BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17567
         (362 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MMC|B Chain B, Structure Of The Dissimilatory Sulfite Reductase From
           Archaeoglobus Fulgidus
 pdb|3MMC|E Chain E, Structure Of The Dissimilatory Sulfite Reductase From
           Archaeoglobus Fulgidus
 pdb|3MM5|B Chain B, Dissimilatory Sulfite Reductase In Complex With The
           Substrate Sulfite
 pdb|3MM5|E Chain E, Dissimilatory Sulfite Reductase In Complex With The
           Substrate Sulfite
 pdb|3MM6|B Chain B, Dissimilatory Sulfite Reductase Cyanide Complex
 pdb|3MM6|E Chain E, Dissimilatory Sulfite Reductase Cyanide Complex
 pdb|3MM7|B Chain B, Dissimilatory Sulfite Reductase Carbon Monoxide Complex
 pdb|3MM7|E Chain E, Dissimilatory Sulfite Reductase Carbon Monoxide Complex
 pdb|3MM8|B Chain B, Dissimilatory Sulfite Reductase Nitrate Complex
 pdb|3MM8|E Chain E, Dissimilatory Sulfite Reductase Nitrate Complex
 pdb|3MM9|B Chain B, Dissimilatory Sulfite Reductase Nitrite Complex
 pdb|3MM9|E Chain E, Dissimilatory Sulfite Reductase Nitrite Complex
 pdb|3MMA|B Chain B, Dissimilatory Sulfite Reductase Phosphate Complex
 pdb|3MMA|E Chain E, Dissimilatory Sulfite Reductase Phosphate Complex
 pdb|3MMB|B Chain B, Dissimilatory Sulfite Reductase In Complex With The
           Endproduct Sulfide
 pdb|3MMB|E Chain E, Dissimilatory Sulfite Reductase In Complex With The
           Endproduct Sulfide
          Length = 366

 Score = 27.7 bits (60), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 24/63 (38%), Gaps = 6/63 (9%)

Query: 153 WISYNEVELSQIDSTKLTWTVYTMMSNLAMCLLGWWRCFANNYLQWAAVGTWILLNTQGW 212
           W S N VE    D +K+   +  +   +     G W      Y      G   +++TQGW
Sbjct: 84  WTSRNNVEFFVTDESKIDDLINEVQERVGFPCGGTWDAVKGEY------GLSNIVHTQGW 137

Query: 213 WRC 215
             C
Sbjct: 138 IHC 140


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.136    0.441 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,268,438
Number of Sequences: 62578
Number of extensions: 329943
Number of successful extensions: 671
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 671
Number of HSP's gapped (non-prelim): 1
length of query: 362
length of database: 14,973,337
effective HSP length: 100
effective length of query: 262
effective length of database: 8,715,537
effective search space: 2283470694
effective search space used: 2283470694
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)