Diaphorina citri psyllid: psy17537

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770---

MEEAEILTLGVEQRRSENGPYLADPRPSAYKKSHNFMFGNQEENATATNQDVEMNDADDEDRARSEVRFSFKVENIHNLKDTALSPPHYARNLPWKIMFMVKLLVRRRIQHLFFIKENDWGFSHFMTFSDLLDPDKGFIKDDSIILEVCVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAVYKMPTESDDSNKSVALALQRVFHELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQEFLRVCNGETESSAWSCYASAELILVPQKPGVEPFSRRIQHLFFIKENDWGFSHFMTFSDLLDPDKGFIKDDSIILEVCVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAVYKMPTESDDSNKSVALALQRVFHELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLEIKMKGTCVEGTVPKLFEGKMISFIKCKKVNYTSSRAETFYDIQLNVKGKKDILESFKDYIEPEVLEGDNKYDAGVHGLQDAEKGVTFENLPPVLHLHLMRFQYDPVTDCSVKFNDRFEFYDRIELDDFLKEKGPTPATYILHAVLVHSGDNHGGHYVVYINPKGDNKSTALPPFDKDAEVLFFFKLYEPRRKQISYLGHAYLHMTESIGEYHPWCKFDDDVVSKCSKDEAVAHNFGGNDEDSGLTVKHSTNAYMLVYIRESELANVLEDVTERDIPQEDKIPYLGCNDEDSGLTVKHSTNAYMLVYIRESELANVLEDVTERDIPQES

cccccEEEEEccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccCEEEEEEcccccccccccccccEECcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccccccCEEccccccHHHHHHHHHHHccHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHcccccccccccccEEEEEEEccccccccEEcccccccECccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEcccccccccccccEEEEEEEcccccHHHHHHHcccccccccccccccccccEEEEEEEEEEccccccEEEEEccEEEccccccccccccCEEccccccccccccccccccccEEEEEEEEEEcccccccEEEEEcccccccccccccccccccHHHHcccccccccccccccccEEEEEccccccccCEEEcccccccccHHHHHHHHcccccccccccccccccEEEEEEEEEcccHHccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEHHHHHHHHccccccccccc

****EIL***V****************************************************RSEVRFSFKVENIHNLKDTALSPPHYARNLPWKIMFMVKLLVRRRIQHLFFIKENDWGFSHFMTFSDLLDPDKGFIKDDSIILEVCVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAVYKMPTESDDSNKSVALALQRVFHELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQEFLRVCNGETESSAWSCYASAELILVPQKPGVEPFSRRIQHLFFIKENDWGFSHFMTFSDLLDPDKGFIKDDSIILEVCVQADAPHGVSWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAVYKMPTE**DSNKSVALALQRVFHELQFSDKPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLEIKMKGTCVEGTVPKLFEGKMISFIKCKKVNYTSSRAETFYDIQLNVKGKKDILESFKDYIEPEVLEGDNKYDAGVHGLQDAEKGVTFENLPPVLHLHLMRFQYDPVTDCSVKFNDRFEFYDRIELDDFLKEKGPTPATYILHAVLVHSGDNHGGHYVVYINPKGD***TALPPFDKDAEVLFFFKLYEPRRKQISYLGHAYLHMTESIGEYHPWCKFDDDVVSKCSKDEAVAHNFGGN***SGLTVKHSTNAYMLVYIRESELANVLEDVTERDIPQEDKIPYLGCNDEDSGLTVKHSTNAYMLVYIRESELANVLEDVTERDI****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin carboxyl-terminal hydrolase 7	Cleaves ubiquitin fusion protein substrates.	confident	Q9VYQ8
Ubiquitin carboxyl-terminal hydrolase 7	Hydrolase that deubiquitinates target proteins. May induces p53/TP53-dependent cell growth repression and apoptosis. May be involved in cell proliferation during early embryonic development.	confident	Q6U7I1
Ubiquitin carboxyl-terminal hydrolase 7	Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, PTEN and DAXX. Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.	confident	Q93009

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	confident	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008150 [BP]	biological_process	confident
GO:0008022 [MF]	protein C-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032088 [BP]	negative regulation of NF-kappaB transcription factor activity	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0031625 [MF]	ubiquitin protein ligase binding	probable	GO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0035328 [CC]	transcriptionally silent chromatin	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0016578 [BP]	histone deubiquitination	probable	GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0070647, GO:0070646, GO:0016043, GO:0071704, GO:0016570, GO:0016579, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0002039 [MF]	p53 binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0005700 [CC]	polytene chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0031647 [BP]	regulation of protein stability	probable	GO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0006283 [BP]	transcription-coupled nucleotide-excision repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0016605 [CC]	PML body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0004843 [MF]	ubiquitin-specific protease activity	probable	GO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0004197 [MF]	cysteine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0007275 [BP]	multicellular organismal development	probable	GO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0004221 [MF]	ubiquitin thiolesterase activity	probable	GO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0006511 [BP]	ubiquitin-dependent protein catabolic process	probable	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0010216 [BP]	maintenance of DNA methylation	probable	GO:0019222, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006306, GO:0006305, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0032259, GO:0010468, GO:0006139, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0032153 [CC]	cell division site	probable	GO:0005575, GO:0044464, GO:0005623
GO:0006342 [BP]	chromatin silencing	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0030133 [CC]	transport vesicle	probable	GO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F1Z, chain A
Confidence level:very confident
Coverage over the Query: 262-612,659-682,693-734
View the alignment between query and template
View the model in PyMOL

Template: 2F1Z, chain A
Confidence level:very confident
Coverage over the Query: 62-261
View the alignment between query and template
View the model in PyMOL

Template: 2IBI, chain A
Confidence level:probable
Coverage over the Query: 347-633
View the alignment between query and template
View the model in PyMOL

Template: 2YLM, chain A
Confidence level:probable
Coverage over the Query: 601-661
View the alignment between query and template
View the model in PyMOL