQMLVFCLVSGLYSWCQGCSH   42 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~-~~~iC~~~v~~l~~~C~~C~H   42 (70)
                      ++.|.+|+..|-+.. .|.- .. -=......+.+-|..|+|
T Consensus        46 r~~Ck~C~~~liPG~-~~~vri~-~~~~~~~~l~~~C~~C~~   85 (85)
T PF04032_consen   46 RTICKKCGSLLIPGV-NCSVRIR-KKKKKKNFLVYTCLNCGH   85 (85)
T ss_dssp             CTB-TTT--B--CTT-TEEEEEE----SSS-EEEEEETTTTE
T ss_pred             cccccCCCCEEeCCC-ccEEEEE-ecCCCCCEEEEEccccCC
Confidence            567888888883331 2322 00 001223455666888876


No 72 
>PHA00626 hypothetical protein
Probab=43.97  E-value=11  Score=21.14  Aligned_cols=17  Identities=12%  Similarity=0.255  Sum_probs=11.5

Q ss_pred             ccCccCCCC-CCcCccccc
Q psy17526          3 AHSDRCQHG-LGNFGKLEG   20 (70)
Q Consensus         3 ~~C~~C~~~-l~~~~~~C~   20 (70)
                      +.||+||+. +-+++ +|.
T Consensus         1 m~CP~CGS~~Ivrcg-~cr   18 (59)
T PHA00626          1 MSCPKCGSGNIAKEK-TMR   18 (59)
T ss_pred             CCCCCCCCceeeeec-eec
Confidence            469999994 56665 443


No 73 
>KOG1952|consensus
Probab=43.36  E-value=7.4  Score=32.15  Aligned_cols=32  Identities=22%  Similarity=0.402  Sum_probs=25.2

Q ss_pred             HHHHhhhhcc--cccccCCCCCChHHHHHHHHhC
Q psy17526         24 MLVFCLVSGL--YSWCQGCSHGGHLSHMQEWFMK   55 (70)
Q Consensus        24 ~iC~~~v~~l--~~~C~~C~HggH~~h~~~Wf~~   55 (70)
                      .||.+.|++.  .+.|.+|-|..|++++++|-.+
T Consensus       195 mIC~e~I~~t~~~WSC~sCYhVFHl~CI~~WArs  228 (950)
T KOG1952|consen  195 MICTERIKRTAPVWSCKSCYHVFHLNCIKKWARS  228 (950)
T ss_pred             EEeeeeccccCCceecchhhhhhhHHHHHHHHHH
Confidence            5676666444  3459999999999999999765


No 74 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=43.14  E-value=28  Score=22.09  Aligned_cols=49  Identities=22%  Similarity=0.506  Sum_probs=25.7

Q ss_pred             cccCccCCCCCCcCcc--ccccchHHHHhhhhcccccccCCC----CCChHHHHHH
Q psy17526          2 NAHSDRCQHGLGNFGK--LEGKIQMLVFCLVSGLYSWCQGCS----HGGHLSHMQE   51 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~--~C~~~~~iC~~~v~~l~~~C~~C~----HggH~~h~~~   51 (70)
                      .+.|+.||.+|-....  +=.+.+..=.+. ..-|..|+.|+    .|.|...|++
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~-~~~f~~C~~C~kiyW~GsH~~~~~~  145 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYET-YDEFWRCPGCGKIYWEGSHWRRMEE  145 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCcccccc-CCeEEECCCCCCEecccccHHHHHh
Confidence            3678888888843320  000111000011 12277899998    5778777654


No 75 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=43.03  E-value=6.9  Score=21.78  Aligned_cols=13  Identities=15%  Similarity=0.335  Sum_probs=7.5

Q ss_pred             CcccCccCCCCCC
Q psy17526          1 MNAHSDRCQHGLG   13 (70)
Q Consensus         1 ~~~~C~~C~~~l~   13 (70)
                      |.+.||.|+|+..
T Consensus         1 m~v~CP~C~k~~~   13 (57)
T PF03884_consen    1 MTVKCPICGKPVE   13 (57)
T ss_dssp             -EEE-TTT--EEE
T ss_pred             CcccCCCCCCeec
Confidence            6788999999983


No 76 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=42.69  E-value=12  Score=17.39  Aligned_cols=7  Identities=14%  Similarity=0.430  Sum_probs=5.3

Q ss_pred             cCccCCC
Q psy17526          4 HSDRCQH   10 (70)
Q Consensus         4 ~C~~C~~   10 (70)
                      .||+||+
T Consensus        18 ~CPnCG~   24 (24)
T PF07754_consen   18 PCPNCGF   24 (24)
T ss_pred             eCCCCCC
Confidence            5888874


No 77 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=42.37  E-value=15  Score=18.95  Aligned_cols=19  Identities=21%  Similarity=0.141  Sum_probs=14.7

Q ss_pred             cCCCCCChHHHHHHHHhCC
Q psy17526         38 QGCSHGGHLSHMQEWFMKN   56 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~~   56 (70)
                      +.|||..-.++++.+.++.
T Consensus        17 L~CGH~~c~~cl~~l~~~~   35 (43)
T PF13445_consen   17 LPCGHVFCKDCLQKLSKKS   35 (43)
T ss_dssp             -SSS-EEEHHHHHHHHHH-
T ss_pred             EeCccHHHHHHHHHHHhcC
Confidence            6699999999999999854


No 78 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=42.22  E-value=20  Score=25.84  Aligned_cols=11  Identities=18%  Similarity=0.401  Sum_probs=8.7

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +-.|++||.++
T Consensus       111 ~RFCg~CG~~~  121 (279)
T COG2816         111 HRFCGRCGTKT  121 (279)
T ss_pred             CcCCCCCCCcC
Confidence            34789999888


No 79 
>PF01530 zf-C2HC:  Zinc finger, C2HC type;  InterPro: IPR002515 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (C2HC) type zinc finger domain found in eukaryotes. Proteins containing these domains include:   MYST family histone acetyltransferases [, [] Myelin transcription factor Myt1 [] Suppressor of tumourigenicity protein 18 (ST18) []   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2CS8_A 1PXE_A 2JX1_A 2JYD_A.
Probab=42.12  E-value=13  Score=18.34  Aligned_cols=8  Identities=63%  Similarity=1.460  Sum_probs=4.8

Q ss_pred             CCCCC-CCC
Q psy17526         57 NVCPT-GCG   64 (70)
Q Consensus        57 ~~CP~-gC~   64 (70)
                      ..||+ ||+
T Consensus         2 ~~CPtpGCd   10 (31)
T PF01530_consen    2 LKCPTPGCD   10 (31)
T ss_dssp             TSSSSTT--
T ss_pred             CcCCCCCCC
Confidence            57998 886


No 80 
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional
Probab=42.05  E-value=10  Score=30.10  Aligned_cols=11  Identities=18%  Similarity=0.305  Sum_probs=10.3

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      |++||.|||.|
T Consensus       518 yISCPsCGRTL  528 (611)
T PRK02048        518 YISCPGCGRTL  528 (611)
T ss_pred             EEECCCCCcch
Confidence            78999999999


No 81 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=40.84  E-value=7.6  Score=20.64  Aligned_cols=12  Identities=17%  Similarity=0.182  Sum_probs=6.2

Q ss_pred             cCccCCCCCCcC
Q psy17526          4 HSDRCQHGLGNF   15 (70)
Q Consensus         4 ~C~~C~~~l~~~   15 (70)
                      .||-|+|+|..-
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999998643


No 82 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=40.72  E-value=7.4  Score=21.33  Aligned_cols=13  Identities=15%  Similarity=0.309  Sum_probs=10.2

Q ss_pred             ccCccCCCCCCcC
Q psy17526          3 AHSDRCQHGLGNF   15 (70)
Q Consensus         3 ~~C~~C~~~l~~~   15 (70)
                      +.|++|+|-|.+.
T Consensus         5 iRC~~CnklLa~~   17 (51)
T PF10122_consen    5 IRCGHCNKLLAKA   17 (51)
T ss_pred             eeccchhHHHhhh
Confidence            5788999888664


No 83 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=40.50  E-value=14  Score=25.83  Aligned_cols=9  Identities=11%  Similarity=0.342  Sum_probs=6.8

Q ss_pred             cCccCCCCC
Q psy17526          4 HSDRCQHGL   12 (70)
Q Consensus         4 ~C~~C~~~l   12 (70)
                      .||+||.++
T Consensus       246 pCprCG~~I  254 (272)
T PRK14810        246 PCLNCKTPI  254 (272)
T ss_pred             cCCCCCCee
Confidence            577888777


No 84 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=40.27  E-value=13  Score=18.79  Aligned_cols=10  Identities=20%  Similarity=0.474  Sum_probs=8.6

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      ..||+||.+|
T Consensus         2 ~~CP~Cg~~l   11 (39)
T PF01396_consen    2 EKCPKCGGPL   11 (39)
T ss_pred             cCCCCCCcee
Confidence            3699999998


No 85 
>KOG0826|consensus
Probab=40.23  E-value=22  Score=26.44  Aligned_cols=24  Identities=21%  Similarity=0.610  Sum_probs=19.6

Q ss_pred             ccccccCCCCCChHHHHHHHHhCCCCCCC-CCC
Q psy17526         33 LYSWCQGCSHGGHLSHMQEWFMKNNVCPT-GCG   64 (70)
Q Consensus        33 l~~~C~~C~HggH~~h~~~Wf~~~~~CP~-gC~   64 (70)
                      -+++|        ..|+-.+..++..||+ |++
T Consensus       320 GyVfC--------Y~Ci~~Yv~~~~~CPVT~~p  344 (357)
T KOG0826|consen  320 GYVFC--------YPCIFSYVVNYGHCPVTGYP  344 (357)
T ss_pred             ceEEe--------HHHHHHHHHhcCCCCccCCc
Confidence            36677        6778889899999998 876


No 86 
>KOG1734|consensus
Probab=40.10  E-value=15  Score=26.89  Aligned_cols=27  Identities=22%  Similarity=0.577  Sum_probs=22.0

Q ss_pred             ccccCCCCCChHHHHHHHHhC--CCCCCC
Q psy17526         35 SWCQGCSHGGHLSHMQEWFMK--NNVCPT   61 (70)
Q Consensus        35 ~~C~~C~HggH~~h~~~Wf~~--~~~CP~   61 (70)
                      ++=+.|+|..|..|++-|-.-  -.+||-
T Consensus       247 ty~LsCnHvFHEfCIrGWcivGKkqtCPY  275 (328)
T KOG1734|consen  247 TYKLSCNHVFHEFCIRGWCIVGKKQTCPY  275 (328)
T ss_pred             heeeecccchHHHhhhhheeecCCCCCch
Confidence            456789999999999999654  467884


No 87 
>PRK00420 hypothetical protein; Validated
Probab=40.05  E-value=16  Score=22.94  Aligned_cols=21  Identities=19%  Similarity=0.150  Sum_probs=14.7

Q ss_pred             CcccCccCCCCCCc--Cc-ccccc
Q psy17526          1 MNAHSDRCQHGLGN--FG-KLEGK   21 (70)
Q Consensus         1 ~~~~C~~C~~~l~~--~~-~~C~~   21 (70)
                      +...||.||.||.+  .+ .+|..
T Consensus        22 l~~~CP~Cg~pLf~lk~g~~~Cp~   45 (112)
T PRK00420         22 LSKHCPVCGLPLFELKDGEVVCPV   45 (112)
T ss_pred             ccCCCCCCCCcceecCCCceECCC
Confidence            35789999999954  33 45654


No 88 
>PHA02862 5L protein; Provisional
Probab=39.86  E-value=28  Score=23.11  Aligned_cols=21  Identities=24%  Similarity=0.381  Sum_probs=15.8

Q ss_pred             CCCChHHHHHHHHhCC--CCCCC
Q psy17526         41 SHGGHLSHMQEWFMKN--NVCPT   61 (70)
Q Consensus        41 ~HggH~~h~~~Wf~~~--~~CP~   61 (70)
                      -.--|.+||++|.+.+  ..||.
T Consensus        25 ~K~VHq~CL~~WIn~S~k~~CeL   47 (156)
T PHA02862         25 YKVVHIKCMQLWINYSKKKECNL   47 (156)
T ss_pred             chhHHHHHHHHHHhcCCCcCccC
Confidence            3445999999999764  56776


No 89 
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=39.85  E-value=16  Score=25.74  Aligned_cols=10  Identities=10%  Similarity=0.401  Sum_probs=6.9

Q ss_pred             cCccCCCCCC
Q psy17526          4 HSDRCQHGLG   13 (70)
Q Consensus         4 ~C~~C~~~l~   13 (70)
                      .|++||.++.
T Consensus       256 pC~~Cg~~I~  265 (282)
T PRK13945        256 PCRKCGTPIE  265 (282)
T ss_pred             CCCcCCCeeE
Confidence            5777777773


No 90 
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=39.72  E-value=17  Score=22.60  Aligned_cols=14  Identities=14%  Similarity=0.370  Sum_probs=11.6

Q ss_pred             cccCccCCCCCCcC
Q psy17526          2 NAHSDRCQHGLGNF   15 (70)
Q Consensus         2 ~~~C~~C~~~l~~~   15 (70)
                      .+.||.||.+|...
T Consensus        47 ~~~cP~Cge~~~~a   60 (102)
T PF04475_consen   47 DTICPKCGEELDSA   60 (102)
T ss_pred             cccCCCCCCccCce
Confidence            57899999999654


No 91 
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=39.03  E-value=23  Score=18.15  Aligned_cols=27  Identities=22%  Similarity=0.618  Sum_probs=16.3

Q ss_pred             cccc--CCCCCChHHHHHHHHhCCC--CCCC
Q psy17526         35 SWCQ--GCSHGGHLSHMQEWFMKNN--VCPT   61 (70)
Q Consensus        35 ~~C~--~C~HggH~~h~~~Wf~~~~--~CP~   61 (70)
                      +-|.  .|+=..|..+++.+|...+  .||.
T Consensus        12 ~~C~~~~C~~r~H~~C~~~y~r~~~~~~CP~   42 (43)
T PF08746_consen   12 QRCSNRDCNVRLHDDCFKKYFRHRSNPKCPN   42 (43)
T ss_dssp             EE-SS--S--EE-HHHHHHHTTT-SS-B-TT
T ss_pred             ccCCCCccCchHHHHHHHHHHhcCCCCCCcC
Confidence            3466  4777899999999999865  6986


No 92 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=38.56  E-value=16  Score=23.59  Aligned_cols=22  Identities=14%  Similarity=0.276  Sum_probs=17.0

Q ss_pred             CcccCccCCCCCCcCccccccch
Q psy17526          1 MNAHSDRCQHGLGNFGKLEGKIQ   23 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~~~~C~~~~   23 (70)
                      +...|.+||+++... ++|+++.
T Consensus        80 l~~~CE~CG~~I~~G-r~C~~C~  101 (137)
T TIGR03826        80 LGYPCERCGTSIREG-RLCDSCA  101 (137)
T ss_pred             CcCcccccCCcCCCC-CccHHHH
Confidence            456799999988665 6888855


No 93 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=38.16  E-value=30  Score=18.79  Aligned_cols=20  Identities=15%  Similarity=0.177  Sum_probs=11.8

Q ss_pred             cccccccCCCCCChHHHHHH
Q psy17526         32 GLYSWCQGCSHGGHLSHMQE   51 (70)
Q Consensus        32 ~l~~~C~~C~HggH~~h~~~   51 (70)
                      +....|++||+..|.+.-.+
T Consensus        44 ~r~~~C~~Cg~~~~rD~naA   63 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDRDVNAA   63 (69)
T ss_pred             cceEEcCCCCCEECcHHHHH
Confidence            34566777777666554443


No 94 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=37.88  E-value=18  Score=25.39  Aligned_cols=28  Identities=14%  Similarity=0.283  Sum_probs=15.1

Q ss_pred             cCccCCCCCCcCccccccchHHHHhhhhcccccccCCCCC
Q psy17526          4 HSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQGCSHG   43 (70)
Q Consensus         4 ~C~~C~~~l~~~~~~C~~~~~iC~~~v~~l~~~C~~C~Hg   43 (70)
                      .||+||.++.+..            +-.+-..||++|...
T Consensus       237 pC~~Cg~~I~~~~------------~~gR~ty~Cp~CQ~~  264 (269)
T PRK14811        237 PCPRCGTPIEKIV------------VGGRGTHFCPQCQPL  264 (269)
T ss_pred             CCCcCCCeeEEEE------------ECCCCcEECCCCcCC
Confidence            4777777663321            123445666666654


No 95 
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=37.51  E-value=12  Score=19.33  Aligned_cols=10  Identities=10%  Similarity=0.408  Sum_probs=8.9

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      +.|+.||+.|
T Consensus         6 l~C~~CG~~m   15 (58)
T PF13408_consen    6 LRCGHCGSKM   15 (58)
T ss_pred             EEcccCCcEe
Confidence            5799999999


No 96 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=37.34  E-value=25  Score=20.89  Aligned_cols=11  Identities=36%  Similarity=0.797  Sum_probs=9.6

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +..|++|+++|
T Consensus        33 rS~C~~C~~~L   43 (92)
T PF06750_consen   33 RSHCPHCGHPL   43 (92)
T ss_pred             CCcCcCCCCcC
Confidence            46899999999


No 97 
>PF14260 zf-C4pol:  C4-type zinc-finger of DNA polymerase delta
Probab=37.27  E-value=21  Score=19.80  Aligned_cols=37  Identities=19%  Similarity=0.205  Sum_probs=25.9

Q ss_pred             CccCCCCCCcCc-cccccch--------------HHHHhhhhcccccccCCC
Q psy17526          5 SDRCQHGLGNFG-KLEGKIQ--------------MLVFCLVSGLYSWCQGCS   41 (70)
Q Consensus         5 C~~C~~~l~~~~-~~C~~~~--------------~iC~~~v~~l~~~C~~C~   41 (70)
                      |..|++.+.... .+|+.+.              ..-+..+..++..|++|.
T Consensus         1 C~~C~~~~~~~~~~lC~~C~~~~~~~~~~l~~~~~~~E~~~~~l~~iC~~C~   52 (73)
T PF14260_consen    1 CLVCGAKTQEGESPLCSNCRSDPQQTIYNLLSRLRELERRFNELWTICQSCS   52 (73)
T ss_pred             CCCCCCcCCCCCCCcCcccCcChHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            678999886532 4666632              122677888899999998


No 98 
>PF03942 DTW:  DTW domain;  InterPro: IPR005636 This presumed domain is found in bacterial and eukaryotic proteins. Its function is unknown. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after.
Probab=36.49  E-value=24  Score=23.31  Aligned_cols=19  Identities=16%  Similarity=0.134  Sum_probs=15.3

Q ss_pred             CcccCccCCCCCCcCcccccc
Q psy17526          1 MNAHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         1 ~~~~C~~C~~~l~~~~~~C~~   21 (70)
                      ++..|++|++++.-+  +|+.
T Consensus         1 rr~~C~~C~~~~~~C--~C~~   19 (203)
T PF03942_consen    1 RRFRCPRCWRPLSLC--ICSL   19 (203)
T ss_pred             CCCcCcCCCCccccC--CCcC
Confidence            578999999998665  5766


No 99 
>PRK03922 hypothetical protein; Provisional
Probab=36.40  E-value=20  Score=22.63  Aligned_cols=14  Identities=7%  Similarity=0.180  Sum_probs=11.6

Q ss_pred             cccCccCCCCCCcC
Q psy17526          2 NAHSDRCQHGLGNF   15 (70)
Q Consensus         2 ~~~C~~C~~~l~~~   15 (70)
                      .+.||.||.++...
T Consensus        49 ~~~cP~cge~~~~a   62 (113)
T PRK03922         49 LTICPKCGEPFDSA   62 (113)
T ss_pred             cccCCCCCCcCCcE
Confidence            57899999999653


No 100
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=36.34  E-value=13  Score=17.58  Aligned_cols=10  Identities=20%  Similarity=0.235  Sum_probs=5.4

Q ss_pred             cCccCCCCCC
Q psy17526          4 HSDRCQHGLG   13 (70)
Q Consensus         4 ~C~~C~~~l~   13 (70)
                      .||.||.+|-
T Consensus         1 ~CP~C~s~l~   10 (28)
T PF03119_consen    1 TCPVCGSKLV   10 (28)
T ss_dssp             B-TTT--BEE
T ss_pred             CcCCCCCEeE
Confidence            4899999983


No 101
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=36.20  E-value=22  Score=21.59  Aligned_cols=20  Identities=15%  Similarity=-0.077  Sum_probs=14.2

Q ss_pred             cCccCCCCCC---cCc-cccccch
Q psy17526          4 HSDRCQHGLG---NFG-KLEGKIQ   23 (70)
Q Consensus         4 ~C~~C~~~l~---~~~-~~C~~~~   23 (70)
                      .||.|+++.-   ..+ |.|+++.
T Consensus        37 ~Cp~C~~~~VkR~a~GIW~C~kCg   60 (89)
T COG1997          37 VCPFCGRTTVKRIATGIWKCRKCG   60 (89)
T ss_pred             cCCCCCCcceeeeccCeEEcCCCC
Confidence            6999999862   223 8888843


No 102
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=35.90  E-value=17  Score=18.44  Aligned_cols=14  Identities=21%  Similarity=0.415  Sum_probs=11.0

Q ss_pred             ccCccCCCCCCcCc
Q psy17526          3 AHSDRCQHGLGNFG   16 (70)
Q Consensus         3 ~~C~~C~~~l~~~~   16 (70)
                      ..|+.||..|.+.+
T Consensus         3 ~~C~~Cg~~l~~ig   16 (47)
T PF13005_consen    3 RACPDCGGELKEIG   16 (47)
T ss_pred             CcCCCCCceeeECC
Confidence            57999999996544


No 103
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=35.44  E-value=15  Score=18.78  Aligned_cols=10  Identities=10%  Similarity=0.281  Sum_probs=6.1

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      +.||.||.++
T Consensus        22 ~~Cp~CG~~~   31 (46)
T PRK00398         22 VRCPYCGYRI   31 (46)
T ss_pred             eECCCCCCeE
Confidence            4566666655


No 104
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=34.75  E-value=18  Score=18.36  Aligned_cols=8  Identities=13%  Similarity=0.380  Sum_probs=5.7

Q ss_pred             ccCccCCC
Q psy17526          3 AHSDRCQH   10 (70)
Q Consensus         3 ~~C~~C~~   10 (70)
                      +.||+||.
T Consensus        27 ~~CP~Cg~   34 (42)
T PF09723_consen   27 VPCPECGS   34 (42)
T ss_pred             CcCCCCCC
Confidence            56777777


No 105
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=34.18  E-value=21  Score=24.95  Aligned_cols=10  Identities=20%  Similarity=0.468  Sum_probs=6.8

Q ss_pred             cCccCCCCCC
Q psy17526          4 HSDRCQHGLG   13 (70)
Q Consensus         4 ~C~~C~~~l~   13 (70)
                      .||+||.++.
T Consensus       247 pC~~Cg~~I~  256 (274)
T PRK01103        247 PCRRCGTPIE  256 (274)
T ss_pred             CCCCCCCeeE
Confidence            4777777773


No 106
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=34.14  E-value=29  Score=17.64  Aligned_cols=22  Identities=32%  Similarity=0.561  Sum_probs=16.1

Q ss_pred             cccccCCCCCCh----HHHHHHHHhC
Q psy17526         34 YSWCQGCSHGGH----LSHMQEWFMK   55 (70)
Q Consensus        34 ~~~C~~C~HggH----~~h~~~Wf~~   55 (70)
                      ...|+.|+|++.    .+|+.+.|.+
T Consensus        11 l~~CL~C~~~~c~~~~~~h~~~H~~~   36 (50)
T smart00290       11 LWLCLTCGQVGCGRYQLGHALEHFEE   36 (50)
T ss_pred             eEEecCCCCcccCCCCCcHHHHHhhh
Confidence            557888888776    4678887765


No 107
>PRK10445 endonuclease VIII; Provisional
Probab=33.78  E-value=22  Score=24.81  Aligned_cols=11  Identities=18%  Similarity=0.404  Sum_probs=7.6

Q ss_pred             ccCccCCCCCC
Q psy17526          3 AHSDRCQHGLG   13 (70)
Q Consensus         3 ~~C~~C~~~l~   13 (70)
                      ..||+||.++.
T Consensus       236 ~~Cp~Cg~~I~  246 (263)
T PRK10445        236 EACERCGGIIE  246 (263)
T ss_pred             CCCCCCCCEeE
Confidence            35788887773


No 108
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=33.47  E-value=19  Score=18.02  Aligned_cols=11  Identities=27%  Similarity=0.498  Sum_probs=8.3

Q ss_pred             cCccCCCCCCc
Q psy17526          4 HSDRCQHGLGN   14 (70)
Q Consensus         4 ~C~~C~~~l~~   14 (70)
                      .||+|+..|..
T Consensus         1 ~CP~C~~~l~~   11 (41)
T PF13453_consen    1 KCPRCGTELEP   11 (41)
T ss_pred             CcCCCCcccce
Confidence            38999988843


No 109
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=33.36  E-value=21  Score=20.25  Aligned_cols=19  Identities=11%  Similarity=0.162  Sum_probs=15.6

Q ss_pred             ccCccCCCCCCcCcccccc
Q psy17526          3 AHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~   21 (70)
                      -+|+-||+++|..-..|+.
T Consensus         9 ~HC~VCg~aIp~de~~CSe   27 (64)
T COG4068           9 RHCVVCGKAIPPDEQVCSE   27 (64)
T ss_pred             ccccccCCcCCCccchHHH
Confidence            4799999999887667776


No 110
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=33.03  E-value=37  Score=25.19  Aligned_cols=24  Identities=17%  Similarity=0.347  Sum_probs=22.3

Q ss_pred             cCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         38 QGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        38 ~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ..|||+.-.-|++..+..+..||+
T Consensus        41 TtCgHtFCslCIR~hL~~qp~CP~   64 (391)
T COG5432          41 TTCGHTFCSLCIRRHLGTQPFCPV   64 (391)
T ss_pred             cccccchhHHHHHHHhcCCCCCcc
Confidence            369999999999999999999997


No 111
>PF07227 DUF1423:  Protein of unknown function (DUF1423);  InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []. Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.
Probab=32.68  E-value=18  Score=27.78  Aligned_cols=30  Identities=17%  Similarity=0.139  Sum_probs=23.0

Q ss_pred             HHHH----hhhhcccccccCCCCCChHHHHHHHH
Q psy17526         24 MLVF----CLVSGLYSWCQGCSHGGHLSHMQEWF   53 (70)
Q Consensus        24 ~iC~----~~v~~l~~~C~~C~HggH~~h~~~Wf   53 (70)
                      .||.    ..-..+|+.|-.|+|..|++|+..=.
T Consensus       132 ~iC~kfD~~~n~~~Wi~Cd~CgH~cH~dCALr~~  165 (446)
T PF07227_consen  132 CICSKFDDNKNTCSWIGCDVCGHWCHLDCALRHE  165 (446)
T ss_pred             cccCCcccCCCCeeEEeccCCCceehhhhhcccc
Confidence            6773    33456788899999999999987643


No 112
>PRK12366 replication factor A; Reviewed
Probab=32.32  E-value=17  Score=28.58  Aligned_cols=23  Identities=4%  Similarity=-0.068  Sum_probs=16.7

Q ss_pred             CcccCccCCCCCCc--Cccccccch
Q psy17526          1 MNAHSDRCQHGLGN--FGKLEGKIQ   23 (70)
Q Consensus         1 ~~~~C~~C~~~l~~--~~~~C~~~~   23 (70)
                      +|.+||.|+|.+..  ..|.|.++.
T Consensus       531 ~y~aCp~CnkKv~~~~g~~~C~~c~  555 (637)
T PRK12366        531 ILYLCPNCRKRVEEVDGEYICEFCG  555 (637)
T ss_pred             EEecccccCeEeEcCCCcEECCCCC
Confidence            47899999999943  226787754


No 113
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=32.30  E-value=32  Score=25.01  Aligned_cols=31  Identities=32%  Similarity=0.790  Sum_probs=22.7

Q ss_pred             hcccccccCCCCCChHHHHHHHHhCCCCCCCCCCc
Q psy17526         31 SGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCGH   65 (70)
Q Consensus        31 ~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~c   65 (70)
                      .++|+-|+.|++..+..-+.   ++..+||. |++
T Consensus        25 e~lw~KCp~c~~~~y~~eL~---~n~~vcp~-c~~   55 (294)
T COG0777          25 EGLWTKCPSCGEMLYRKELE---SNLKVCPK-CGH   55 (294)
T ss_pred             CCceeECCCccceeeHHHHH---hhhhcccc-cCc
Confidence            68899999999988874444   44568887 554


No 114
>KOG2906|consensus
Probab=32.27  E-value=18  Score=22.55  Aligned_cols=10  Identities=20%  Similarity=0.338  Sum_probs=8.8

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      +.||.||..|
T Consensus         2 ~FCP~Cgn~L   11 (105)
T KOG2906|consen    2 LFCPTCGNML   11 (105)
T ss_pred             cccCCCCCEE
Confidence            5799999998


No 115
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=32.10  E-value=43  Score=19.33  Aligned_cols=35  Identities=26%  Similarity=0.405  Sum_probs=20.2

Q ss_pred             ccCccCCCCCCcCccccccchHHHHhhhhccccccc--CCCCC
Q psy17526          3 AHSDRCQHGLGNFGKLEGKIQMLVFCLVSGLYSWCQ--GCSHG   43 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~~~~iC~~~v~~l~~~C~--~C~Hg   43 (70)
                      +.||.||... +.-    +.+.+ .+.++.++..|.  .|||-
T Consensus         2 m~CP~Cg~~a-~ir----tSr~~-s~~~~~~Y~qC~N~eCg~t   38 (72)
T PRK09678          2 FHCPLCQHAA-HAR----TSRYI-TDTTKERYHQCQNVNCSAT   38 (72)
T ss_pred             ccCCCCCCcc-EEE----EChhc-ChhhheeeeecCCCCCCCE
Confidence            5688888776 110    00011 133777788887  78875


No 116
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=31.69  E-value=13  Score=20.85  Aligned_cols=11  Identities=18%  Similarity=0.582  Sum_probs=9.4

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      .|.|.+|||++
T Consensus        10 ~t~CrRCGk~i   20 (60)
T PF10892_consen   10 ETPCRRCGKSI   20 (60)
T ss_pred             eehhhhhCccH
Confidence            36899999998


No 117
>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated
Probab=31.22  E-value=18  Score=28.68  Aligned_cols=13  Identities=15%  Similarity=0.074  Sum_probs=11.0

Q ss_pred             CcccCccCCCCCC
Q psy17526          1 MNAHSDRCQHGLG   13 (70)
Q Consensus         1 ~~~~C~~C~~~l~   13 (70)
                      .|++||.|||.|-
T Consensus       509 e~isCP~CgRtlf  521 (606)
T PRK00694        509 EYISCPGCGRTLF  521 (606)
T ss_pred             eEEECCCCCceee
Confidence            3789999999983


No 118
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=30.92  E-value=24  Score=18.00  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=5.2

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      +.||+|+|.-
T Consensus         3 ~~CprC~kg~   12 (36)
T PF14787_consen    3 GLCPRCGKGF   12 (36)
T ss_dssp             -C-TTTSSSC
T ss_pred             ccCcccCCCc
Confidence            4577777654


No 119
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=30.33  E-value=30  Score=17.98  Aligned_cols=19  Identities=37%  Similarity=0.889  Sum_probs=14.9

Q ss_pred             cccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         36 WCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        36 ~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      -|.+||=-||.       ..+..||.
T Consensus         3 kC~~CG~~GH~-------~t~k~CP~   21 (40)
T PF15288_consen    3 KCKNCGAFGHM-------RTNKRCPM   21 (40)
T ss_pred             ccccccccccc-------ccCccCCC
Confidence            47889988887       56778885


No 120
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=30.14  E-value=31  Score=23.56  Aligned_cols=21  Identities=14%  Similarity=0.177  Sum_probs=15.3

Q ss_pred             CcccCccCCCCCC--cCcccccc
Q psy17526          1 MNAHSDRCQHGLG--NFGKLEGK   21 (70)
Q Consensus         1 ~~~~C~~C~~~l~--~~~~~C~~   21 (70)
                      |...||.|+.+|.  ...|.|..
T Consensus         1 ~~~~CP~C~~~l~~~~~~~~C~~   23 (272)
T PRK11088          1 MSYQCPLCHQPLTLEENSWICPQ   23 (272)
T ss_pred             CcccCCCCCcchhcCCCEEEcCC
Confidence            4468999999993  23477776


No 121
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=30.08  E-value=26  Score=21.32  Aligned_cols=12  Identities=8%  Similarity=0.155  Sum_probs=10.3

Q ss_pred             cccCccCCCCCC
Q psy17526          2 NAHSDRCQHGLG   13 (70)
Q Consensus         2 ~~~C~~C~~~l~   13 (70)
                      +|.||+|+++-+
T Consensus         8 ~tyCp~CkkHt~   19 (92)
T PRK05767          8 RTYCPYCKTHTE   19 (92)
T ss_pred             cccCcCCCCccc
Confidence            689999999883


No 122
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=29.93  E-value=25  Score=21.88  Aligned_cols=20  Identities=10%  Similarity=0.237  Sum_probs=16.6

Q ss_pred             cccCccCCCCCCcCcccccc
Q psy17526          2 NAHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~   21 (70)
                      ++.|.+||+.+|+.-.++.-
T Consensus        20 ~v~CdnCg~~vPkdKAikr~   39 (108)
T COG4830          20 YVRCDNCGKAVPKDKAIKRT   39 (108)
T ss_pred             ceeeccccccCCccceeeEe
Confidence            67899999999988766655


No 123
>PTZ00157 60S ribosomal protein L36a; Provisional
Probab=29.80  E-value=27  Score=20.97  Aligned_cols=12  Identities=8%  Similarity=0.315  Sum_probs=10.3

Q ss_pred             cccCccCCCCCC
Q psy17526          2 NAHSDRCQHGLG   13 (70)
Q Consensus         2 ~~~C~~C~~~l~   13 (70)
                      +|.||+|+++-+
T Consensus         9 ~tyC~~C~kHt~   20 (84)
T PTZ00157          9 KTYCKKCGKHTS   20 (84)
T ss_pred             cccCcCCCCCcc
Confidence            689999999883


No 124
>PTZ00166 DNA polymerase delta catalytic subunit; Provisional
Probab=29.70  E-value=41  Score=28.18  Aligned_cols=43  Identities=21%  Similarity=0.242  Sum_probs=31.3

Q ss_pred             cccCccCCCCCCcCccccccc-h-----H---------HHHhhhhcccccccCCCCCCh
Q psy17526          2 NAHSDRCQHGLGNFGKLEGKI-Q-----M---------LVFCLVSGLYSWCQGCSHGGH   45 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~~-~-----~---------iC~~~v~~l~~~C~~C~HggH   45 (70)
                      ...|..|++++... .+|..+ .     .         .-+....++++.|+.|.+..|
T Consensus       960 ~~~c~~c~~~~~~~-~~c~~c~~~~~~~~~~~~~~~~~~~e~~~~~~~~~c~~c~g~~~ 1017 (1054)
T PTZ00166        960 QLQCLGCKSVIKEG-ALCDNCNQNKEPSIYGKKLAKRRHKEAEYSQLWTQCQRCQGSLH 1017 (1054)
T ss_pred             CcccCCCCCCCCCC-CcCccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCC
Confidence            35799999999543 477665 1     1         225677889999999998776


No 125
>PHA02825 LAP/PHD finger-like protein; Provisional
Probab=29.61  E-value=64  Score=21.57  Aligned_cols=23  Identities=22%  Similarity=0.601  Sum_probs=17.3

Q ss_pred             CCCCCC-----hHHHHHHHHhCC--CCCCC
Q psy17526         39 GCSHGG-----HLSHMQEWFMKN--NVCPT   61 (70)
Q Consensus        39 ~C~Hgg-----H~~h~~~Wf~~~--~~CP~   61 (70)
                      -|.=-|     |.++++.|....  ..|+.
T Consensus        24 PC~CkGs~k~VH~sCL~rWi~~s~~~~Cei   53 (162)
T PHA02825         24 YCNCKNENKIVHKECLEEWINTSKNKSCKI   53 (162)
T ss_pred             CcccCCCchHHHHHHHHHHHhcCCCCcccc
Confidence            455555     999999998874  56775


No 126
>KOG4718|consensus
Probab=28.80  E-value=51  Score=23.21  Aligned_cols=27  Identities=22%  Similarity=0.653  Sum_probs=24.9

Q ss_pred             ccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         35 SWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        35 ~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      +-|.+|+--.|..+++++|++...||.
T Consensus       195 ~rCg~c~i~~h~~c~qty~q~~~~cph  221 (235)
T KOG4718|consen  195 IRCGSCNIQYHRGCIQTYLQRRDICPH  221 (235)
T ss_pred             eccCcccchhhhHHHHHHhcccCcCCc
Confidence            559999999999999999999999997


No 127
>PHA02776 E7 protein; Provisional
Probab=27.98  E-value=34  Score=21.09  Aligned_cols=38  Identities=21%  Similarity=0.216  Sum_probs=21.2

Q ss_pred             ccCccCCCCCCcCcccccc--chHHHHhhhhcccccccCCC
Q psy17526          3 AHSDRCQHGLGNFGKLEGK--IQMLVFCLVSGLYSWCQGCS   41 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~--~~~iC~~~v~~l~~~C~~C~   41 (70)
                      +.|.+|++.+-=.. .++.  ++.+=.+.+..+.+.|+.|.
T Consensus        59 t~C~~C~~~lRL~V-~st~~~IR~lqqLLl~~L~ivCp~Ca   98 (101)
T PHA02776         59 TCCCGCDNNVRLVV-ECTEPDIQELHNLLLGSLNIVCPICA   98 (101)
T ss_pred             eECCCCCCeEEEEE-EcChhhHHHHHHHhcCCeEEECCCCC
Confidence            34666666553332 2322  22333566678888888885


No 128
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=27.85  E-value=25  Score=21.92  Aligned_cols=36  Identities=14%  Similarity=0.076  Sum_probs=20.3

Q ss_pred             cccCccCCCCCCcCccccccchHHHHhhhh-cccccccCCCCCC
Q psy17526          2 NAHSDRCQHGLGNFGKLEGKIQMLVFCLVS-GLYSWCQGCSHGG   44 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~~~~iC~~~v~-~l~~~C~~C~Hgg   44 (70)
                      ++.|.+|..+|-+.. .+.-      .... .+.+-|+.||+.-
T Consensus        56 R~~CkkC~t~Lvpg~-n~rv------R~~~~~v~vtC~~CG~~~   92 (105)
T COG2023          56 RTICKKCYTPLVPGK-NARV------RLRKGRVVVTCLECGTIR   92 (105)
T ss_pred             HHhccccCcccccCc-ceEE------EEcCCeEEEEecCCCcEE
Confidence            467999999883322 1211      1111 1667788888753


No 129
>PRK02935 hypothetical protein; Provisional
Probab=27.23  E-value=26  Score=22.03  Aligned_cols=11  Identities=9%  Similarity=0.265  Sum_probs=8.9

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +..||+|+|+-
T Consensus        70 qV~CP~C~K~T   80 (110)
T PRK02935         70 QVICPSCEKPT   80 (110)
T ss_pred             eeECCCCCchh
Confidence            46799999976


No 130
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=27.08  E-value=33  Score=24.96  Aligned_cols=39  Identities=15%  Similarity=0.155  Sum_probs=23.8

Q ss_pred             cCccCCCCCCcCccccccch-HHHHhhhhc--------ccccccCCCCCCh
Q psy17526          4 HSDRCQHGLGNFGKLEGKIQ-MLVFCLVSG--------LYSWCQGCSHGGH   45 (70)
Q Consensus         4 ~C~~C~~~l~~~~~~C~~~~-~iC~~~v~~--------l~~~C~~C~HggH   45 (70)
                      .|..|+| |+.  +.|.++. .+|++-|++        -.+.|+.|+|...
T Consensus       173 KC~SCNr-lGq--~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~et~  220 (314)
T PF06524_consen  173 KCQSCNR-LGQ--YSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGYETQ  220 (314)
T ss_pred             ccccccc-ccc--hhhhheeeeehhhhhhhcccccccCCCCCCCCCCCccc
Confidence            3555555 211  3566665 677776655        3456999999753


No 131
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=26.95  E-value=22  Score=24.85  Aligned_cols=9  Identities=22%  Similarity=0.549  Sum_probs=6.5

Q ss_pred             cCccCCCCC
Q psy17526          4 HSDRCQHGL   12 (70)
Q Consensus         4 ~C~~C~~~l   12 (70)
                      .||+||.++
T Consensus       247 pC~~Cg~~I  255 (272)
T TIGR00577       247 PCRRCGTPI  255 (272)
T ss_pred             CCCCCCCee
Confidence            577777777


No 132
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=26.91  E-value=43  Score=18.46  Aligned_cols=11  Identities=9%  Similarity=0.084  Sum_probs=8.5

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      ...||.||.++
T Consensus        17 k~~CP~CG~~t   27 (56)
T PRK13130         17 KEICPVCGGKT   27 (56)
T ss_pred             cccCcCCCCCC
Confidence            45788888887


No 133
>KOG2612|consensus
Probab=26.89  E-value=31  Score=21.16  Aligned_cols=12  Identities=25%  Similarity=0.861  Sum_probs=9.0

Q ss_pred             CcccCccCCCCC
Q psy17526          1 MNAHSDRCQHGL   12 (70)
Q Consensus         1 ~~~~C~~C~~~l   12 (70)
                      |+..|++|+|-.
T Consensus        73 ~~~hCeNC~RdV   84 (103)
T KOG2612|consen   73 MDCHCENCDRDV   84 (103)
T ss_pred             ccccCCCCccHH
Confidence            677888888754


No 134
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase. Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase. This enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.
Probab=26.55  E-value=62  Score=21.41  Aligned_cols=33  Identities=18%  Similarity=0.553  Sum_probs=22.5

Q ss_pred             hhhcccccccCCCCCCh-------------HHHHHHHHhC--CCCCCC
Q psy17526         29 LVSGLYSWCQGCSHGGH-------------LSHMQEWFMK--NNVCPT   61 (70)
Q Consensus        29 ~v~~l~~~C~~C~HggH-------------~~h~~~Wf~~--~~~CP~   61 (70)
                      ...++..||.+|.+--|             ...+.+|+++  .++|+.
T Consensus       109 ~~d~~~wyc~~c~~~~~e~~f~~~d~~~~~~~~~~~f~~~~~~rtC~~  156 (159)
T TIGR03037       109 ELDGFQWFCPQCGHKLHRAEVQLENIVTDLPPVFEHFYSNEDARTCKN  156 (159)
T ss_pred             CCcceEEECCCCCCeEEEEEEEecChhhhhHHHHHHHhCChhhccCCc
Confidence            35677777888877766             3456677766  467876


No 135
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional
Probab=26.34  E-value=60  Score=21.87  Aligned_cols=35  Identities=23%  Similarity=0.677  Sum_probs=23.6

Q ss_pred             hhhcccccccCCCCCCh-------------HHHHHHHHhC--CCCCCCCCC
Q psy17526         29 LVSGLYSWCQGCSHGGH-------------LSHMQEWFMK--NNVCPTGCG   64 (70)
Q Consensus        29 ~v~~l~~~C~~C~HggH-------------~~h~~~Wf~~--~~~CP~gC~   64 (70)
                      ...++-.||.+|.+--|             ...+.+|+++  .++|+. ||
T Consensus       115 ~~d~~~wyc~~c~~~~~e~~f~~~d~~~~~~~~~~~f~~~~e~rtC~~-CG  164 (177)
T PRK13264        115 ELDGFQWYCDECNHKVHEVEVQLTDIETDLPPVFAAFYASEELRTCDN-CG  164 (177)
T ss_pred             CccceEEECCCCCCeEEEEEEEecChhhhhHHHHHHHhcCHhhccCCc-CC
Confidence            45677778888887766             3456677766  467876 44


No 136
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=26.00  E-value=28  Score=21.68  Aligned_cols=22  Identities=9%  Similarity=0.086  Sum_probs=12.4

Q ss_pred             cccCc--cCCCCCCcC---ccccccch
Q psy17526          2 NAHSD--RCQHGLGNF---GKLEGKIQ   23 (70)
Q Consensus         2 ~~~C~--~C~~~l~~~---~~~C~~~~   23 (70)
                      |.+||  .|+|.+...   .+.|.++.
T Consensus        18 Y~aC~~~~C~kKv~~~~~~~y~C~~C~   44 (146)
T PF08646_consen   18 YPACPNEKCNKKVTENGDGSYRCEKCN   44 (146)
T ss_dssp             EEE-TSTTTS-B-EEETTTEEEETTTT
T ss_pred             ECCCCCccCCCEeecCCCcEEECCCCC
Confidence            67899  999988322   25776643


No 137
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=25.56  E-value=27  Score=22.05  Aligned_cols=11  Identities=9%  Similarity=0.295  Sum_probs=8.3

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +..||+|+|+-
T Consensus        69 ~V~CP~C~K~T   79 (114)
T PF11023_consen   69 QVECPNCGKQT   79 (114)
T ss_pred             eeECCCCCChH
Confidence            35799999875


No 138
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=25.27  E-value=37  Score=15.35  Aligned_cols=10  Identities=10%  Similarity=0.268  Sum_probs=7.7

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      ..|+.|||..
T Consensus         3 ~~C~~CgR~F   12 (25)
T PF13913_consen    3 VPCPICGRKF   12 (25)
T ss_pred             CcCCCCCCEE
Confidence            5688888876


No 139
>TIGR03823 FliZ flagellar regulatory protein FliZ. FliZ is involved in the regulation of flagellar assembly and possibly also the down-regulation of the motile phenotype. FliZ interacts with the flagellar translational activator FlhCD complex.
Probab=25.22  E-value=24  Score=23.63  Aligned_cols=19  Identities=21%  Similarity=0.401  Sum_probs=15.0

Q ss_pred             cccCccCCCCCCcCcccccc
Q psy17526          2 NAHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~   21 (70)
                      .|.|.+|+|.|.|.. ...+
T Consensus        22 QthCshC~K~LDRis-LV~~   40 (168)
T TIGR03823        22 QTHCSHCHKLLDRIS-LVFR   40 (168)
T ss_pred             cchhhhhcchhhhee-eeec
Confidence            589999999998875 4544


No 140
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.18  E-value=93  Score=22.77  Aligned_cols=25  Identities=28%  Similarity=0.622  Sum_probs=20.7

Q ss_pred             CCCCCChHHHHHHHHhCC-CCCCCCCC
Q psy17526         39 GCSHGGHLSHMQEWFMKN-NVCPTGCG   64 (70)
Q Consensus        39 ~C~HggH~~h~~~Wf~~~-~~CP~gC~   64 (70)
                      .|||-.-.+|+...|... ..||. |+
T Consensus        25 ~CGH~~C~sCv~~l~~~~~~~CP~-C~   50 (309)
T TIGR00570        25 VCGHTLCESCVDLLFVRGSGSCPE-CD   50 (309)
T ss_pred             CCCCcccHHHHHHHhcCCCCCCCC-CC
Confidence            799999999999988764 57995 54


No 141
>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
Probab=25.04  E-value=31  Score=28.06  Aligned_cols=14  Identities=14%  Similarity=0.162  Sum_probs=11.5

Q ss_pred             CcccCccCCCCCCc
Q psy17526          1 MNAHSDRCQHGLGN   14 (70)
Q Consensus         1 ~~~~C~~C~~~l~~   14 (70)
                      .+++||.|||.+..
T Consensus       633 e~isCPgCGRT~~d  646 (733)
T PLN02925        633 EYVSCPSCGRTLFD  646 (733)
T ss_pred             eEEECCCCCCcccc
Confidence            37899999999843


No 142
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=24.90  E-value=26  Score=17.26  Aligned_cols=10  Identities=20%  Similarity=0.348  Sum_probs=8.0

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      ..||+||.-|
T Consensus         2 ~FCp~C~nlL   11 (35)
T PF02150_consen    2 RFCPECGNLL   11 (35)
T ss_dssp             -BETTTTSBE
T ss_pred             eeCCCCCccc
Confidence            4799999988


No 143
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=24.71  E-value=15  Score=20.05  Aligned_cols=24  Identities=17%  Similarity=0.256  Sum_probs=16.2

Q ss_pred             cccccccCCCCCChHH----HHHHHHhC
Q psy17526         32 GLYSWCQGCSHGGHLS----HMQEWFMK   55 (70)
Q Consensus        32 ~l~~~C~~C~HggH~~----h~~~Wf~~   55 (70)
                      .-...|+.|++.|-..    |+++.+++
T Consensus         9 ~~lw~CL~Cg~~~C~~~~~~Ha~~H~~~   36 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGRYSNGHALKHYKE   36 (63)
T ss_dssp             SSEEEETTTS-EEETTTSTSHHHHHHHH
T ss_pred             CceEEeCCCCcccccCCcCcHHHHhhcc
Confidence            3445588888887765    77887765


No 144
>PRK11582 flagella biosynthesis protein FliZ; Provisional
Probab=24.31  E-value=27  Score=23.41  Aligned_cols=19  Identities=21%  Similarity=0.366  Sum_probs=15.1

Q ss_pred             cccCccCCCCCCcCcccccc
Q psy17526          2 NAHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~   21 (70)
                      .|+|.+|+|.|.|.. ...+
T Consensus        22 QthCshC~K~LDRis-LV~~   40 (169)
T PRK11582         22 QTHCAHCRKLLDRIT-LVFR   40 (169)
T ss_pred             ccchhhhccchhhee-eeec
Confidence            589999999998875 5544


No 145
>PRK08402 replication factor A; Reviewed
Probab=24.25  E-value=26  Score=25.84  Aligned_cols=21  Identities=5%  Similarity=0.067  Sum_probs=15.8

Q ss_pred             CcccCccCCCCCC----cCcccccc
Q psy17526          1 MNAHSDRCQHGLG----NFGKLEGK   21 (70)
Q Consensus         1 ~~~~C~~C~~~l~----~~~~~C~~   21 (70)
                      +|.+||.|+|.+.    ...|.|..
T Consensus       211 ~y~aCp~CnKkv~~~~~~~~~~Ce~  235 (355)
T PRK08402        211 VYDACPECRRKVDYDPATDTWICPE  235 (355)
T ss_pred             eEecCCCCCeEEEEecCCCCEeCCC
Confidence            4789999999994    23477876


No 146
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=24.20  E-value=31  Score=18.72  Aligned_cols=12  Identities=8%  Similarity=0.282  Sum_probs=8.5

Q ss_pred             CcccCccCCCCC
Q psy17526          1 MNAHSDRCQHGL   12 (70)
Q Consensus         1 ~~~~C~~C~~~l   12 (70)
                      +|-.||+||.-.
T Consensus        12 kY~~Cp~CGN~~   23 (49)
T PF12677_consen   12 KYCKCPKCGNDK   23 (49)
T ss_pred             hhccCcccCCcE
Confidence            366788888754


No 147
>KOG1941|consensus
Probab=24.19  E-value=40  Score=25.99  Aligned_cols=25  Identities=40%  Similarity=0.622  Sum_probs=21.6

Q ss_pred             ccCCCCCChHHHHHHHHhCC--CCCCC
Q psy17526         37 CQGCSHGGHLSHMQEWFMKN--NVCPT   61 (70)
Q Consensus        37 C~~C~HggH~~h~~~Wf~~~--~~CP~   61 (70)
                      -+.|.|..|..++.+.+.++  +.||.
T Consensus       384 ALpCsHIfH~rCl~e~L~~n~~rsCP~  410 (518)
T KOG1941|consen  384 ALPCSHIFHLRCLQEILENNGTRSCPN  410 (518)
T ss_pred             ccchhHHHHHHHHHHHHHhCCCCCCcc
Confidence            57789999999999999885  67885


No 148
>KOG2114|consensus
Probab=24.00  E-value=36  Score=28.36  Aligned_cols=20  Identities=30%  Similarity=0.635  Sum_probs=17.3

Q ss_pred             CCCCCChHHHHHHHHhCCCCCCC
Q psy17526         39 GCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        39 ~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      .|+|..|.+|+.   ...++||.
T Consensus       858 ~CgHsyHqhC~e---~~~~~CP~  877 (933)
T KOG2114|consen  858 LCGHSYHQHCLE---DKEDKCPK  877 (933)
T ss_pred             ecccHHHHHhhc---cCcccCCc
Confidence            589999999998   66789996


No 149
>PRK07218 replication factor A; Provisional
Probab=23.90  E-value=41  Score=25.41  Aligned_cols=18  Identities=6%  Similarity=0.028  Sum_probs=13.8

Q ss_pred             cccCccCCCCCCcCcccccc
Q psy17526          2 NAHSDRCQHGLGNFGKLEGK   21 (70)
Q Consensus         2 ~~~C~~C~~~l~~~~~~C~~   21 (70)
                      .+.||.|+|.|.+  ++|..
T Consensus       297 i~rCP~C~r~v~~--~~C~~  314 (423)
T PRK07218        297 IERCPECGRVIQK--GQCRS  314 (423)
T ss_pred             eecCcCccccccC--CcCCC
Confidence            4689999999976  25655


No 150
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=23.89  E-value=29  Score=22.69  Aligned_cols=28  Identities=32%  Similarity=0.859  Sum_probs=17.9

Q ss_pred             cccccCCCCCChHHHHHHHHhC-----------CCCCCCCCCc
Q psy17526         34 YSWCQGCSHGGHLSHMQEWFMK-----------NNVCPTGCGH   65 (70)
Q Consensus        34 ~~~C~~C~HggH~~h~~~Wf~~-----------~~~CP~gC~c   65 (70)
                      ..|=+.|.+| |.  ...||.+           .-.||+ ||.
T Consensus         2 I~y~L~C~~g-H~--FEgWF~ss~~fd~Q~~~glv~CP~-Cgs   40 (148)
T PF06676_consen    2 IVYDLRCENG-HE--FEGWFRSSAAFDRQQARGLVSCPV-CGS   40 (148)
T ss_pred             eeEEEecCCC-Cc--cceecCCHHHHHHHHHcCCccCCC-CCC
Confidence            3455566643 44  6899998           246998 553


No 151
>PRK05978 hypothetical protein; Provisional
Probab=23.40  E-value=47  Score=21.69  Aligned_cols=34  Identities=21%  Similarity=0.649  Sum_probs=24.6

Q ss_pred             HhhhhcccccccCCCCCChHHHHHHHHhCCCCCCCCCC
Q psy17526         27 FCLVSGLYSWCQGCSHGGHLSHMQEWFMKNNVCPTGCG   64 (70)
Q Consensus        27 ~~~v~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~gC~   64 (70)
                      ....+|+.--|++||-|-=.   +.+++-+..||. ||
T Consensus        26 ~~~~rGl~grCP~CG~G~LF---~g~Lkv~~~C~~-CG   59 (148)
T PRK05978         26 RAMWRGFRGRCPACGEGKLF---RAFLKPVDHCAA-CG   59 (148)
T ss_pred             HHHHHHHcCcCCCCCCCccc---ccccccCCCccc-cC
Confidence            35668888899999988433   455666888997 44


No 152
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=23.06  E-value=60  Score=17.84  Aligned_cols=26  Identities=12%  Similarity=-0.003  Sum_probs=16.6

Q ss_pred             HHHHhhh--hcccccccCCCCCChHHHH
Q psy17526         24 MLVFCLV--SGLYSWCQGCSHGGHLSHM   49 (70)
Q Consensus        24 ~iC~~~v--~~l~~~C~~C~HggH~~h~   49 (70)
                      .+|.+++  ..-.+.|+.|+=.-|-++.
T Consensus         9 ~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    9 PVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             hhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            3455555  4556778888877766553


No 153
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.82  E-value=12  Score=17.64  Aligned_cols=23  Identities=17%  Similarity=0.485  Sum_probs=13.3

Q ss_pred             HHHhhhhcc-cccccCCCCCChHH
Q psy17526         25 LVFCLVSGL-YSWCQGCSHGGHLS   47 (70)
Q Consensus        25 iC~~~v~~l-~~~C~~C~HggH~~   47 (70)
                      +|++.+.+. +..|..|.-..|..
T Consensus         5 ~C~~~~~~~~~Y~C~~c~f~lh~~   28 (30)
T PF03107_consen    5 VCRRKIDGFYFYHCSECCFTLHVR   28 (30)
T ss_pred             CCCCCcCCCEeEEeCCCCCeEcCc
Confidence            455556666 66666666555543


No 154
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=22.77  E-value=42  Score=16.78  Aligned_cols=11  Identities=36%  Similarity=0.682  Sum_probs=8.9

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      .+.||.|++.-
T Consensus         5 ~v~CP~C~s~~   15 (36)
T PF03811_consen    5 DVHCPRCQSTE   15 (36)
T ss_pred             eeeCCCCCCCC
Confidence            46799999876


No 155
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=22.64  E-value=44  Score=16.64  Aligned_cols=10  Identities=10%  Similarity=0.252  Sum_probs=7.9

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      ..||.||.+.
T Consensus         3 ~~Cp~Cg~~~   12 (47)
T PF14690_consen    3 PRCPHCGSPS   12 (47)
T ss_pred             ccCCCcCCCc
Confidence            5789999776


No 156
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=22.31  E-value=36  Score=14.34  Aligned_cols=11  Identities=36%  Similarity=0.966  Sum_probs=7.7

Q ss_pred             cccCCCCCChH
Q psy17526         36 WCQGCSHGGHL   46 (70)
Q Consensus        36 ~C~~C~HggH~   46 (70)
                      .|-+|+=.||.
T Consensus         2 ~C~~C~~~GH~   12 (18)
T PF00098_consen    2 KCFNCGEPGHI   12 (18)
T ss_dssp             BCTTTSCSSSC
T ss_pred             cCcCCCCcCcc
Confidence            36677777775


No 157
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=21.92  E-value=40  Score=20.63  Aligned_cols=11  Identities=9%  Similarity=0.220  Sum_probs=9.5

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +|.||.|.++-
T Consensus         8 ~tyCp~CkkhT   18 (94)
T COG1631           8 RTYCPYCKKHT   18 (94)
T ss_pred             eecCcccccce
Confidence            68899999887


No 158
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=21.91  E-value=44  Score=18.25  Aligned_cols=9  Identities=33%  Similarity=0.615  Sum_probs=6.2

Q ss_pred             cccCccCCC
Q psy17526          2 NAHSDRCQH   10 (70)
Q Consensus         2 ~~~C~~C~~   10 (70)
                      |-.||+||-
T Consensus        19 ~~~CPrCG~   27 (51)
T COG1998          19 NRFCPRCGP   27 (51)
T ss_pred             cccCCCCCC
Confidence            456888883


No 159
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=21.83  E-value=46  Score=16.71  Aligned_cols=9  Identities=11%  Similarity=0.250  Sum_probs=6.6

Q ss_pred             cCccCCCCC
Q psy17526          4 HSDRCQHGL   12 (70)
Q Consensus         4 ~C~~C~~~l   12 (70)
                      .||+||...
T Consensus         2 ~Cp~Cg~~~   10 (43)
T PF08271_consen    2 KCPNCGSKE   10 (43)
T ss_dssp             SBTTTSSSE
T ss_pred             CCcCCcCCc
Confidence            688888764


No 160
>KOG0825|consensus
Probab=21.64  E-value=65  Score=27.09  Aligned_cols=31  Identities=16%  Similarity=0.155  Sum_probs=26.4

Q ss_pred             hcccccccCCCCCChHHHHHHHHhCCCCCCC
Q psy17526         31 SGLYSWCQGCSHGGHLSHMQEWFMKNNVCPT   61 (70)
Q Consensus        31 ~~l~~~C~~C~HggH~~h~~~Wf~~~~~CP~   61 (70)
                      ++|..-=..|+|..|.+++..|-....+||+
T Consensus       135 DqL~~~~k~c~H~FC~~Ci~sWsR~aqTCPi  165 (1134)
T KOG0825|consen  135 DQLEESEKHTAHYFCEECVGSWSRCAQTCPV  165 (1134)
T ss_pred             HHhhccccccccccHHHHhhhhhhhcccCch
Confidence            4555556789999999999999999999996


No 161
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=21.37  E-value=53  Score=18.54  Aligned_cols=10  Identities=10%  Similarity=0.394  Sum_probs=8.7

Q ss_pred             ccCccCCCCC
Q psy17526          3 AHSDRCQHGL   12 (70)
Q Consensus         3 ~~C~~C~~~l   12 (70)
                      ..||.|+|+.
T Consensus         7 v~CP~C~k~~   16 (62)
T PRK00418          7 VNCPTCGKPV   16 (62)
T ss_pred             ccCCCCCCcc
Confidence            5799999986


No 162
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=21.34  E-value=49  Score=16.89  Aligned_cols=9  Identities=11%  Similarity=0.183  Sum_probs=6.6

Q ss_pred             ccCccCCCC
Q psy17526          3 AHSDRCQHG   11 (70)
Q Consensus         3 ~~C~~C~~~   11 (70)
                      .+||+||..
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            468888874


No 163
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=21.22  E-value=21  Score=19.80  Aligned_cols=12  Identities=17%  Similarity=0.132  Sum_probs=7.5

Q ss_pred             cccCccCCCCCC
Q psy17526          2 NAHSDRCQHGLG   13 (70)
Q Consensus         2 ~~~C~~C~~~l~   13 (70)
                      +..|++||.+|-
T Consensus        48 r~FC~~CGs~l~   59 (92)
T PF04828_consen   48 RYFCPTCGSPLF   59 (92)
T ss_dssp             EEEETTT--EEE
T ss_pred             CcccCCCCCeee
Confidence            357999999883


No 164
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional
Probab=21.21  E-value=59  Score=23.08  Aligned_cols=25  Identities=28%  Similarity=0.634  Sum_probs=20.0

Q ss_pred             hhcccccccCCCCCChHHHHHHHHh
Q psy17526         30 VSGLYSWCQGCSHGGHLSHMQEWFM   54 (70)
Q Consensus        30 v~~l~~~C~~C~HggH~~h~~~Wf~   54 (70)
                      |+|-.+||+.|+|++=..-+++=+.
T Consensus         3 ~~r~~~~CpGCg~~~il~al~~al~   27 (279)
T PRK11866          3 VKRPPIWCPGCGNYGILEALRKALA   27 (279)
T ss_pred             CCCCCCCCCCCCChHHHHHHHHHHH
Confidence            5667899999999987777777663


No 165
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=20.60  E-value=77  Score=16.15  Aligned_cols=21  Identities=14%  Similarity=-0.040  Sum_probs=13.5

Q ss_pred             ccCccCCCCCCcCccccccch
Q psy17526          3 AHSDRCQHGLGNFGKLEGKIQ   23 (70)
Q Consensus         3 ~~C~~C~~~l~~~~~~C~~~~   23 (70)
                      +.|..|++++...-+.|..+.
T Consensus         1 v~Cd~C~~~i~G~ry~C~~C~   21 (43)
T cd02340           1 VICDGCQGPIVGVRYKCLVCP   21 (43)
T ss_pred             CCCCCCCCcCcCCeEECCCCC
Confidence            368888887755445665543


No 166
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed
Probab=20.46  E-value=80  Score=22.34  Aligned_cols=22  Identities=32%  Similarity=0.629  Sum_probs=17.7

Q ss_pred             cccccCCCCCChHHHHHHHHhC
Q psy17526         34 YSWCQGCSHGGHLSHMQEWFMK   55 (70)
Q Consensus        34 ~~~C~~C~HggH~~h~~~Wf~~   55 (70)
                      -.||+.|+|+.....+.+-+.+
T Consensus        16 ~~~CpGCg~~i~~~~v~~al~e   37 (277)
T PRK09628         16 TLWCWGCGDGVILKSIIRAIDK   37 (277)
T ss_pred             CCcCCCCCCchHHHHHHHHHHH
Confidence            4799999999888877776654


No 167
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=20.45  E-value=40  Score=16.81  Aligned_cols=12  Identities=17%  Similarity=0.354  Sum_probs=5.9

Q ss_pred             cccCccCCCCCC
Q psy17526          2 NAHSDRCQHGLG   13 (70)
Q Consensus         2 ~~~C~~C~~~l~   13 (70)
                      +..|-.|+++..
T Consensus         3 ~~~C~eC~~~f~   14 (34)
T PF01286_consen    3 YPKCDECGKPFM   14 (34)
T ss_dssp             -EE-TTT--EES
T ss_pred             CchHhHhCCHHH
Confidence            457888888873


No 168
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=20.28  E-value=62  Score=17.98  Aligned_cols=23  Identities=17%  Similarity=0.330  Sum_probs=18.6

Q ss_pred             CCCCCChHHHHHHHHhC-CCCCCC
Q psy17526         39 GCSHGGHLSHMQEWFMK-NNVCPT   61 (70)
Q Consensus        39 ~C~HggH~~h~~~Wf~~-~~~CP~   61 (70)
                      ..||..=-+.+.+|+++ +.+||.
T Consensus        21 ~~G~tyer~~I~~~l~~~~~~~P~   44 (73)
T PF04564_consen   21 PSGHTYERSAIERWLEQNGGTDPF   44 (73)
T ss_dssp             TTSEEEEHHHHHHHHCTTSSB-TT
T ss_pred             CcCCEEcHHHHHHHHHcCCCCCCC
Confidence            45677778999999999 889996


No 169
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.12  E-value=60  Score=18.58  Aligned_cols=13  Identities=8%  Similarity=0.082  Sum_probs=10.2

Q ss_pred             cccCccCCCCCCc
Q psy17526          2 NAHSDRCQHGLGN   14 (70)
Q Consensus         2 ~~~C~~C~~~l~~   14 (70)
                      ..-||.|||+...
T Consensus         7 ~v~CP~Cgkpv~w   19 (65)
T COG3024           7 TVPCPTCGKPVVW   19 (65)
T ss_pred             cccCCCCCCcccc
Confidence            3569999999954


No 170
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=20.08  E-value=49  Score=20.68  Aligned_cols=11  Identities=18%  Similarity=0.383  Sum_probs=9.4

Q ss_pred             cccCccCCCCC
Q psy17526          2 NAHSDRCQHGL   12 (70)
Q Consensus         2 ~~~C~~C~~~l   12 (70)
                      +..|++||.+|
T Consensus        69 r~FC~~CGs~l   79 (133)
T COG3791          69 RGFCPTCGSPL   79 (133)
T ss_pred             CeecccCCCce
Confidence            35799999999


Done!