Diaphorina citri psyllid: psy17532


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MECYDKPKCVEKRPESKKNLNFCCCEGDMCNKDFAWEPAPLPPPINSTTPIKTESHPLIIFLYTMLPIFALIIPIFLCYWYYRQRKLGSYFNPVPTLEPHPTSPPSPQQGCRSIQLVEVKAQGRFGAVWKAKFKNENVAVKIFLMQDKQSWQSEQEIFKLPHMEHDNILRYIGAEKRGESIHTEFWLITAYHERGSLCDFLKCNIVTWEQLCRIALSMSKGLMHLHEEILPNKADSYKPAVAHRDFKSNNVLLKSDLTAAIADFGLALLFEPGKPCGDTHGQVGTRRYMAPEVLEGAINFSRDAFLRIDMYACALVLWELASRCSSVSPPPGEYRLPFSAEVGDHPSLEDMQEAVVHKKLRPTLPETWKQHAGMLALCDTMEECWDHDAEARLSASCVVERGMLALCDTMEECWDHDAEARLSASCVVERVAWQSRALLDSTGNSLPPAAQQQNRFSESTM
ccccccccEECccccccccEEEECcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEcccEEEEEEEEcccHHHHHHHHHHHHccccccccccEEEEEEECcccccEEEEEEEcccccccHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccccEECcccccEEEEEcccEEECccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccHHHHHHHccccc
MECYDKPKC*********NLNFCCCEGDMCNKDFAWEPAPL************ESHPLIIFLYTMLPIFALIIPIFLCYWYYRQRKL****NPV*****************RSIQLVEVKAQGRFGAVWKAKFKNENVAVKIFLMQDKQSWQSEQEIFKLPHMEHDNILRYIGAEKRGESIHTEFWLITAYHERGSLCDFLKCNIVTWEQLCRIALSMSKGLMHLHEEILPNKADSYKPAVAHRDFKSNNVLLKSDLTAAIADFGLALLFEPGKPCGDTHGQVGTRRYMAPEVLEGAINFSRDAFLRIDMYACALVLWELASRCSSVSPPPGEYRLPFSAEVGDHPSLEDMQEAVVHKKLRPTLPETWKQHAGMLALCDTMEECWDHDAEARLSASCVVERGMLAL*******************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MECYDKPKCVEKRPESKKNLNFCCCEGDMCNKDFAWEPAPLPPPINSTTPIKTESHPLIIFLYTMLPIFALIIPIFLCYWYYRQRKLGSYFNPVPTLEPHPTSPPSPQQGCRSIQLVEVKAQGRFGAVWKAKFKNENVAVKIFLMQDKQSWQSEQEIFKLPHMEHDNILRYIGAEKRGESIHTEFWLITAYHERGSLCDFLKCNIVTWEQLCRIALSMSKGLMHLHEEILPNKADSYKPAVAHRDFKSNNVLLKSDLTAAIADFGLALLFEPGKPCGDTHGQVGTRRYMAPEVLEGAINFSRDAFLRIDMYACALVLWELASRCSSVSPPPGEYRLPFSAEVGDHPSLEDMQEAVVHKKLRPTLPETWKQHAGMLALCDTMEECWDHDAEARLSASCVVERGMLALCDTMEECWDHDAEARLSASCVVERVAWQSRALLDSTGNSLPPAAQQQNRFSESTM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Activin receptor type-2B Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.confidentP38445
Activin receptor type-2B Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.confidentQ66T47
Activin receptor type-2B Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.confidentQ13705

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017002 [MF]activin-activated receptor activityconfidentGO:0038023, GO:0060089, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199
GO:0009966 [BP]regulation of signal transductionconfidentGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044464 [CC]cell partconfidentGO:0005575, GO:0005623
GO:0048706 [BP]embryonic skeletal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009790, GO:0048856, GO:0044767, GO:0001501, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0007368 [BP]determination of left/right symmetryprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699
GO:0045669 [BP]positive regulation of osteoblast differentiationprobableGO:0051094, GO:0050793, GO:0045595, GO:0050794, GO:0045597, GO:0045667, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0030278, GO:0050789, GO:0048522
GO:0016362 [MF]activin receptor activity, type IIprobableGO:0038023, GO:0060089, GO:0017002, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199, GO:0016773
GO:0042713 [BP]sperm ejaculationprobableGO:0044703, GO:0044702, GO:0048609, GO:0032504, GO:0044706, GO:0007618, GO:0007620, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0051704, GO:0007320, GO:0000003
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0032927 [BP]positive regulation of activin receptor signaling pathwayprobableGO:0090092, GO:0032925, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0034711 [MF]inhibin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045648 [BP]positive regulation of erythrocyte differentiationprobableGO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0043084 [BP]penile erectionprobableGO:0044703, GO:0044702, GO:0032504, GO:0048609, GO:0007618, GO:0007620, GO:0022414, GO:0032501, GO:0008150, GO:0051704, GO:0044699, GO:0000003
GO:0048185 [MF]activin bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0060011 [BP]Sertoli cell proliferationprobableGO:0048610, GO:0061458, GO:0008584, GO:0007275, GO:0044699, GO:0000003, GO:0046546, GO:0008406, GO:0045137, GO:0048513, GO:0032502, GO:0032501, GO:0048608, GO:0008283, GO:0009987, GO:0044767, GO:0003006, GO:0008150, GO:0046661, GO:0007548, GO:0044707, GO:0022414, GO:0048856, GO:0050673, GO:0048731
GO:0034673 [CC]inhibin-betaglycan-ActRII complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0010862 [BP]positive regulation of pathway-restricted SMAD protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0010647, GO:0010646, GO:0050789, GO:0080090, GO:0010604, GO:0090100, GO:0009966, GO:0009967, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0090092, GO:0045937, GO:0060255, GO:0031323, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0060393, GO:0001932, GO:0001934, GO:0048522
GO:0007498 [BP]mesoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0015026 [MF]coreceptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0050999 [BP]regulation of nitric-oxide synthase activityprobableGO:0051341, GO:0019222, GO:0032768, GO:0050790, GO:0065007, GO:0008150, GO:0065009, GO:0050789
GO:0030501 [BP]positive regulation of bone mineralizationprobableGO:0070169, GO:0045778, GO:0050793, GO:0051240, GO:0051094, GO:0070167, GO:0008150, GO:0048518, GO:2000026, GO:0051239, GO:0030500, GO:0065007, GO:0030278, GO:0050789
GO:0001702 [BP]gastrulation with mouth forming secondprobableGO:0048598, GO:0032502, GO:0048856, GO:0044707, GO:0007369, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0048179 [CC]activin receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0030510 [BP]regulation of BMP signaling pathwayprobableGO:0090092, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:1901164 [BP]negative regulation of trophoblast cell migrationprobableGO:2000242, GO:2000241, GO:0050789, GO:0065007, GO:2000145, GO:1901163, GO:0030336, GO:0030334, GO:0050793, GO:0051271, GO:0050794, GO:0043900, GO:0051270, GO:0008150, GO:0051239, GO:0048519, GO:0032879, GO:0040013, GO:0040012, GO:2000026, GO:2000146, GO:0048523
GO:0045705 [BP]negative regulation of salivary gland boundary specificationprobableGO:0051093, GO:0003156, GO:0050793, GO:0051241, GO:0008150, GO:0065007, GO:2000026, GO:2000027, GO:0051239, GO:0048519, GO:0022603, GO:0050789, GO:0045704
GO:0030073 [BP]insulin secretionprobableGO:0015833, GO:0023052, GO:0044699, GO:0071705, GO:0042886, GO:0046879, GO:0065007, GO:0030072, GO:0071702, GO:0065008, GO:0009987, GO:0006810, GO:0023061, GO:0010817, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0002790, GO:0032940, GO:0009914, GO:0008150
GO:0048705 [BP]skeletal system morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0046881 [BP]positive regulation of follicle-stimulating hormone secretionprobableGO:0060341, GO:0051047, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0051046, GO:0044057, GO:0032276, GO:0065007, GO:0048518, GO:0032278, GO:0051050, GO:0050794, GO:0046880, GO:0046883, GO:0008150, GO:0051239, GO:0046887, GO:0032879, GO:0044060, GO:0048522
GO:0018107 [BP]peptidyl-threonine phosphorylationprobableGO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0016361 [MF]activin receptor activity, type IprobableGO:0038023, GO:0060089, GO:0017002, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199, GO:0016773
GO:0007181 [BP]transforming growth factor beta receptor complex assemblyprobableGO:0022607, GO:0070887, GO:0070271, GO:0043933, GO:0034622, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0071840, GO:0009719, GO:0051716, GO:0071822, GO:0070848, GO:0016043, GO:0065003, GO:0071310, GO:0065007, GO:0044699, GO:0071559, GO:0071495, GO:0009987, GO:0006461, GO:0050794, GO:0042221, GO:0008150, GO:0007154, GO:0043623, GO:0010033, GO:0007179, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0044085, GO:0044763
GO:0030718 [BP]germ-line stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0019827, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0009749 [BP]response to glucose stimulusprobableGO:0009746, GO:1901700, GO:0009743, GO:0034284, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0001822 [BP]kidney developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0031016 [BP]pancreas developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005026 [MF]transforming growth factor beta receptor activity, type IIprobableGO:0038023, GO:0060089, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0005024, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199
GO:0005025 [MF]transforming growth factor beta receptor activity, type IprobableGO:0038023, GO:0060089, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0016740, GO:0005024, GO:0004675, GO:0004674, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0004672, GO:0019199
GO:0048617 [BP]embryonic foregut morphogenesisprobableGO:0048598, GO:0032502, GO:0007440, GO:0048565, GO:0044707, GO:0048856, GO:0055123, GO:0007275, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048731, GO:0009653, GO:0048546, GO:0044699
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0051216 [BP]cartilage developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060836 [BP]lymphatic endothelial cell differentiationprobableGO:0030154, GO:0072359, GO:0072358, GO:0045446, GO:0007275, GO:0044699, GO:0003158, GO:0001944, GO:0001945, GO:0030855, GO:0032502, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0048869, GO:0008150, GO:0009987
GO:0001755 [BP]neural crest cell migrationprobableGO:0030154, GO:0048468, GO:0006928, GO:0051674, GO:0001667, GO:0007275, GO:0044699, GO:0014032, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0016477, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0008150
GO:0001974 [BP]blood vessel remodelingprobableGO:0044699, GO:0032501, GO:0008150, GO:0048771, GO:0044707
GO:0060021 [BP]palate developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0001946 [BP]lymphangiogenesisprobableGO:0032502, GO:0036303, GO:0044707, GO:0032501, GO:0048856, GO:0001944, GO:0001945, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0038100 [MF]nodal bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:1901383 [BP]negative regulation of chorionic trophoblast cell proliferationprobableGO:0042127, GO:0008285, GO:0050794, GO:0008150, GO:0065007, GO:1901382, GO:0048519, GO:0050789, GO:0048523
GO:0030902 [BP]hindbrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0035265 [BP]organ growthprobableGO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0009791 [BP]post-embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0046332 [MF]SMAD bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030509 [BP]BMP signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0050431 [MF]transforming growth factor beta bindingprobableGO:0019955, GO:0003674, GO:0019838, GO:0005515, GO:0005488
GO:0070700 [MF]BMP receptor bindingprobableGO:0033612, GO:0003674, GO:0005488, GO:0005515, GO:0005102, GO:0070696
GO:0032147 [BP]activation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009953 [BP]dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0070724 [CC]BMP receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0038092 [BP]nodal signaling pathwayprobableGO:0044700, GO:0051716, GO:0032924, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0042475 [BP]odontogenesis of dentin-containing toothprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0042476, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0004712 [MF]protein serine/threonine/tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0007443 [BP]Malpighian tubule morphogenesisprobableGO:0032502, GO:0061326, GO:0048619, GO:0055123, GO:0009790, GO:0048565, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0061333, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0008150, GO:0001655, GO:0072002, GO:0072001, GO:0007442, GO:0044707, GO:0048856, GO:0035295, GO:0048731, GO:0048546
GO:0061298 [BP]retina vasculature development in camera-type eyeprobableGO:0032502, GO:0048513, GO:0032501, GO:0044767, GO:0007423, GO:0044707, GO:0048856, GO:0001944, GO:0008150, GO:0072359, GO:0072358, GO:0001654, GO:0060041, GO:0048731, GO:0043010, GO:0007275, GO:0044699
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0004702 [MF]receptor signaling protein serine/threonine kinase activityprobableGO:0004674, GO:0016773, GO:0005057, GO:0003824, GO:0016301, GO:0060089, GO:0016740, GO:0003674, GO:0004871, GO:0004672, GO:0016772
GO:0008258 [BP]head involutionprobableGO:0048598, GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0030324 [BP]lung developmentprobableGO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0007428 [BP]primary branching, open tracheal systemprobableGO:0032502, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0048731
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0043280 [BP]positive regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0060389 [BP]pathway-restricted SMAD protein phosphorylationprobableGO:0016310, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0065007, GO:0006468, GO:0044238, GO:0009987, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0007154, GO:0007178, GO:0044700, GO:0019538, GO:0050896, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0060840 [BP]artery developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060841 [BP]venous blood vessel developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.302.7.11.30 and 2.7.12.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G2F, chain A
Confidence level:very confident
Coverage over the Query: 120-407
View the alignment between query and template
View the model in PyMOL
Template: 4FAO, chain E
Confidence level:confident
Coverage over the Query: 1-38
View the alignment between query and template
View the model in PyMOL
Template: 2J51, chain A
Confidence level:probable
Coverage over the Query: 97-330,345-417
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 60-86
View the alignment between query and template
View the model in PyMOL