Diaphorina citri psyllid: psy17548


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MTAAGSSSSITPNVLSDIVRVCWGTNVKEDIFVRWTQGFQFSLDEPTALVQYEGGPCAVLAPAQAFILKYIIQNVDPVNDNWRTIEQEDQNKLLVHAVVEMLKQAVDSNTFHIVYIDATEASSPDYSFDQFHSQIKVQSCSSCDEVEQFYNQRIDLLYNRFGVLLFLYSVLYSKGLARLRLEVSDITEPLIDREFGYGSQSLINLMITGRAVNYVFDHVQDIDGLQLQGINQQSQIGFLTLLEHLRYCEVGSYLKNPINPVWVLGSETHLTVTFSFEKRLACLESSADKARRVFKMFDPDGNNFIASDHLQNLLAKLDLVSDINYVDIMRKKLDPDELGIILLSAFMDEFFGDPEKPPPDMFDIFHYNGLARSNYERKVMYRMAHCVLLECNINCLLETNPMLTCLQTKWPSIELSWVHGVTPSLN
cccccccccccHHHHHHHHHHcccccccccccccccccCEEcccccccEEEcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccEEccccccccccccccEEEEEEcccccccccccccccccccEEEEcccccEEEEEEccHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHcccccccccEEHHHHHHHHcccccccccccEEEEEEcccccccccccEEEEEcEEEEEcccccccccccccccEEcccccccEEEEccccccccc
************NVLSDIVRVCWGTNVKEDIFVRWTQGFQFSLDEPTALVQYEGGPCAVLAPAQAFILKYIIQNVDPVNDNWRTIEQEDQNKLLVHAVVEMLKQAVDSNTFHIVYIDATEASSPDYSFDQFHSQIKVQSCSSCDEVEQFYNQRIDLLYNRFGVLLFLYSVLYSKGLARLRLEVSDITEPLIDREFGYGSQSLINLMITGRAVNYVFDHVQDIDGLQLQGINQQSQIGFLTLLEHLRYCEVGSYLKNPINPVWVLGSETHLTVTFSFEKRLACLESSADKARRVFKMFDPDGNNFIASDHLQNLLAKLDLVSDINYVDIMRKKLDPDELGIILLSAFMDEFFGDP****PDMFDIFHYNGLARSNYERKVMYRMAHCVLLECNINCLLETNPMLTCLQTKWPSIELSWVHGVTPS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAAGSSSSITPNVLSDIVRVCWGTNVKEDIFVRWTQGFQFSLDEPTALVQYEGGPCAVLAPAQAFILKYIIQNVDPVNDNWRTIEQEDQNKLLVHAVVEMLKQAVDSNTFHIVYIDATEASSPDYSFDQFHSQIKVQSCSSCDEVEQFYNQRIDLLYNRFGVLLFLYSVLYSKGLARLRLEVSDITEPLIDREFGYGSQSLINLMITGRAVNYVFDHVQDIDGLQLQGINQQSQIGFLTLLEHLRYCEVGSYLKNPINPVWVLGSETHLTVTFSFEKRLACLESSADKARRVFKMFDPDGNNFIASDHLQNLLAKLDLVSDINYVDIMRKKLDPDELGIILLSAFMDEFFGDPEKPPPDMFDIFHYNGLARSNYERKVMYRMAHCVLLECNINCLLETNPMLTCLQTKWPSIELSWVHGVTPSLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein FAM188A May have pro-apoptotic function.confidentQ0IIH8
Protein FAM188A May have pro-apoptotic function.confidentQ9CV28
Protein FAM188A May have pro-apoptotic function. Overexpression significantly inhibits cell proliferation in several tumor cell lines.confidentQ9H8M7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UHK, chain A
Confidence level:confident
Coverage over the Query: 284-377
View the alignment between query and template
View the model in PyMOL