BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy17567
(362 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MMC|B Chain B, Structure Of The Dissimilatory Sulfite Reductase From
Archaeoglobus Fulgidus
pdb|3MMC|E Chain E, Structure Of The Dissimilatory Sulfite Reductase From
Archaeoglobus Fulgidus
pdb|3MM5|B Chain B, Dissimilatory Sulfite Reductase In Complex With The
Substrate Sulfite
pdb|3MM5|E Chain E, Dissimilatory Sulfite Reductase In Complex With The
Substrate Sulfite
pdb|3MM6|B Chain B, Dissimilatory Sulfite Reductase Cyanide Complex
pdb|3MM6|E Chain E, Dissimilatory Sulfite Reductase Cyanide Complex
pdb|3MM7|B Chain B, Dissimilatory Sulfite Reductase Carbon Monoxide Complex
pdb|3MM7|E Chain E, Dissimilatory Sulfite Reductase Carbon Monoxide Complex
pdb|3MM8|B Chain B, Dissimilatory Sulfite Reductase Nitrate Complex
pdb|3MM8|E Chain E, Dissimilatory Sulfite Reductase Nitrate Complex
pdb|3MM9|B Chain B, Dissimilatory Sulfite Reductase Nitrite Complex
pdb|3MM9|E Chain E, Dissimilatory Sulfite Reductase Nitrite Complex
pdb|3MMA|B Chain B, Dissimilatory Sulfite Reductase Phosphate Complex
pdb|3MMA|E Chain E, Dissimilatory Sulfite Reductase Phosphate Complex
pdb|3MMB|B Chain B, Dissimilatory Sulfite Reductase In Complex With The
Endproduct Sulfide
pdb|3MMB|E Chain E, Dissimilatory Sulfite Reductase In Complex With The
Endproduct Sulfide
Length = 366
Score = 27.7 bits (60), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 16/63 (25%), Positives = 24/63 (38%), Gaps = 6/63 (9%)
Query: 153 WISYNEVELSQIDSTKLTWTVYTMMSNLAMCLLGWWRCFANNYLQWAAVGTWILLNTQGW 212
W S N VE D +K+ + + + G W Y G +++TQGW
Sbjct: 84 WTSRNNVEFFVTDESKIDDLINEVQERVGFPCGGTWDAVKGEY------GLSNIVHTQGW 137
Query: 213 WRC 215
C
Sbjct: 138 IHC 140
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.136 0.441
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,268,438
Number of Sequences: 62578
Number of extensions: 329943
Number of successful extensions: 671
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 671
Number of HSP's gapped (non-prelim): 1
length of query: 362
length of database: 14,973,337
effective HSP length: 100
effective length of query: 262
effective length of database: 8,715,537
effective search space: 2283470694
effective search space used: 2283470694
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)