Query         psy17567
Match_columns 362
No_of_seqs    208 out of 398
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:51:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17567.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17567hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3618|consensus               99.9 6.4E-23 1.4E-27  212.4  20.3  264   66-362    13-286 (1318)
  2 KOG3619|consensus               99.4 4.4E-13 9.6E-18  144.4   7.3   65  298-362    13-77  (867)
  3 KOG2422|consensus               93.9   0.017 3.6E-07   60.7   0.2   15   66-80    113-127 (665)
  4 KOG0112|consensus               93.9   0.031 6.7E-07   61.1   2.1   10  103-112   827-836 (975)
  5 KOG4364|consensus               93.0    0.13 2.9E-06   54.7   4.9   10   86-95    393-402 (811)
  6 KOG3619|consensus               92.9     4.6  0.0001   45.1  16.7  105  257-362   519-625 (867)
  7 KOG0345|consensus               91.5    0.42 9.1E-06   49.6   6.3    7   66-72    539-545 (567)
  8 PF06375 BLVR:  Bovine leukaemi  91.2   0.062 1.3E-06   47.8   0.0    6   66-71    108-113 (154)
  9 KOG2412|consensus               91.2    0.24 5.2E-06   51.8   4.2   30    2-31    213-242 (591)
 10 KOG4364|consensus               90.7    0.36 7.7E-06   51.6   5.0   17  304-320   655-671 (811)
 11 PF11600 CAF-1_p150:  Chromatin  89.8     1.3 2.8E-05   41.3   7.6   11   86-96    199-209 (216)
 12 KOG4055|consensus               87.7     1.2 2.5E-05   40.7   5.4   28   33-60    118-145 (213)
 13 PF07946 DUF1682:  Protein of u  87.4    0.55 1.2E-05   46.5   3.5   17   10-26    255-271 (321)
 14 PF06658 DUF1168:  Protein of u  86.9       1 2.2E-05   39.7   4.5   41    5-45     45-85  (142)
 15 KOG0338|consensus               86.2    0.17 3.6E-06   53.0  -0.9   31    1-31    102-132 (691)
 16 PTZ00121 MAEBL; Provisional     84.4     1.6 3.6E-05   50.6   5.6    7   77-83   1813-1819(2084)
 17 PLN02381 valyl-tRNA synthetase  75.5     1.6 3.5E-05   50.0   2.0   19   13-31     16-34  (1066)
 18 KOG4727|consensus               75.1     9.1  0.0002   34.7   6.2    7   66-72    174-180 (193)
 19 PRK11281 hypothetical protein;  74.2 1.5E+02  0.0032   34.7  17.0   28  315-342   729-759 (1113)
 20 KOG1962|consensus               73.2     7.4 0.00016   36.6   5.4   18   63-80    187-204 (216)
 21 KOG2357|consensus               72.8     5.5 0.00012   40.7   4.8    8   14-21    389-396 (440)
 22 PF15012 DUF4519:  Domain of un  72.7     3.9 8.4E-05   30.3   2.7   21    1-21      1-22  (56)
 23 KOG1297|consensus               71.3     1.8 3.9E-05   40.2   0.9   16   66-81    232-247 (249)
 24 PLN02381 valyl-tRNA synthetase  71.0     3.6 7.8E-05   47.3   3.4   16  112-127    98-113 (1066)
 25 KOG2412|consensus               70.8     2.9 6.3E-05   44.0   2.4   24    8-31    212-235 (591)
 26 PF09889 DUF2116:  Uncharacteri  70.0      14 0.00029   27.8   5.2   33  111-143    16-48  (59)
 27 KOG2812|consensus               69.5       5 0.00011   40.3   3.6   15   65-79    276-290 (426)
 28 PF11600 CAF-1_p150:  Chromatin  67.3     8.6 0.00019   35.8   4.6    9  102-110   201-209 (216)
 29 KOG2894|consensus               65.6      12 0.00025   36.6   5.0   26   66-91    127-152 (331)
 30 KOG0345|consensus               61.2      11 0.00023   39.6   4.2   15   61-75    537-551 (567)
 31 KOG2243|consensus               60.6     5.9 0.00013   46.1   2.4   13  111-123  4595-4607(5019)
 32 PRK10929 putative mechanosensi  60.4   3E+02  0.0066   32.2  15.9   32  310-341   709-743 (1109)
 33 PF09925 DUF2157:  Predicted me  60.4 1.1E+02  0.0024   26.3  10.4   20  115-134    11-30  (145)
 34 PF07543 PGA2:  Protein traffic  60.3     8.3 0.00018   33.9   2.9   12   65-76    128-139 (140)
 35 PF06027 DUF914:  Eukaryotic pr  60.2 1.9E+02  0.0041   29.0  13.9   72  251-322   113-184 (334)
 36 PF05262 Borrelia_P83:  Borreli  60.1      21 0.00046   37.6   6.3   10   69-78    335-344 (489)
 37 KOG2457|consensus               58.3     4.6  0.0001   41.1   1.0   29    1-29     16-45  (555)
 38 PF14812 PBP1_TM:  Transmembran  58.3     3.3 7.1E-05   33.1   0.0   15   32-46     42-56  (81)
 39 KOG0163|consensus               57.0      24 0.00052   39.0   6.1    7  250-256  1170-1176(1259)
 40 PF08432 Vfa1:  AAA-ATPase Vps4  56.6      17 0.00036   33.1   4.3   25   67-91    114-138 (182)
 41 PF15437 PGBA_C:  Plasminogen-b  56.3     9.9 0.00021   30.3   2.4   16    8-23     45-60  (86)
 42 KOG0569|consensus               55.5 2.2E+02  0.0047   30.1  12.9   26  319-344   447-472 (485)
 43 KOG3054|consensus               54.9      14 0.00031   35.4   3.6   18  117-134   215-232 (299)
 44 KOG4434|consensus               54.4     3.5 7.5E-05   41.7  -0.5   17  116-132   371-387 (520)
 45 KOG1230|consensus               54.1     9.3  0.0002   39.4   2.4   18   63-80     33-50  (521)
 46 PF14632 SPT6_acidic:  Acidic N  51.9       9 0.00019   31.3   1.6   16   66-81     59-74  (92)
 47 KOG4819|consensus               51.9      99  0.0021   25.6   7.5   12   66-77     88-99  (106)
 48 PF09428 DUF2011:  Fungal prote  51.1      32  0.0007   29.8   5.0   13   47-59    115-127 (131)
 49 COG5269 ZUO1 Ribosome-associat  49.7      36 0.00079   33.3   5.5   18   67-84    323-340 (379)
 50 PF11286 DUF3087:  Protein of u  49.6 1.5E+02  0.0034   26.7   9.2   16  124-139     9-24  (165)
 51 PTZ00053 methionine aminopepti  49.1     8.4 0.00018   40.3   1.3   16   95-110   120-135 (470)
 52 PF05297 Herpes_LMP1:  Herpesvi  48.6     5.8 0.00013   38.9   0.0    7  132-138    49-55  (381)
 53 KOG1924|consensus               46.8      28  0.0006   38.7   4.7   22   10-31    991-1012(1102)
 54 KOG4055|consensus               45.8      25 0.00055   32.3   3.6   29   28-56    117-145 (213)
 55 KOG2571|consensus               45.2      36 0.00077   38.3   5.3   43  100-142   560-602 (862)
 56 KOG3089|consensus               44.5      32 0.00068   32.8   4.1   18   66-83     79-96  (271)
 57 KOG0163|consensus               43.0      66  0.0014   35.8   6.7    9   69-77   1006-1014(1259)
 58 KOG2507|consensus               41.6      24 0.00051   36.5   3.0   20  109-128   326-345 (506)
 59 PTZ00053 methionine aminopepti  40.8      16 0.00036   38.2   1.9    9  312-320   319-327 (470)
 60 TIGR00869 sec62 protein transl  40.3      15 0.00033   34.9   1.4   15   51-65    216-230 (232)
 61 PLN02316 synthase/transferase   38.8      24 0.00052   40.5   2.9    9   92-100   390-399 (1036)
 62 PF09323 DUF1980:  Domain of un  38.7 1.3E+02  0.0029   27.0   7.3   23  164-186    27-49  (182)
 63 COG3601 Predicted membrane pro  37.9 3.3E+02  0.0071   25.1   9.6   30  257-286   148-177 (186)
 64 PRK09510 tolA cell envelope in  37.6      91   0.002   32.0   6.5   10   67-76    258-267 (387)
 65 PF03904 DUF334:  Domain of unk  37.3 3.1E+02  0.0066   26.2   9.4   15  119-133   136-150 (230)
 66 COG5593 Nucleic-acid-binding p  36.4      20 0.00042   38.2   1.6   12   35-46    779-790 (821)
 67 PLN03237 DNA topoisomerase 2;   35.1     6.4 0.00014   46.4  -2.4   25   67-91   1259-1283(1465)
 68 PF08496 Peptidase_S49_N:  Pept  35.0      66  0.0014   28.7   4.5   13   69-81    119-131 (155)
 69 PRK01637 hypothetical protein;  34.5 2.7E+02  0.0059   26.8   9.2   71  258-328   187-262 (286)
 70 KOG3054|consensus               33.3 1.1E+02  0.0024   29.5   5.9    6    7-12    105-110 (299)
 71 PLN03223 Polycystin cation cha  33.2 9.5E+02   0.021   29.1  14.9   28  305-332  1438-1467(1634)
 72 PF14617 CMS1:  U3-containing 9  33.2     3.1 6.8E-05   40.0  -4.5    9   69-77     56-64  (252)
 73 PF12569 NARP1:  NMDA receptor-  33.0      32 0.00069   36.5   2.6    9  125-133   497-505 (517)
 74 PF09736 Bud13:  Pre-mRNA-splic  32.9 2.6E+02  0.0056   24.6   7.9   19   66-84     68-86  (145)
 75 PF08374 Protocadherin:  Protoc  32.8     5.1 0.00011   37.6  -3.0   10   10-19     67-76  (221)
 76 KOG1015|consensus               32.7      15 0.00032   41.8  -0.0   12  315-326   876-887 (1567)
 77 KOG2062|consensus               31.9      20 0.00044   39.5   0.9   17   68-85    852-868 (929)
 78 PF05793 TFIIF_alpha:  Transcri  31.1      16 0.00035   38.8   0.0    6   68-73    362-367 (527)
 79 COG3356 Predicted membrane pro  28.9 3.7E+02   0.008   29.0   9.5   18  116-133     3-20  (578)
 80 PF15333 TAF1D:  TATA box-bindi  28.8      29 0.00063   32.4   1.2   10  102-111   100-109 (217)
 81 PRK11644 sensory histidine kin  28.6 6.9E+02   0.015   26.0  19.3    9  123-131    97-105 (495)
 82 PF15049 DUF4534:  Protein of u  27.3   4E+02  0.0087   24.1   8.1   44  164-207    83-130 (163)
 83 PF13493 DUF4118:  Domain of un  27.1      90   0.002   24.8   3.8   26  307-332    80-105 (105)
 84 PF01086 Clathrin_lg_ch:  Clath  27.0 1.1E+02  0.0024   28.7   4.9   16   83-98    180-197 (225)
 85 PF06027 DUF914:  Eukaryotic pr  26.7 6.6E+02   0.014   25.2  12.0   66  257-331   242-311 (334)
 86 COG3083 Predicted hydrolase of  26.7 6.7E+02   0.014   27.0  10.7   10  228-237    99-108 (600)
 87 PF05087 Rota_VP2:  Rotavirus V  26.7      37  0.0008   36.8   1.7   18   67-84     89-107 (887)
 88 PF01086 Clathrin_lg_ch:  Clath  26.2      99  0.0021   29.1   4.4    9   88-96    205-213 (225)
 89 KOG2256|consensus               26.2      20 0.00044   38.8  -0.3    8  262-269   439-446 (661)
 90 PRK04214 rbn ribonuclease BN/u  25.8   3E+02  0.0065   28.1   8.1   31  258-288   194-227 (412)
 91 KOG1070|consensus               25.7      29 0.00063   40.9   0.8   14   66-79   1442-1455(1710)
 92 KOG1098|consensus               25.5      37  0.0008   36.9   1.5   25   25-49    340-364 (780)
 93 TIGR00927 2A1904 K+-dependent   25.0      15 0.00033   41.6  -1.5   11   87-97    901-911 (1096)
 94 KOG0299|consensus               24.9      60  0.0013   33.8   2.8    7   66-72     94-100 (479)
 95 KOG0949|consensus               24.8 1.2E+02  0.0025   35.1   5.1   20  101-120   998-1017(1330)
 96 PF12757 DUF3812:  Protein of u  24.7 1.1E+02  0.0024   26.2   4.0   19   13-31     91-109 (126)
 97 PF06645 SPC12:  Microsomal sig  24.6 2.1E+02  0.0046   22.3   5.3   12  187-198    55-66  (76)
 98 COG4901 Ribosomal protein S25   24.1      55  0.0012   27.3   1.9   23   61-83     37-59  (107)
 99 COG5116 RPN2 26S proteasome re  24.0      20 0.00043   38.6  -0.8   34   66-101   849-884 (926)
100 PRK07668 hypothetical protein;  23.7 6.7E+02   0.015   24.2  16.4   17  187-204   129-145 (254)
101 KOG3915|consensus               23.4 1.8E+02  0.0039   30.6   5.8   18   47-64    563-580 (641)
102 KOG3045|consensus               23.4      22 0.00048   34.8  -0.6   14  117-130   146-159 (325)
103 PF13829 DUF4191:  Domain of un  23.2 4.2E+02  0.0092   25.1   7.9   20  118-137     9-28  (224)
104 KOG2138|consensus               23.0      42 0.00091   36.8   1.3    7   67-73    851-857 (883)
105 PHA02644 hypothetical protein;  23.0     6.7 0.00015   31.5  -3.5   13   61-73     91-104 (112)
106 PRK09510 tolA cell envelope in  22.2 2.4E+02  0.0051   29.0   6.4    7   70-76    258-264 (387)
107 KOG2507|consensus               22.2      66  0.0014   33.4   2.4    9  108-116   360-368 (506)
108 TIGR00570 cdk7 CDK-activating   21.9 1.4E+02   0.003   29.8   4.5   51    9-59    152-221 (309)
109 PF08243 SPT2:  SPT2 chromatin   21.7 1.3E+02  0.0028   25.5   3.8   13   33-45     93-105 (116)
110 PF07701 HNOBA:  Heme NO bindin  21.3 2.3E+02  0.0049   26.5   5.8   44  319-362   168-211 (219)
111 PF01698 FLO_LFY:  Floricaula /  20.9      55  0.0012   33.4   1.6   22   96-127   236-257 (386)
112 KOG2662|consensus               20.6 9.6E+02   0.021   24.9  11.6   16  114-129   297-312 (414)
113 KOG3142|consensus               20.3 6.9E+02   0.015   23.1  12.1   28   67-94     18-45  (187)
114 smart00441 FF Contains two con  20.2      74  0.0016   22.4   1.8   50   68-127     4-53  (55)
115 KOG1059|consensus               20.1      35 0.00076   37.6   0.0   20   46-65    850-869 (877)

No 1  
>KOG3618|consensus
Probab=99.90  E-value=6.4e-23  Score=212.36  Aligned_cols=264  Identities=14%  Similarity=0.172  Sum_probs=189.9

Q ss_pred             cCHHhHHHHHHHhhhhccCc----cccccccccc-cccccccccccccCccCcCCCcchHHhHHHHHHHHhhhHHHHHHH
Q psy17567         66 QSVKEIEESLKERKEKTLTE----DSQCDTMIPV-FKKGVLYKGIYCPSLTNSFREPSLEMSYQRYSHRQRQKSLIIVNL  140 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~~lt~----~~~~~~~~~~-f~~g~~~~g~~~p~L~~kF~s~~LE~LYq~Y~~r~~q~sL~v~~~  140 (362)
                      ++.+++...+.|..+.+.++    .+||++++|. |++ +.+| |    ++++|+|..||+.|+.-.+.|-|...--- +
T Consensus        13 ~~t~~v~~~~~Psi~s~~Ss~gRR~~~~~~~lP~~FER-Asar-W----wdPkFdS~~LEeqy~~~~Fpq~r~RfR~~-L   85 (1318)
T KOG3618|consen   13 GDTNSVRVKINPSISSSCSSSGRRVGGGGRLLPQLFER-ASAR-W----WDPKFDSVNLEEQYLERCFPQTRRRFRYA-L   85 (1318)
T ss_pred             CCCcccceeeCcchhhhcCCCCcccCCCcccchHHHHH-hhhh-h----cCccCCcchHHHHHHHhhCHHHHHHHHHH-H
Confidence            78899999999999998876    4999999996 998 4445 3    78999999999999999888766554322 2


Q ss_pred             HHHHHHHHHHHHHHHhcccccccccchhHHHHHHHHHHHHHHHHHh-hhhhhcchhhHHHHHHHHHHHHhhhhhhhhhhh
Q psy17567        141 VDMVLKAVLTVAWISYNEVELSQIDSTKLTWTVYTMMSNLAMCLLG-WWRCFANNYLQWAAVGTWILLNTQGWWRCFANN  219 (362)
Q Consensus       141 l~ill~~~l~~l~l~~~~~~~~~~~~~~~~~~~~~l~~~l~L~vl~-~~~~~~~~~l~~~~~~~wi~l~t~~~~~c~~~~  219 (362)
                      ..|.+++.++.+|+..+...+   ....+....|.+.+..++++++ +++.+.+.| .|.+++.-+++       |    
T Consensus        86 ~YI~~~~l~W~lYfav~~rs~---fi~~~~~slc~lslv~~mf~~ft~~~lY~rhy-~~TS~~~tlLv-------c----  150 (1318)
T KOG3618|consen   86 FYIGFACLLWSLYFAVHMRSR---FIVMVAPSLCFLSLVCVMFFLFTFTKLYARHY-AWTSLALTLLV-------C----  150 (1318)
T ss_pred             HHHHHHHHHHHHHheeccCce---eeeehHHHHHHHHHHHHHHHHHHHHHHHHHHh-hHHHHHHHHHH-------H----
Confidence            578889999999987665332   2222223333333333444443 677665555 67766522221       2    


Q ss_pred             hhhhhhhHHHHhhhhhhhhcccc-ccCCccchhHHHHHHHHHHhcccccchHHHHHhhhhhHHHHHHHHHHHHh---ccC
Q psy17567        220 YLQWAAVGTWILLNTQGFISQGI-GLNNKEYLIWYILFIVFVTYAMLPLPLKWCFIGGCTTSVLHVIITAQIKL---HRG  295 (362)
Q Consensus       220 yl~~~~~~~~v~~~~q~~~~~~~-~~~~~~~~~w~~lfiIf~iYtmLPl~l~~ail~g~~~Sl~hliv~~~~~~---~~~  295 (362)
                            ..++..     +.+++. .+-++-.....++-++++|||.+|+|++.++.+|+..|+.+-++...+.-   +..
T Consensus       151 ------~~tLa~-----ltat~r~af~spvgsfa~c~evvlLiYTv~plPLyL~~~~gi~YSilFE~~~~~~ig~~~~~~  219 (1318)
T KOG3618|consen  151 ------ALTLAN-----LTATARPAFLSPVGSFAMCIEVVLLIYTVMPLPLYLSLCLGIAYSILFETFGYHFIGEACFPS  219 (1318)
T ss_pred             ------HHHHHH-----hhhccchhhhCchhHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHHhhhhccccccccC
Confidence                  111111     111222 22122334555778899999999999999999999999998876432110   001


Q ss_pred             CCCchhhhhHHHHHHHHHHhhhhhhhhhhhhhHHhHHHHHHHHHHHHHHHHhhhHHHHHHHHhhhcC
Q psy17567        296 PLSPCSVHEMGALCLVYIGINSAGMYTKYLTDRGQRRAFLETHRSTETRMKTQKENDQQEKLLLSGM  362 (362)
Q Consensus       296 ~~~~~~~~ql~an~ll~lc~NliG~~~~~l~e~~qR~aFLetrq~i~~rl~Le~E~~qQErLLLSVL  362 (362)
                      +....+-+.++..++++.|+|++|++..+|+.+++|++||+..|++..|..||.|+|-+|++++||+
T Consensus       220 e~aG~~~~~l~~r~~lH~~vHliGVHlfim~qVR~R~TFlKVGQs~l~rkdLE~EkqlKe~MIhSVM  286 (1318)
T KOG3618|consen  220 EGAGALHWELLSRGLLHGCVHLIGVHLFIMSQVRSRSTFLKVGQSILHRKDLEVEKQLKERMIHSVM  286 (1318)
T ss_pred             cccCchhHHHHHHHHHhhhhhhhhhHHHHHHHHHhhhhHHHhhHHHHhhhhhHHHHHHHHHHHHhhc
Confidence            1222456789999999999999999999999999999999999999999999999999999999996


No 2  
>KOG3619|consensus
Probab=99.39  E-value=4.4e-13  Score=144.43  Aligned_cols=65  Identities=40%  Similarity=0.654  Sum_probs=62.7

Q ss_pred             CchhhhhHHHHHHHHHHhhhhhhhhhhhhhHHhHHHHHHHHHHHHHHHHhhhHHHHHHHHhhhcC
Q psy17567        298 SPCSVHEMGALCLVYIGINSAGMYTKYLTDRGQRRAFLETHRSTETRMKTQKENDQQEKLLLSGM  362 (362)
Q Consensus       298 ~~~~~~ql~an~ll~lc~NliG~~~~~l~e~~qR~aFLetrq~i~~rl~Le~E~~qQErLLLSVL  362 (362)
                      +...+.|+++|+++|+|+|++|+|++||+|++||++|+|||+||++|+++|.|++||||||+|||
T Consensus        13 ~~~~~~ql~an~~~~~~~nl~G~~~~~~~e~~~r~~f~~~~~~i~~r~~l~~~~~~qerlllsvl   77 (867)
T KOG3619|consen   13 DVLLLNQLLANAVLFLCINLVGIFTKYMMERAQRQAFLETRKCIEVRMELETEKQQQERLLLSVL   77 (867)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            45678899999999999999999999999999999999999999999999999999999999997


No 3  
>KOG2422|consensus
Probab=93.94  E-value=0.017  Score=60.72  Aligned_cols=15  Identities=20%  Similarity=0.016  Sum_probs=8.3

Q ss_pred             cCHHhHHHHHHHhhh
Q psy17567         66 QSVKEIEESLKERKE   80 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~   80 (362)
                      .+||+-..+|+-.+.
T Consensus       113 s~deq~~a~l~~~k~  127 (665)
T KOG2422|consen  113 SDDEQKLAILKYGKT  127 (665)
T ss_pred             CchHHHHHHHHhhcc
Confidence            455566666655544


No 4  
>KOG0112|consensus
Probab=93.89  E-value=0.031  Score=61.08  Aligned_cols=10  Identities=30%  Similarity=0.481  Sum_probs=5.0

Q ss_pred             ccccccCccC
Q psy17567        103 KGIYCPSLTN  112 (362)
Q Consensus       103 ~g~~~p~L~~  112 (362)
                      +|+..|.|+.
T Consensus       827 k~v~~~ll~e  836 (975)
T KOG0112|consen  827 KGVIISLLKE  836 (975)
T ss_pred             cchhhhhhhc
Confidence            4455555554


No 5  
>KOG4364|consensus
Probab=93.00  E-value=0.13  Score=54.73  Aligned_cols=10  Identities=10%  Similarity=-0.044  Sum_probs=6.0

Q ss_pred             cccccccccc
Q psy17567         86 DSQCDTMIPV   95 (362)
Q Consensus        86 ~~~~~~~~~~   95 (362)
                      .++|..+.|+
T Consensus       393 ~~s~~~f~pF  402 (811)
T KOG4364|consen  393 TVSDIRFEPF  402 (811)
T ss_pred             cccccccccc
Confidence            3566666664


No 6  
>KOG3619|consensus
Probab=92.89  E-value=4.6  Score=45.14  Aligned_cols=105  Identities=11%  Similarity=-0.008  Sum_probs=61.2

Q ss_pred             HHHHHhcccccchHHHHHhhhhhHHHHHHHHHHHHhc--cCCCCchhhhhHHHHHHHHHHhhhhhhhhhhhhhHHhHHHH
Q psy17567        257 IVFVTYAMLPLPLKWCFIGGCTTSVLHVIITAQIKLH--RGPLSPCSVHEMGALCLVYIGINSAGMYTKYLTDRGQRRAF  334 (362)
Q Consensus       257 iIf~iYtmLPl~l~~ail~g~~~Sl~hliv~~~~~~~--~~~~~~~~~~ql~an~ll~lc~NliG~~~~~l~e~~qR~aF  334 (362)
                      .+.++++++++|...-.++-.+....|.++.......  ..+..+..-...... ++++-+-++=.++....|+.-|--|
T Consensus       519 ~~i~~~vf~rl~~~~k~llll~~~~~y~~l~~~~~~~~~~~~~~~~~~~k~~~~-i~l~lf~l~l~~~~Rq~E~~~RlDF  597 (867)
T KOG3619|consen  519 GLLSTAVFLRLPFMLKLLLLLIVFAAYGLLIELSYARELDEEPLPYMGLKLMLS-ILLSLFLLALLLHARQVEYTARLDF  597 (867)
T ss_pred             HHHHHHheeeccHHHHHHHHHHHHHHHHhheeeeeccccCCCCccccchhHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455788889985444433333444444432111010  011111111122222 3333333445667788999999999


Q ss_pred             HHHHHHHHHHHHhhhHHHHHHHHhhhcC
Q psy17567        335 LETHRSTETRMKTQKENDQQEKLLLSGM  362 (362)
Q Consensus       335 Letrq~i~~rl~Le~E~~qQErLLLSVL  362 (362)
                      +=.-|..+++-..|.=.+..++||..||
T Consensus       598 LWk~q~~~E~ee~e~m~~~Nr~LLeNiL  625 (867)
T KOG3619|consen  598 LWKVQAQEEKEEMETMQNLNRLLLENIL  625 (867)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHhcC
Confidence            9999999999888877788888888775


No 7  
>KOG0345|consensus
Probab=91.53  E-value=0.42  Score=49.58  Aligned_cols=7  Identities=0%  Similarity=0.017  Sum_probs=3.2

Q ss_pred             cCHHhHH
Q psy17567         66 QSVKEIE   72 (362)
Q Consensus        66 ~~~~~~~   72 (362)
                      |+||++|
T Consensus       539 e~e~~~~  545 (567)
T KOG0345|consen  539 EEEELAD  545 (567)
T ss_pred             hhHHHHH
Confidence            3444444


No 8  
>PF06375 BLVR:  Bovine leukaemia virus receptor (BLVR);  InterPro: IPR010474  Bovine leukemia virus (BLV) is one of the most common infectious cattle viruses, with between 30 and 40% of cows in the United States being infected. It is closely related to the human T-cell leukaemia virus type 1 (HTLV-1) and has highly conserved envelope glycoprotein functional domains []. BLV is an oncogenic C-type retrovirus, which results in the animals developing a malignant lymphoma. BLV, like the human and simian T cell leukaemia viruses, is a deltaretrovirus. 182 residues at the amino-terminal of the BLV envelope glycoprotein surface unit encompass the receptor-binding domain. The metabolic activity in B cells, T cells, and thymocytes is indicated by the expression of the BLV-binding receptor []. A candidate gene of the receptor (BLVR) is related, but unique, to a gene family of the delta subunit of the adaptor protein (AP) complex 3, AP-3 []. The AP-3 complex is not clathrin-associated but is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. ; PDB: 4AFI_B.
Probab=91.18  E-value=0.062  Score=47.83  Aligned_cols=6  Identities=33%  Similarity=0.495  Sum_probs=0.0

Q ss_pred             cCHHhH
Q psy17567         66 QSVKEI   71 (362)
Q Consensus        66 ~~~~~~   71 (362)
                      +||||+
T Consensus       108 e~~ed~  113 (154)
T PF06375_consen  108 ESDEDI  113 (154)
T ss_dssp             ------
T ss_pred             cccccc
Confidence            566655


No 9  
>KOG2412|consensus
Probab=91.16  E-value=0.24  Score=51.81  Aligned_cols=30  Identities=23%  Similarity=0.534  Sum_probs=20.7

Q ss_pred             cccCCCchhhhhhHHHhhhHHHHHhhHHHH
Q psy17567          2 RKRRGGAGEKKKRIEKRNKEEEKEENEQEE   31 (362)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~e~e~~e~~   31 (362)
                      ++|++..+|++.|||++|++++|++.+.++
T Consensus       213 ~~~~~~~e~kr~Eaerk~~~~qEe~Rqk~d  242 (591)
T KOG2412|consen  213 RERKERSEEKREEAERKRRAHQEELRQKED  242 (591)
T ss_pred             HHHHHHHHhhhhhhHHHHHHHHHHHHHHHH
Confidence            456777788888888887776665544443


No 10 
>KOG4364|consensus
Probab=90.68  E-value=0.36  Score=51.62  Aligned_cols=17  Identities=6%  Similarity=-0.087  Sum_probs=7.6

Q ss_pred             hHHHHHHHHHHhhhhhh
Q psy17567        304 EMGALCLVYIGINSAGM  320 (362)
Q Consensus       304 ql~an~ll~lc~NliG~  320 (362)
                      +|+++.+=+.-+|..|+
T Consensus       655 alm~ql~pl~hgn~ns~  671 (811)
T KOG4364|consen  655 ALMVQLFPLSHGNENSI  671 (811)
T ss_pred             HHHHHHhhhhcccccch
Confidence            34444444444444443


No 11 
>PF11600 CAF-1_p150:  Chromatin assembly factor 1 complex p150 subunit, N-terminal;  InterPro: IPR021644  P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [].P150 is the HP1 interaction site of CAF-1 and lies within the N-terminal region of the protein []. 
Probab=89.77  E-value=1.3  Score=41.34  Aligned_cols=11  Identities=18%  Similarity=0.486  Sum_probs=7.2

Q ss_pred             ccccccccccc
Q psy17567         86 DSQCDTMIPVF   96 (362)
Q Consensus        86 ~~~~~~~~~~f   96 (362)
                      ++.|..+.|||
T Consensus       199 ~~~~~~f~pF~  209 (216)
T PF11600_consen  199 SDYEKKFLPFF  209 (216)
T ss_pred             chhhccccCce
Confidence            45566677776


No 12 
>KOG4055|consensus
Probab=87.69  E-value=1.2  Score=40.75  Aligned_cols=28  Identities=50%  Similarity=0.686  Sum_probs=12.0

Q ss_pred             hhhhhHHHHhhhhhhHHHHHHHHHhhhh
Q psy17567         33 EKEDVEEEKNKKKKKKKKKKKKKKKKKK   60 (362)
Q Consensus        33 ~~e~~~~e~~~~~~~~~~~~k~~~~~~~   60 (362)
                      +.+...+|+-.++..|++|+|+++++++
T Consensus       118 k~~kaaEeKTaKKRaKRqk~Kq~akkkk  145 (213)
T KOG4055|consen  118 KNQKAAEEKTAKKRAKRQKKKQKAKKKK  145 (213)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            3333333443444344555555443333


No 13 
>PF07946 DUF1682:  Protein of unknown function (DUF1682);  InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6 from SWISSPROT) is described as being an adipocyte-specific protein, but no evidence of this was found. 
Probab=87.42  E-value=0.55  Score=46.48  Aligned_cols=17  Identities=41%  Similarity=0.554  Sum_probs=8.2

Q ss_pred             hhhhhHHHhhhHHHHHh
Q psy17567         10 EKKKRIEKRNKEEEKEE   26 (362)
Q Consensus        10 ~~~~~~~~~~~~~~e~e   26 (362)
                      |-++++++.|+++.++-
T Consensus       255 e~~~K~~k~R~~~~~~~  271 (321)
T PF07946_consen  255 EAKKKAKKNREEEEEKI  271 (321)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44455555555544433


No 14 
>PF06658 DUF1168:  Protein of unknown function (DUF1168);  InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=86.89  E-value=1  Score=39.67  Aligned_cols=41  Identities=27%  Similarity=0.379  Sum_probs=18.0

Q ss_pred             CCCchhhhhhHHHhhhHHHHHhhHHHHhhhhhhHHHHhhhh
Q psy17567          5 RGGAGEKKKRIEKRNKEEEKEENEQEEKEKEDVEEEKNKKK   45 (362)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~e~e~~e~~~~~e~~~~e~~~~~   45 (362)
                      |.++-++-+.-|+.-+++.++++=+.+-++...+++++..+
T Consensus        45 RRrE~~Rl~~me~~~~~e~~~~eF~~kree~~~~~eekTaK   85 (142)
T PF06658_consen   45 RRREYERLEYMEEEAKKEKEDEEFQRKREERKKEAEEKTAK   85 (142)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444555555555444444443333333333334444444


No 15 
>KOG0338|consensus
Probab=86.23  E-value=0.17  Score=52.98  Aligned_cols=31  Identities=32%  Similarity=0.503  Sum_probs=21.2

Q ss_pred             CcccCCCchhhhhhHHHhhhHHHHHhhHHHH
Q psy17567          1 MRKRRGGAGEKKKRIEKRNKEEEKEENEQEE   31 (362)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~e~e~~e~~   31 (362)
                      |+++|++++-...+.|+..+|++|.+++|.+
T Consensus       102 ~~~~k~~a~~~~~eeE~~~~E~eE~de~eDe  132 (691)
T KOG0338|consen  102 ARQRKPGAKSVSIEEEEEEKEGEEKDEEEDE  132 (691)
T ss_pred             HHhhCCCCCccchhhhhhcccccccccccch
Confidence            4677888777777777776666666655554


No 16 
>PTZ00121 MAEBL; Provisional
Probab=84.40  E-value=1.6  Score=50.55  Aligned_cols=7  Identities=43%  Similarity=0.401  Sum_probs=2.6

Q ss_pred             Hhhhhcc
Q psy17567         77 ERKEKTL   83 (362)
Q Consensus        77 e~~~~~l   83 (362)
                      .+.+..+
T Consensus      1813 qrIQqNL 1819 (2084)
T PTZ00121       1813 GGKEGNL 1819 (2084)
T ss_pred             HHhhhcc
Confidence            3333333


No 17 
>PLN02381 valyl-tRNA synthetase
Probab=75.54  E-value=1.6  Score=49.98  Aligned_cols=19  Identities=26%  Similarity=0.569  Sum_probs=8.2

Q ss_pred             hhHHHhhhHHHHHhhHHHH
Q psy17567         13 KRIEKRNKEEEKEENEQEE   31 (362)
Q Consensus        13 ~~~~~~~~~~~e~e~~e~~   31 (362)
                      +|-|+++|++|+.+++|.+
T Consensus        16 ~~~~~~~~~~~~~~~~~~~   34 (1066)
T PLN02381         16 EELERKKKKEEKAKEKELK   34 (1066)
T ss_pred             HHHHHHHhhhHHHHHHHHH
Confidence            3444444444444444433


No 18 
>KOG4727|consensus
Probab=75.14  E-value=9.1  Score=34.72  Aligned_cols=7  Identities=29%  Similarity=0.420  Sum_probs=3.4

Q ss_pred             cCHHhHH
Q psy17567         66 QSVKEIE   72 (362)
Q Consensus        66 ~~~~~~~   72 (362)
                      +|.||+-
T Consensus       174 es~~~~~  180 (193)
T KOG4727|consen  174 ESKDEMA  180 (193)
T ss_pred             cccHHHH
Confidence            5555443


No 19 
>PRK11281 hypothetical protein; Provisional
Probab=74.20  E-value=1.5e+02  Score=34.66  Aligned_cols=28  Identities=14%  Similarity=0.032  Sum_probs=19.4

Q ss_pred             hhhhhhhhhhhhhHHhHHHH---HHHHHHHH
Q psy17567        315 INSAGMYTKYLTDRGQRRAF---LETHRSTE  342 (362)
Q Consensus       315 ~NliG~~~~~l~e~~qR~aF---Letrq~i~  342 (362)
                      .-+-++..|+|.=.+.|-+|   .++|+-+.
T Consensus       729 ~l~~~~~~R~l~i~~RRla~~ra~~rR~~~~  759 (1113)
T PRK11281        729 NLLYQTVLRGLSVAARRLAYRRALAKRQNLV  759 (1113)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33466778888888888888   66665553


No 20 
>KOG1962|consensus
Probab=73.24  E-value=7.4  Score=36.59  Aligned_cols=18  Identities=22%  Similarity=0.250  Sum_probs=13.3

Q ss_pred             ccccCHHhHHHHHHHhhh
Q psy17567         63 KEEQSVKEIEESLKERKE   80 (362)
Q Consensus        63 ~~~~~~~~~~~~l~e~~~   80 (362)
                      ..|+=++|.|+.++|+..
T Consensus       187 q~e~~~~EydrLlee~~~  204 (216)
T KOG1962|consen  187 QSEGLQDEYDRLLEEYSK  204 (216)
T ss_pred             HHHHcccHHHHHHHHHHH
Confidence            345578899999988543


No 21 
>KOG2357|consensus
Probab=72.79  E-value=5.5  Score=40.70  Aligned_cols=8  Identities=13%  Similarity=0.231  Sum_probs=3.0

Q ss_pred             hHHHhhhH
Q psy17567         14 RIEKRNKE   21 (362)
Q Consensus        14 ~~~~~~~~   21 (362)
                      ||..+|++
T Consensus       389 EaaQ~kk~  396 (440)
T KOG2357|consen  389 EAAQEKKA  396 (440)
T ss_pred             HHHHHHHH
Confidence            33333333


No 22 
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=72.70  E-value=3.9  Score=30.33  Aligned_cols=21  Identities=38%  Similarity=0.631  Sum_probs=13.7

Q ss_pred             CcccC-CCchhhhhhHHHhhhH
Q psy17567          1 MRKRR-GGAGEKKKRIEKRNKE   21 (362)
Q Consensus         1 ~~~~~-~~~~~~~~~~~~~~~~   21 (362)
                      ||+.| |+.+|-.|...|||++
T Consensus         1 MRqLkg~~~KET~K~K~ERk~~   22 (56)
T PF15012_consen    1 MRQLKGGKTKETRKQKKERKKE   22 (56)
T ss_pred             CCccCCCCccchHHHHHHHHHH
Confidence            78888 5556666666666655


No 23 
>KOG1297|consensus
Probab=71.34  E-value=1.8  Score=40.19  Aligned_cols=16  Identities=19%  Similarity=0.135  Sum_probs=11.3

Q ss_pred             cCHHhHHHHHHHhhhh
Q psy17567         66 QSVKEIEESLKERKEK   81 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~   81 (362)
                      .+|++||..|++.-.+
T Consensus       232 ~dde~fdeyledlfl~  247 (249)
T KOG1297|consen  232 VDDENFDEYLEDLFLK  247 (249)
T ss_pred             cchHHHHHHHHHhhcc
Confidence            4555599999887543


No 24 
>PLN02381 valyl-tRNA synthetase
Probab=71.02  E-value=3.6  Score=47.25  Aligned_cols=16  Identities=13%  Similarity=0.328  Sum_probs=8.9

Q ss_pred             CcCCCcchHHhHHHHH
Q psy17567        112 NSFREPSLEMSYQRYS  127 (362)
Q Consensus       112 ~kF~s~~LE~LYq~Y~  127 (362)
                      ++++....|.-.+.|-
T Consensus        98 ~~yd~~~iE~~w~~~W  113 (1066)
T PLN02381         98 KQYSPSAVEKSWYAWW  113 (1066)
T ss_pred             cCCCHHHHHHHHHHHH
Confidence            4555566666555543


No 25 
>KOG2412|consensus
Probab=70.84  E-value=2.9  Score=44.02  Aligned_cols=24  Identities=29%  Similarity=0.544  Sum_probs=12.9

Q ss_pred             chhhhhhHHHhhhHHHHHhhHHHH
Q psy17567          8 AGEKKKRIEKRNKEEEKEENEQEE   31 (362)
Q Consensus         8 ~~~~~~~~~~~~~~~~e~e~~e~~   31 (362)
                      ..++|+..|++|+|.++.+.++++
T Consensus       212 i~~~~~~~e~kr~Eaerk~~~~qE  235 (591)
T KOG2412|consen  212 IRERKERSEEKREEAERKRRAHQE  235 (591)
T ss_pred             HHHHHHHHHhhhhhhHHHHHHHHH
Confidence            345556666666665555444444


No 26 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=69.96  E-value=14  Score=27.79  Aligned_cols=33  Identities=21%  Similarity=0.420  Sum_probs=24.2

Q ss_pred             cCcCCCcchHHhHHHHHHHHhhhHHHHHHHHHH
Q psy17567        111 TNSFREPSLEMSYQRYSHRQRQKSLIIVNLVDM  143 (362)
Q Consensus       111 ~~kF~s~~LE~LYq~Y~~r~~q~sL~v~~~l~i  143 (362)
                      +.+|=|++=++.|.+=+.|++++..+++.++.+
T Consensus        16 ~~~fCS~~C~~~~~k~qk~~~~~~~i~~~~~i~   48 (59)
T PF09889_consen   16 DESFCSPKCREEYRKRQKRMRKTQYIFFGIFIL   48 (59)
T ss_pred             chhhhCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456777888899998888888777766654333


No 27 
>KOG2812|consensus
Probab=69.51  E-value=5  Score=40.28  Aligned_cols=15  Identities=33%  Similarity=0.466  Sum_probs=6.3

Q ss_pred             ccCHHhHHHHHHHhh
Q psy17567         65 EQSVKEIEESLKERK   79 (362)
Q Consensus        65 ~~~~~~~~~~l~e~~   79 (362)
                      |.+-.+.+..+-|..
T Consensus       276 e~s~K~~ke~~~e~~  290 (426)
T KOG2812|consen  276 ESSLKKSKEMISEAE  290 (426)
T ss_pred             HHHHhhHHHhhhhhh
Confidence            334444444443333


No 28 
>PF11600 CAF-1_p150:  Chromatin assembly factor 1 complex p150 subunit, N-terminal;  InterPro: IPR021644  P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [].P150 is the HP1 interaction site of CAF-1 and lies within the N-terminal region of the protein []. 
Probab=67.32  E-value=8.6  Score=35.85  Aligned_cols=9  Identities=22%  Similarity=0.600  Sum_probs=4.5

Q ss_pred             cccccccCc
Q psy17567        102 YKGIYCPSL  110 (362)
Q Consensus       102 ~~g~~~p~L  110 (362)
                      |-|+++||.
T Consensus       201 ~~~~f~pF~  209 (216)
T PF11600_consen  201 YEKKFLPFF  209 (216)
T ss_pred             hhccccCce
Confidence            344555554


No 29 
>KOG2894|consensus
Probab=65.61  E-value=12  Score=36.57  Aligned_cols=26  Identities=27%  Similarity=0.307  Sum_probs=13.8

Q ss_pred             cCHHhHHHHHHHhhhhccCccccccc
Q psy17567         66 QSVKEIEESLKERKEKTLTEDSQCDT   91 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~~lt~~~~~~~   91 (362)
                      +++||.+...-+.+...+.++++.++
T Consensus       127 ededD~~~k~~~~Kk~klGKdP~VDT  152 (331)
T KOG2894|consen  127 EDEDDAEEKSIPLKKGKLGKDPDVDT  152 (331)
T ss_pred             ccccccchhhcchhhhhcCCCCCccc
Confidence            34444443334445556777777665


No 30 
>KOG0345|consensus
Probab=61.22  E-value=11  Score=39.61  Aligned_cols=15  Identities=20%  Similarity=0.189  Sum_probs=8.2

Q ss_pred             hcccccCHHhHHHHH
Q psy17567         61 KKKEEQSVKEIEESL   75 (362)
Q Consensus        61 ~~~~~~~~~~~~~~l   75 (362)
                      ++.+|+.-||++...
T Consensus       537 ~ae~e~~~~d~~l~~  551 (567)
T KOG0345|consen  537 TAEEEELADDIRLLK  551 (567)
T ss_pred             hhhhHHHHHHHHHHH
Confidence            445654555776543


No 31 
>KOG2243|consensus
Probab=60.58  E-value=5.9  Score=46.11  Aligned_cols=13  Identities=31%  Similarity=0.279  Sum_probs=6.1

Q ss_pred             cCcCCCcchHHhH
Q psy17567        111 TNSFREPSLEMSY  123 (362)
Q Consensus       111 ~~kF~s~~LE~LY  123 (362)
                      .+.|-+.+-|+.-
T Consensus      4595 ~~s~~d~~s~~~~ 4607 (5019)
T KOG2243|consen 4595 KNSFLDEESEEEA 4607 (5019)
T ss_pred             hhccccchhhhhh
Confidence            3455555544443


No 32 
>PRK10929 putative mechanosensitive channel protein; Provisional
Probab=60.41  E-value=3e+02  Score=32.19  Aligned_cols=32  Identities=9%  Similarity=0.175  Sum_probs=19.9

Q ss_pred             HHHHHhhhhhhhhhhhhhHHhHHHHH---HHHHHH
Q psy17567        310 LVYIGINSAGMYTKYLTDRGQRRAFL---ETHRST  341 (362)
Q Consensus       310 ll~lc~NliG~~~~~l~e~~qR~aFL---etrq~i  341 (362)
                      +.++..-+-++..|+|.=-+.|-+|-   ++|+-+
T Consensus       709 l~~~~~l~y~~~~R~l~i~~RRlA~~Ra~~rR~~~  743 (1109)
T PRK10929        709 IWFLLLVVYHIIRRWMLIQRRRIAFDRAKQRRAEI  743 (1109)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33333444567778888777787783   355544


No 33 
>PF09925 DUF2157:  Predicted membrane protein (DUF2157);  InterPro: IPR018677 This family of various hypothetical prokaryotic proteins has no known function.
Probab=60.36  E-value=1.1e+02  Score=26.33  Aligned_cols=20  Identities=20%  Similarity=0.205  Sum_probs=14.1

Q ss_pred             CCcchHHhHHHHHHHHhhhH
Q psy17567        115 REPSLEMSYQRYSHRQRQKS  134 (362)
Q Consensus       115 ~s~~LE~LYq~Y~~r~~q~s  134 (362)
                      .++..|++.+.|..+.++++
T Consensus        11 ~~~q~~~i~~~~~~~~~~~~   30 (145)
T PF09925_consen   11 TPEQAEAILAFYGERPSRSS   30 (145)
T ss_pred             CHHHHHHHHHHhhccccchh
Confidence            46678888888887644444


No 34 
>PF07543 PGA2:  Protein trafficking PGA2;  InterPro: IPR011431 A Saccharomyces cerevisiae (Baker's yeast) member of this family (PGA2, P53903 from SWISSPROT) is a single pass membrane protein which has been implicated in protein trafficking [, ].
Probab=60.30  E-value=8.3  Score=33.86  Aligned_cols=12  Identities=42%  Similarity=0.595  Sum_probs=9.8

Q ss_pred             ccCHHhHHHHHH
Q psy17567         65 EQSVKEIEESLK   76 (362)
Q Consensus        65 ~~~~~~~~~~l~   76 (362)
                      ++||+||+..|+
T Consensus       128 ~~dD~DI~dlLe  139 (140)
T PF07543_consen  128 EDDDKDIEDLLE  139 (140)
T ss_pred             cccHHHHHHHhc
Confidence            379999998875


No 35 
>PF06027 DUF914:  Eukaryotic protein of unknown function (DUF914);  InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function. Some of the sequences in this family are annotated as putative membrane proteins.
Probab=60.22  E-value=1.9e+02  Score=28.95  Aligned_cols=72  Identities=15%  Similarity=0.220  Sum_probs=44.2

Q ss_pred             hHHHHHHHHHHhcccccchHHHHHhhhhhHHHHHHHHHHHHhccCCCCchhhhhHHHHHHHHHHhhhhhhhh
Q psy17567        251 IWYILFIVFVTYAMLPLPLKWCFIGGCTTSVLHVIITAQIKLHRGPLSPCSVHEMGALCLVYIGINSAGMYT  322 (362)
Q Consensus       251 ~w~~lfiIf~iYtmLPl~l~~ail~g~~~Sl~hliv~~~~~~~~~~~~~~~~~ql~an~ll~lc~NliG~~~  322 (362)
                      .|-..|+.++.|.+|--+..+.=++|+++++.=++.........+.++...-+.+..|++.++++-+-|++.
T Consensus       113 ~~~i~~~~~LS~~fL~~ry~~~~~~gv~i~i~Gv~lv~~sD~~~~~~~~~~~~~i~GDll~l~~a~lya~~n  184 (334)
T PF06027_consen  113 CTSIPFVMILSFIFLKRRYSWFHILGVLICIAGVVLVVVSDVLSGSDSSSGSNPILGDLLALLGAILYAVSN  184 (334)
T ss_pred             hhhhHHHHHHHHHHHHhhhhHHHHHHHHHHHhhhhheeeecccccccCCCCCccchhHHHHHHHHHHHHHHH
Confidence            455677888889999999999988999988877665432111111111112245666666666665555543


No 36 
>PF05262 Borrelia_P83:  Borrelia P83/100 protein;  InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins.
Probab=60.15  E-value=21  Score=37.58  Aligned_cols=10  Identities=20%  Similarity=0.464  Sum_probs=5.5

Q ss_pred             HhHHHHHHHh
Q psy17567         69 KEIEESLKER   78 (362)
Q Consensus        69 ~~~~~~l~e~   78 (362)
                      +|.++.+++.
T Consensus       335 kD~qk~~~e~  344 (489)
T PF05262_consen  335 KDQQKLIEEQ  344 (489)
T ss_pred             HHHHHHHhhh
Confidence            3555555554


No 37 
>KOG2457|consensus
Probab=58.29  E-value=4.6  Score=41.09  Aligned_cols=29  Identities=34%  Similarity=0.480  Sum_probs=14.7

Q ss_pred             CcccCC-CchhhhhhHHHhhhHHHHHhhHH
Q psy17567          1 MRKRRG-GAGEKKKRIEKRNKEEEKEENEQ   29 (362)
Q Consensus         1 ~~~~~~-~~~~~~~~~~~~~~~~~e~e~~e   29 (362)
                      |||+++ ++.|+|.++|.++.+++++.++|
T Consensus        16 ~r~~~~~~~~~r~~~~~~e~~~~~~~~~~~   45 (555)
T KOG2457|consen   16 MRKCREKKEAEREAEREAEREAEEEEKAEE   45 (555)
T ss_pred             HhHHhhhchhhhHHHHHhhhhhHhhhhhhh
Confidence            455554 34566666655555544444333


No 38 
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=58.29  E-value=3.3  Score=33.06  Aligned_cols=15  Identities=33%  Similarity=0.516  Sum_probs=0.0

Q ss_pred             hhhhhhHHHHhhhhh
Q psy17567         32 KEKEDVEEEKNKKKK   46 (362)
Q Consensus        32 ~~~e~~~~e~~~~~~   46 (362)
                      .+.++.|+|++-++|
T Consensus        42 DD~dDdeeee~m~rK   56 (81)
T PF14812_consen   42 DDDDDDEEEEPMPRK   56 (81)
T ss_dssp             ---------------
T ss_pred             ccccchhhccccccc
Confidence            334444556666654


No 39 
>KOG0163|consensus
Probab=56.99  E-value=24  Score=39.03  Aligned_cols=7  Identities=43%  Similarity=1.160  Sum_probs=3.6

Q ss_pred             hhHHHHH
Q psy17567        250 LIWYILF  256 (362)
Q Consensus       250 ~~w~~lf  256 (362)
                      +.||.+|
T Consensus      1170 gmWyaHF 1176 (1259)
T KOG0163|consen 1170 GMWYAHF 1176 (1259)
T ss_pred             ceEEEec
Confidence            4555554


No 40 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=56.57  E-value=17  Score=33.13  Aligned_cols=25  Identities=20%  Similarity=0.102  Sum_probs=12.5

Q ss_pred             CHHhHHHHHHHhhhhccCccccccc
Q psy17567         67 SVKEIEESLKERKEKTLTEDSQCDT   91 (362)
Q Consensus        67 ~~~~~~~~l~e~~~~~lt~~~~~~~   91 (362)
                      ++++-+..+.+......+..+.-+.
T Consensus       114 ~~k~~~~~~~~~~~~~~~~~~~~~~  138 (182)
T PF08432_consen  114 DEKEDKDKLKSLQKSYSETLSTVTE  138 (182)
T ss_pred             cccchhHHHHHHHHhhccccCCccc
Confidence            3444555566666555544333333


No 41 
>PF15437 PGBA_C:  Plasminogen-binding protein pgbA C-terminal
Probab=56.30  E-value=9.9  Score=30.33  Aligned_cols=16  Identities=38%  Similarity=0.497  Sum_probs=6.3

Q ss_pred             chhhhhhHHHhhhHHH
Q psy17567          8 AGEKKKRIEKRNKEEE   23 (362)
Q Consensus         8 ~~~~~~~~~~~~~~~~   23 (362)
                      ++.+|-+||+|-.|=+
T Consensus        45 eEkKkAKAeqrA~EfE   60 (86)
T PF15437_consen   45 EEKKKAKAEQRAREFE   60 (86)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3333344444444433


No 42 
>KOG0569|consensus
Probab=55.48  E-value=2.2e+02  Score=30.08  Aligned_cols=26  Identities=19%  Similarity=0.111  Sum_probs=13.1

Q ss_pred             hhhhhhhhhHHhHHHHHHHHHHHHHH
Q psy17567        319 GMYTKYLTDRGQRRAFLETHRSTETR  344 (362)
Q Consensus       319 G~~~~~l~e~~qR~aFLetrq~i~~r  344 (362)
                      ++|.+....-.-.+++-|-.+.++.+
T Consensus       447 ~i~~~~~lPETkgr~~~eI~~~~~~~  472 (485)
T KOG0569|consen  447 LIYLYRYLPETKGRTPYEIIEELEKR  472 (485)
T ss_pred             HHHHHHhCcccCCCCHHHHHHHHHhC
Confidence            34444444444445666665555544


No 43 
>KOG3054|consensus
Probab=54.89  E-value=14  Score=35.38  Aligned_cols=18  Identities=17%  Similarity=0.159  Sum_probs=13.2

Q ss_pred             cchHHhHHHHHHHHhhhH
Q psy17567        117 PSLEMSYQRYSHRQRQKS  134 (362)
Q Consensus       117 ~~LE~LYq~Y~~r~~q~s  134 (362)
                      ..||.|=-.+-.|.+.+.
T Consensus       215 V~ledLas~f~Lrtqd~i  232 (299)
T KOG3054|consen  215 VPLEDLASEFGLRTQDSI  232 (299)
T ss_pred             eeHHHHHHHhCccHHHHH
Confidence            678888877777776644


No 44 
>KOG4434|consensus
Probab=54.37  E-value=3.5  Score=41.68  Aligned_cols=17  Identities=0%  Similarity=0.143  Sum_probs=8.8

Q ss_pred             CcchHHhHHHHHHHHhh
Q psy17567        116 EPSLEMSYQRYSHRQRQ  132 (362)
Q Consensus       116 s~~LE~LYq~Y~~r~~q  132 (362)
                      +++-+..+++-+...+.
T Consensus       371 ddddd~EWe~lqa~~~k  387 (520)
T KOG4434|consen  371 DDDDDAEWEELQASIQK  387 (520)
T ss_pred             ccccHHHHHHHHHHHHH
Confidence            34445556665555543


No 45 
>KOG1230|consensus
Probab=54.07  E-value=9.3  Score=39.38  Aligned_cols=18  Identities=22%  Similarity=0.309  Sum_probs=10.0

Q ss_pred             ccccCHHhHHHHHHHhhh
Q psy17567         63 KEEQSVKEIEESLKERKE   80 (362)
Q Consensus        63 ~~~~~~~~~~~~l~e~~~   80 (362)
                      .+|.++++|+.++...-.
T Consensus        33 ~~e~de~~i~~~iq~~ea   50 (521)
T KOG1230|consen   33 NEELDEADIAEIIQSLEA   50 (521)
T ss_pred             CcccchHHHHHHHHhhhh
Confidence            344457777766554433


No 46 
>PF14632 SPT6_acidic:  Acidic N-terminal SPT6
Probab=51.91  E-value=9  Score=31.30  Aligned_cols=16  Identities=6%  Similarity=-0.031  Sum_probs=11.4

Q ss_pred             cCHHhHHHHHHHhhhh
Q psy17567         66 QSVKEIEESLKERKEK   81 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~   81 (362)
                      =++||++.+..-.+..
T Consensus        59 LDedDldLi~EN~g~~   74 (92)
T PF14632_consen   59 LDEDDLDLIEENLGVK   74 (92)
T ss_pred             cCHHHHHHHHHcCCcc
Confidence            6889998877655443


No 47 
>KOG4819|consensus
Probab=51.87  E-value=99  Score=25.59  Aligned_cols=12  Identities=17%  Similarity=0.191  Sum_probs=6.3

Q ss_pred             cCHHhHHHHHHH
Q psy17567         66 QSVKEIEESLKE   77 (362)
Q Consensus        66 ~~~~~~~~~l~e   77 (362)
                      +=.+..|-.|..
T Consensus        88 nln~qM~~LL~~   99 (106)
T KOG4819|consen   88 NLNDQMQLLLKQ   99 (106)
T ss_pred             cHHHHHHHHHHH
Confidence            345555555543


No 48 
>PF09428 DUF2011:  Fungal protein of unknown function (DUF2011);  InterPro: IPR018555  This is a family of fungal proteins whose function is unknown. 
Probab=51.13  E-value=32  Score=29.84  Aligned_cols=13  Identities=54%  Similarity=0.690  Sum_probs=4.8

Q ss_pred             hHHHHHHHHHhhh
Q psy17567         47 KKKKKKKKKKKKK   59 (362)
Q Consensus        47 ~~~~~~k~~~~~~   59 (362)
                      ++..+||-+|+++
T Consensus       115 rknr~KK~kkR~~  127 (131)
T PF09428_consen  115 RKNRKKKFKKRGK  127 (131)
T ss_pred             HHHHHHHHHhhcc
Confidence            3333333333333


No 49 
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones]
Probab=49.70  E-value=36  Score=33.30  Aligned_cols=18  Identities=6%  Similarity=0.156  Sum_probs=11.7

Q ss_pred             CHHhHHHHHHHhhhhccC
Q psy17567         67 SVKEIEESLKERKEKTLT   84 (362)
Q Consensus        67 ~~~~~~~~l~e~~~~~lt   84 (362)
                      =|+|++.+.+.....-+.
T Consensus       323 id~~v~li~~~l~d~el~  340 (379)
T COG5269         323 IDEDVDLIMDKLGDEELG  340 (379)
T ss_pred             cchhhhHHHHhcCcHHHH
Confidence            457777777766665553


No 50 
>PF11286 DUF3087:  Protein of unknown function (DUF3087);  InterPro: IPR021438  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=49.58  E-value=1.5e+02  Score=26.74  Aligned_cols=16  Identities=19%  Similarity=0.312  Sum_probs=11.6

Q ss_pred             HHHHHHHhhhHHHHHH
Q psy17567        124 QRYSHRQRQKSLIIVN  139 (362)
Q Consensus       124 q~Y~~r~~q~sL~v~~  139 (362)
                      ++|..++|+..+.+..
T Consensus         9 ~~YRk~~n~v~~~~v~   24 (165)
T PF11286_consen    9 ERYRKHLNRVIVACVA   24 (165)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4788888887776543


No 51 
>PTZ00053 methionine aminopeptidase 2; Provisional
Probab=49.15  E-value=8.4  Score=40.33  Aligned_cols=16  Identities=25%  Similarity=0.110  Sum_probs=12.3

Q ss_pred             ccccccccccccccCc
Q psy17567         95 VFKKGVLYKGIYCPSL  110 (362)
Q Consensus        95 ~f~~g~~~~g~~~p~L  110 (362)
                      .|..|...-|-.+.|-
T Consensus       120 ~~~~~~~p~g~~~~~~  135 (470)
T PTZ00053        120 QFKDGEYPVGEIQEYP  135 (470)
T ss_pred             hCCCCCCCcceEEecC
Confidence            6988888888766664


No 52 
>PF05297 Herpes_LMP1:  Herpesvirus latent membrane protein 1 (LMP1);  InterPro: IPR007961 This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). LMP1 of HHV-4 is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N terminus and a long cytoplasmic carboxy tail of 200 amino acids. HHV-4 virus latent membrane protein 1 (LMP1) is essential for HHV-4 mediated transformation and has been associated with several cases of malignancies. HHV-4-like viruses in Macaca fascicularis (Cynomolgus monkeys) have been associated with high lymphoma rates in immunosuppressed monkeys [].; GO: 0019087 transformation of host cell by virus, 0016021 integral to membrane; PDB: 1CZY_E 1ZMS_B.
Probab=48.61  E-value=5.8  Score=38.89  Aligned_cols=7  Identities=29%  Similarity=0.525  Sum_probs=0.0

Q ss_pred             hhHHHHH
Q psy17567        132 QKSLIIV  138 (362)
Q Consensus       132 q~sL~v~  138 (362)
                      |+.++|+
T Consensus        49 ~~a~~vl   55 (381)
T PF05297_consen   49 QGALTVL   55 (381)
T ss_dssp             -------
T ss_pred             cchHHHH
Confidence            4444443


No 53 
>KOG1924|consensus
Probab=46.81  E-value=28  Score=38.68  Aligned_cols=22  Identities=41%  Similarity=0.436  Sum_probs=14.6

Q ss_pred             hhhhhHHHhhhHHHHHhhHHHH
Q psy17567         10 EKKKRIEKRNKEEEKEENEQEE   31 (362)
Q Consensus        10 ~~~~~~~~~~~~~~e~e~~e~~   31 (362)
                      |--+|+++||||+|+++..+.+
T Consensus       991 ea~~en~krRee~Ek~rr~k~a 1012 (1102)
T KOG1924|consen  991 EAVAENEKRREEEEKERRAKLA 1012 (1102)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4457788888887666654443


No 54 
>KOG4055|consensus
Probab=45.85  E-value=25  Score=32.28  Aligned_cols=29  Identities=45%  Similarity=0.614  Sum_probs=14.6

Q ss_pred             HHHHhhhhhhHHHHhhhhhhHHHHHHHHH
Q psy17567         28 EQEEKEKEDVEEEKNKKKKKKKKKKKKKK   56 (362)
Q Consensus        28 ~e~~~~~e~~~~e~~~~~~~~~~~~k~~~   56 (362)
                      |+.++..|+....++++-.|+++++|||+
T Consensus       117 ek~~kaaEeKTaKKRaKRqk~Kq~akkkk  145 (213)
T KOG4055|consen  117 EKNQKAAEEKTAKKRAKRQKKKQKAKKKK  145 (213)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            33344444444555666655555555544


No 55 
>KOG2571|consensus
Probab=45.24  E-value=36  Score=38.25  Aligned_cols=43  Identities=23%  Similarity=0.213  Sum_probs=32.8

Q ss_pred             cccccccccCccCcCCCcchHHhHHHHHHHHhhhHHHHHHHHH
Q psy17567        100 VLYKGIYCPSLTNSFREPSLEMSYQRYSHRQRQKSLIIVNLVD  142 (362)
Q Consensus       100 ~~~~g~~~p~L~~kF~s~~LE~LYq~Y~~r~~q~sL~v~~~l~  142 (362)
                      ...||+.+||+.+..-.-+-=..|-+...++|+.....|++.+
T Consensus       560 llskgy~l~Y~a~s~a~t~~Pe~~~efl~QrrRW~~s~f~~~~  602 (862)
T KOG2571|consen  560 LLSKGYRLKYVAASDAETEAPESFLEFLNQRRRWLNSIFNAAD  602 (862)
T ss_pred             HHhccceeeeeccccccccCcHhHHHHHHHhhhhcccchhHHH
Confidence            3456999999999887777777888888888887777666433


No 56 
>KOG3089|consensus
Probab=44.53  E-value=32  Score=32.79  Aligned_cols=18  Identities=17%  Similarity=0.202  Sum_probs=14.8

Q ss_pred             cCHHhHHHHHHHhhhhcc
Q psy17567         66 QSVKEIEESLKERKEKTL   83 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~~l   83 (362)
                      .|+|+++..|.....+..
T Consensus        79 ~sPe~l~~ll~~yi~s~~   96 (271)
T KOG3089|consen   79 GSPEDLQKLLKDYISSRR   96 (271)
T ss_pred             CChHHHHHHHHHHHHhhc
Confidence            699999999998876543


No 57 
>KOG0163|consensus
Probab=42.95  E-value=66  Score=35.83  Aligned_cols=9  Identities=11%  Similarity=0.124  Sum_probs=3.7

Q ss_pred             HhHHHHHHH
Q psy17567         69 KEIEESLKE   77 (362)
Q Consensus        69 ~~~~~~l~e   77 (362)
                      |-.|..+.-
T Consensus      1006 er~D~~la~ 1014 (1259)
T KOG0163|consen 1006 ERRDHELAL 1014 (1259)
T ss_pred             HHHHHHHHH
Confidence            334444443


No 58 
>KOG2507|consensus
Probab=41.60  E-value=24  Score=36.52  Aligned_cols=20  Identities=25%  Similarity=0.330  Sum_probs=13.1

Q ss_pred             CccCcCCCcchHHhHHHHHH
Q psy17567        109 SLTNSFREPSLEMSYQRYSH  128 (362)
Q Consensus       109 ~L~~kF~s~~LE~LYq~Y~~  128 (362)
                      .++++|.+.+.=+.-.-|-.
T Consensus       326 sfte~Fps~~vL~~vr~yvr  345 (506)
T KOG2507|consen  326 SFTEKFPSTSVLRMVRDYVR  345 (506)
T ss_pred             chhhcCCcchHHHHHHHHHH
Confidence            47788988776555555544


No 59 
>PTZ00053 methionine aminopeptidase 2; Provisional
Probab=40.80  E-value=16  Score=38.19  Aligned_cols=9  Identities=22%  Similarity=0.154  Sum_probs=4.1

Q ss_pred             HHHhhhhhh
Q psy17567        312 YIGINSAGM  320 (362)
Q Consensus       312 ~lc~NliG~  320 (362)
                      .++.|-+|.
T Consensus       319 nltGHgIG~  327 (470)
T PTZ00053        319 NLNGHSIGP  327 (470)
T ss_pred             CCcccCCCC
Confidence            344444444


No 60 
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=40.33  E-value=15  Score=34.94  Aligned_cols=15  Identities=60%  Similarity=0.592  Sum_probs=7.4

Q ss_pred             HHHHHHhhhhhcccc
Q psy17567         51 KKKKKKKKKKKKKEE   65 (362)
Q Consensus        51 ~~k~~~~~~~~~~~~   65 (362)
                      |+|+|++++|+++.|
T Consensus       216 ~~k~~~~~~~~~~~~  230 (232)
T TIGR00869       216 KLKSKKLKKKQAKRE  230 (232)
T ss_pred             HhhhhhhhHhhhhhc
Confidence            333334666555544


No 61 
>PLN02316 synthase/transferase
Probab=38.81  E-value=24  Score=40.53  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=5.3

Q ss_pred             ccc-cccccc
Q psy17567         92 MIP-VFKKGV  100 (362)
Q Consensus        92 ~~~-~f~~g~  100 (362)
                      +++ ||..|.
T Consensus       390 ~mDfVFsdg~  399 (1036)
T PLN02316        390 VLDWVFADGP  399 (1036)
T ss_pred             EEEEEEecCC
Confidence            344 677764


No 62 
>PF09323 DUF1980:  Domain of unknown function (DUF1980);  InterPro: IPR015402  Members of this occur in gene pairs with members of PF03773 from PFAM. The N-terminal region contains several predicted transmembrane helix regions while the few invariant residues (G, CxxD, and W) occur in the C-terminal region.  Members of this family are found in a set of prokaryotic hypothetical proteins. Their exact function has not, as yet, been defined. 
Probab=38.69  E-value=1.3e+02  Score=26.97  Aligned_cols=23  Identities=9%  Similarity=0.216  Sum_probs=11.8

Q ss_pred             ccchhHHHHHHHHHHHHHHHHHh
Q psy17567        164 IDSTKLTWTVYTMMSNLAMCLLG  186 (362)
Q Consensus       164 ~~~~~~~~~~~~l~~~l~L~vl~  186 (362)
                      +++.+..++..+++++++|.+.-
T Consensus        27 I~P~~~~~~~~a~i~l~ilai~q   49 (182)
T PF09323_consen   27 IHPRYIPLLYFAAILLLILAIVQ   49 (182)
T ss_pred             hCccHHHHHHHHHHHHHHHHHHH
Confidence            45555555555555554444443


No 63 
>COG3601 Predicted membrane protein [Function unknown]
Probab=37.88  E-value=3.3e+02  Score=25.12  Aligned_cols=30  Identities=23%  Similarity=0.296  Sum_probs=25.2

Q ss_pred             HHHHHhcccccchHHHHHhhhhhHHHHHHH
Q psy17567        257 IVFVTYAMLPLPLKWCFIGGCTTSVLHVII  286 (362)
Q Consensus       257 iIf~iYtmLPl~l~~ail~g~~~Sl~hliv  286 (362)
                      .++..|+-+|+.+...++.++.+.+.|...
T Consensus       148 ~~~~~~~ilPFnLikg~i~sivf~~~y~~~  177 (186)
T COG3601         148 IIYVVTTILPFNLIKGLIFSIVFGLLYKRL  177 (186)
T ss_pred             eeeeeeeeccHHHHHHHHHHHHHHHHHHHH
Confidence            388889999999988888888887777765


No 64 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=37.59  E-value=91  Score=31.98  Aligned_cols=10  Identities=20%  Similarity=0.328  Sum_probs=4.4

Q ss_pred             CHHhHHHHHH
Q psy17567         67 SVKEIEESLK   76 (362)
Q Consensus        67 ~~~~~~~~l~   76 (362)
                      ..|||=..|+
T Consensus       258 ~~dd~~~gl~  267 (387)
T PRK09510        258 EVDDLFGGLD  267 (387)
T ss_pred             HHHHHhhccc
Confidence            3444444444


No 65 
>PF03904 DUF334:  Domain of unknown function (DUF334);  InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function.
Probab=37.30  E-value=3.1e+02  Score=26.16  Aligned_cols=15  Identities=27%  Similarity=0.532  Sum_probs=10.3

Q ss_pred             hHHhHHHHHHHHhhh
Q psy17567        119 LEMSYQRYSHRQRQK  133 (362)
Q Consensus       119 LE~LYq~Y~~r~~q~  133 (362)
                      .-..+.+|.-++..-
T Consensus       136 vK~~~E~y~k~~k~~  150 (230)
T PF03904_consen  136 VKQSHEKYQKRQKSM  150 (230)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            455778888777653


No 66 
>COG5593 Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis]
Probab=36.44  E-value=20  Score=38.22  Aligned_cols=12  Identities=50%  Similarity=0.645  Sum_probs=5.2

Q ss_pred             hhhHHHHhhhhh
Q psy17567         35 EDVEEEKNKKKK   46 (362)
Q Consensus        35 e~~~~e~~~~~~   46 (362)
                      ++.|+|++++..
T Consensus       779 ~e~eeee~~e~s  790 (821)
T COG5593         779 EEKEEEENKEVS  790 (821)
T ss_pred             chhhhhhhhhHH
Confidence            333344555543


No 67 
>PLN03237 DNA topoisomerase 2; Provisional
Probab=35.12  E-value=6.4  Score=46.36  Aligned_cols=25  Identities=12%  Similarity=0.024  Sum_probs=10.4

Q ss_pred             CHHhHHHHHHHhhhhccCccccccc
Q psy17567         67 SVKEIEESLKERKEKTLTEDSQCDT   91 (362)
Q Consensus        67 ~~~~~~~~l~e~~~~~lt~~~~~~~   91 (362)
                      +|||+...-+-...=.+++++.-.+
T Consensus      1259 ~~~~~~~~~~~~~~~~~~~~~~~~~ 1283 (1465)
T PLN03237       1259 EEDEILDLKDRLAAYNLDSAPAQSA 1283 (1465)
T ss_pred             ccccHHHHHHHHHhccccCCCCccc
Confidence            4444444333333334454443333


No 68 
>PF08496 Peptidase_S49_N:  Peptidase family S49 N-terminal;  InterPro: IPR013703 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found to the N terminus of bacterial signal peptidases that belong to the MEROPS peptidase family S49 (protease IV family, clan SK) (see also IPR002142 from INTERPRO) [, ]. ; GO: 0004252 serine-type endopeptidase activity, 0005886 plasma membrane
Probab=34.97  E-value=66  Score=28.70  Aligned_cols=13  Identities=23%  Similarity=0.248  Sum_probs=6.6

Q ss_pred             HhHHHHHHHhhhh
Q psy17567         69 KEIEESLKERKEK   81 (362)
Q Consensus        69 ~~~~~~l~e~~~~   81 (362)
                      |||..+|.-..+.
T Consensus       119 eeisail~~a~~~  131 (155)
T PF08496_consen  119 EEISAILSVATPE  131 (155)
T ss_pred             HHHHHHHHhCCCC
Confidence            4555555544443


No 69 
>PRK01637 hypothetical protein; Reviewed
Probab=34.51  E-value=2.7e+02  Score=26.76  Aligned_cols=71  Identities=10%  Similarity=0.223  Sum_probs=40.8

Q ss_pred             HHHHhcccc---cchHHHHHhhhhhHHHHHHHHHHHHhc--cCCCCchhhhhHHHHHHHHHHhhhhhhhhhhhhhH
Q psy17567        258 VFVTYAMLP---LPLKWCFIGGCTTSVLHVIITAQIKLH--RGPLSPCSVHEMGALCLVYIGINSAGMYTKYLTDR  328 (362)
Q Consensus       258 If~iYtmLP---l~l~~ail~g~~~Sl~hliv~~~~~~~--~~~~~~~~~~ql~an~ll~lc~NliG~~~~~l~e~  328 (362)
                      ...+|.++|   .+.+.+...|+++++...+....+..+  +..+.+..+..+.+=+++++..++.+...-+=.|.
T Consensus       187 f~~lY~~~P~~k~~~r~~~~Ga~~a~~~w~~~~~~f~~Yv~~~~~y~~~YGslg~vi~lllWlyl~~~ilL~Gael  262 (286)
T PRK01637        187 FWLLYSVVPNKKVPFRHALVGALVAALLFELGKKGFALYITTFPSYQLIYGALAVIPILFVWVYLSWCIVLLGAEI  262 (286)
T ss_pred             HHHHHhhcCCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            347799999   455666665555555555543322211  11222234566677777777777777666665544


No 70 
>KOG3054|consensus
Probab=33.25  E-value=1.1e+02  Score=29.54  Aligned_cols=6  Identities=33%  Similarity=0.213  Sum_probs=2.4

Q ss_pred             Cchhhh
Q psy17567          7 GAGEKK   12 (362)
Q Consensus         7 ~~~~~~   12 (362)
                      +.|++|
T Consensus       105 kkK~aK  110 (299)
T KOG3054|consen  105 KKKEAK  110 (299)
T ss_pred             hHHHHH
Confidence            334444


No 71 
>PLN03223 Polycystin cation channel protein; Provisional
Probab=33.20  E-value=9.5e+02  Score=29.09  Aligned_cols=28  Identities=14%  Similarity=-0.053  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHhhhh-hhhh-hhhhhHHhHH
Q psy17567        305 MGALCLVYIGINSA-GMYT-KYLTDRGQRR  332 (362)
Q Consensus       305 l~an~ll~lc~Nli-G~~~-~~l~e~~qR~  332 (362)
                      =+.+.+.--+-+++ |.|. .+..|...|+
T Consensus      1438 EIvDfm~~rfrslL~g~~~~~~i~~~~~~~ 1467 (1634)
T PLN03223       1438 ELFPMLRDKWRSMFKGWFYKNHIPEARVRR 1467 (1634)
T ss_pred             HHHHHHHHHHHHHHhhhcccccCCcHHHHH
Confidence            35566677777888 9888 5666666555


No 72 
>PF14617 CMS1:  U3-containing 90S pre-ribosomal complex subunit
Probab=33.18  E-value=3.1  Score=39.96  Aligned_cols=9  Identities=11%  Similarity=0.272  Sum_probs=3.4

Q ss_pred             HhHHHHHHH
Q psy17567         69 KEIEESLKE   77 (362)
Q Consensus        69 ~~~~~~l~e   77 (362)
                      +.+...+..
T Consensus        56 ~~lad~l~~   64 (252)
T PF14617_consen   56 ELLADYLAQ   64 (252)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 73 
>PF12569 NARP1:  NMDA receptor-regulated protein 1 ;  InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala. N-terminal acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover. NAT1 anchors ARD1 and NAT5 to the ribosome and may present the N- terminal of nascent polypeptides for acetylation [], [].
Probab=32.99  E-value=32  Score=36.51  Aligned_cols=9  Identities=11%  Similarity=0.165  Sum_probs=3.6

Q ss_pred             HHHHHHhhh
Q psy17567        125 RYSHRQRQK  133 (362)
Q Consensus       125 ~Y~~r~~q~  133 (362)
                      .|-.-.|+.
T Consensus       497 aFeVy~Rk~  505 (517)
T PF12569_consen  497 AFEVYLRKG  505 (517)
T ss_pred             HhHHHHhcC
Confidence            444444433


No 74 
>PF09736 Bud13:  Pre-mRNA-splicing factor of RES complex;  InterPro: IPR018609 Bud site selection protein 13, also known as pre-mRNA-splicing factor CWC26, belongs to the pre-mRNA retention and splicing (RES) complex. May also be involved in positioning the proximal bud pole signal [, , ]. The presence of RES subunit homologues in numerous eukaryotes suggests that its function is evolutionarily conserved [].
Probab=32.93  E-value=2.6e+02  Score=24.58  Aligned_cols=19  Identities=21%  Similarity=0.270  Sum_probs=14.9

Q ss_pred             cCHHhHHHHHHHhhhhccC
Q psy17567         66 QSVKEIEESLKERKEKTLT   84 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~~lt   84 (362)
                      .+|+|+|..|.+...-..+
T Consensus        68 ~dD~~~~~~lk~~~r~~DP   86 (145)
T PF09736_consen   68 ADDEDLNEELKEQERWDDP   86 (145)
T ss_pred             hhhHHHHHHHHhcccccCc
Confidence            5889999999888765554


No 75 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=32.77  E-value=5.1  Score=37.60  Aligned_cols=10  Identities=20%  Similarity=0.199  Sum_probs=4.0

Q ss_pred             hhhhhHHHhh
Q psy17567         10 EKKKRIEKRN   19 (362)
Q Consensus        10 ~~~~~~~~~~   19 (362)
                      +.|+-+++.+
T Consensus        67 ~~k~g~QagK   76 (221)
T PF08374_consen   67 PHKKGYQAGK   76 (221)
T ss_pred             cccchhhhcc
Confidence            3444444333


No 76 
>KOG1015|consensus
Probab=32.67  E-value=15  Score=41.82  Aligned_cols=12  Identities=17%  Similarity=0.196  Sum_probs=7.5

Q ss_pred             hhhhhhhhhhhh
Q psy17567        315 INSAGMYTKYLT  326 (362)
Q Consensus       315 ~NliG~~~~~l~  326 (362)
                      -|++|.+.-|++
T Consensus       876 e~lLGs~~EfrN  887 (1567)
T KOG1015|consen  876 ENLLGSIKEFRN  887 (1567)
T ss_pred             cccccCcHHHHH
Confidence            477787765543


No 77 
>KOG2062|consensus
Probab=31.86  E-value=20  Score=39.48  Aligned_cols=17  Identities=6%  Similarity=0.024  Sum_probs=7.5

Q ss_pred             HHhHHHHHHHhhhhccCc
Q psy17567         68 VKEIEESLKERKEKTLTE   85 (362)
Q Consensus        68 ~~~~~~~l~e~~~~~lt~   85 (362)
                      -|+.-+++ |.+.++.+-
T Consensus       852 l~NpaRV~-paQ~~~is~  868 (929)
T KOG2062|consen  852 LDNPARVV-PAQLKYISF  868 (929)
T ss_pred             hcChhhcc-hhhcceeee
Confidence            34444443 344445443


No 78 
>PF05793 TFIIF_alpha:  Transcription initiation factor IIF, alpha subunit (TFIIF-alpha);  InterPro: IPR008851 Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) or RNA polymerase II-associating protein 74 (RAP74) is the large subunit of transcription factor IIF (TFIIF), which is essential for accurate initiation and stimulates elongation by RNA polymerase II [].; GO: 0003677 DNA binding, 0045893 positive regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1F3U_F 1NHA_A 1I27_A 1J2X_A 2K7L_A 1ONV_A.
Probab=31.13  E-value=16  Score=38.77  Aligned_cols=6  Identities=0%  Similarity=0.058  Sum_probs=0.0

Q ss_pred             HHhHHH
Q psy17567         68 VKEIEE   73 (362)
Q Consensus        68 ~~~~~~   73 (362)
                      +.|+|.
T Consensus       362 ~sD~d~  367 (527)
T PF05793_consen  362 DSDSDS  367 (527)
T ss_dssp             ------
T ss_pred             cccccc
Confidence            344444


No 79 
>COG3356 Predicted membrane protein [Function unknown]
Probab=28.89  E-value=3.7e+02  Score=29.04  Aligned_cols=18  Identities=28%  Similarity=0.416  Sum_probs=14.6

Q ss_pred             CcchHHhHHHHHHHHhhh
Q psy17567        116 EPSLEMSYQRYSHRQRQK  133 (362)
Q Consensus       116 s~~LE~LYq~Y~~r~~q~  133 (362)
                      .++.|+.|-+|+.++..+
T Consensus         3 t~~~~rsys~~~~~~p~s   20 (578)
T COG3356           3 TRKLERSYSKYFKTLPKS   20 (578)
T ss_pred             cccccchHhhhhccCCCc
Confidence            357789999999999933


No 80 
>PF15333 TAF1D:  TATA box-binding protein-associated factor 1D
Probab=28.81  E-value=29  Score=32.36  Aligned_cols=10  Identities=30%  Similarity=0.401  Sum_probs=5.7

Q ss_pred             cccccccCcc
Q psy17567        102 YKGIYCPSLT  111 (362)
Q Consensus       102 ~~g~~~p~L~  111 (362)
                      -||.-+|++.
T Consensus       100 dkg~~FPf~E  109 (217)
T PF15333_consen  100 DKGFQFPFVE  109 (217)
T ss_pred             hcCCCCcchh
Confidence            3566666663


No 81 
>PRK11644 sensory histidine kinase UhpB; Provisional
Probab=28.61  E-value=6.9e+02  Score=25.99  Aligned_cols=9  Identities=33%  Similarity=0.704  Sum_probs=3.8

Q ss_pred             HHHHHHHHh
Q psy17567        123 YQRYSHRQR  131 (362)
Q Consensus       123 Yq~Y~~r~~  131 (362)
                      -+||....+
T Consensus        97 ~~~~~~~~~  105 (495)
T PRK11644         97 ASRYRHQRD  105 (495)
T ss_pred             HHHhcchhh
Confidence            344444433


No 82 
>PF15049 DUF4534:  Protein of unknown function (DUF4534)
Probab=27.32  E-value=4e+02  Score=24.07  Aligned_cols=44  Identities=23%  Similarity=0.329  Sum_probs=30.1

Q ss_pred             ccchhHHHHHHHHHHHHHHHHHhhh---hhh-cchhhHHHHHHHHHHH
Q psy17567        164 IDSTKLTWTVYTMMSNLAMCLLGWW---RCF-ANNYLQWAAVGTWILL  207 (362)
Q Consensus       164 ~~~~~~~~~~~~l~~~l~L~vl~~~---~~~-~~~~l~~~~~~~wi~l  207 (362)
                      ..+.+++|...-=+++.++-++.+.   +.+ --++++|+..++=+++
T Consensus        83 GlliY~iWIi~YE~~n~~i~lLtn~~i~~~f~ev~~l~w~g~iSRm~l  130 (163)
T PF15049_consen   83 GLLIYAIWIIFYELINFSIQLLTNGTIKEQFKEVRYLRWFGQISRMLL  130 (163)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcCCcccchhHHHHHHHHHHHHHHHH
Confidence            3466777777777778788777763   222 2478899988877764


No 83 
>PF13493 DUF4118:  Domain of unknown function (DUF4118); PDB: 2KSF_A.
Probab=27.12  E-value=90  Score=24.85  Aligned_cols=26  Identities=23%  Similarity=0.319  Sum_probs=19.4

Q ss_pred             HHHHHHHHhhhhhhhhhhhhhHHhHH
Q psy17567        307 ALCLVYIGINSAGMYTKYLTDRGQRR  332 (362)
Q Consensus       307 an~ll~lc~NliG~~~~~l~e~~qR~  332 (362)
                      .+.+.++...++|+.+-+++|+.+||
T Consensus        80 ~~~~~~~~~l~va~v~g~l~~~~r~~  105 (105)
T PF13493_consen   80 QDWITFAVFLVVALVTGYLADRYRRQ  105 (105)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH---
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            46777888888999999999988875


No 84 
>PF01086 Clathrin_lg_ch:  Clathrin light chain;  InterPro: IPR000996 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ].  Clathrin is a trimer composed of three heavy chains and three light chains, each monomer projecting outwards like a leg; this three-legged structure is known as a triskelion [, ]. The heavy chains form the legs, their N-terminal beta-propeller regions extending outwards, while their C-terminal alpha-alpha-superhelical regions form the central hub of the triskelion. Peptide motifs can bind between the beta-propeller blades. The light chains appear to have a regulatory role, and may help orient the assembly and disassembly of clathrin coats as they interact with hsc70 uncoating ATPase []. Clathrin triskelia self-polymerise into a curved lattice by twisting individual legs together. The clathrin lattice forms around a vesicle as it buds from the TGN, plasma membrane or endosomes, acting to stabilise the vesicle and facilitate the budding process []. The multiple blades created when the triskelia polymerise are involved in multiple protein interactions, enabling the recruitment of different cargo adaptors and membrane attachment proteins [].  This entry represents clathrin light chains, which are more divergent in sequence than the heavy chains []. In higher eukaryotes, two genes encode distinct but related light chains, each of which can yield two separate forms via alternative splicing. In yeast there is a single light chain whose sequence is only distantly related to that of higher eukaryotes. Clathrin light chains have a conserved acidic N-terminal domain, a central coiled-coil domain and a conserved C-terminal domain.  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030130 clathrin coat of trans-Golgi network vesicle, 0030132 clathrin coat of coated pit; PDB: 3LVG_E 3LVH_D.
Probab=27.02  E-value=1.1e+02  Score=28.75  Aligned_cols=16  Identities=13%  Similarity=0.366  Sum_probs=0.0

Q ss_pred             cCccccccccccc--ccc
Q psy17567         83 LTEDSQCDTMIPV--FKK   98 (362)
Q Consensus        83 lt~~~~~~~~~~~--f~~   98 (362)
                      ...+..|.++...  |..
T Consensus       180 ~~~~t~WerV~~Lid~~~  197 (225)
T PF01086_consen  180 LQPGTEWERVAKLIDFNP  197 (225)
T ss_dssp             ------------------
T ss_pred             CCCCCcHHHHHHHhCCCC
Confidence            3456778888883  654


No 85 
>PF06027 DUF914:  Eukaryotic protein of unknown function (DUF914);  InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function. Some of the sequences in this family are annotated as putative membrane proteins.
Probab=26.75  E-value=6.6e+02  Score=25.15  Aligned_cols=66  Identities=18%  Similarity=0.184  Sum_probs=38.0

Q ss_pred             HHHHHhcccccchHHH----HHhhhhhHHHHHHHHHHHHhccCCCCchhhhhHHHHHHHHHHhhhhhhhhhhhhhHHhH
Q psy17567        257 IVFVTYAMLPLPLKWC----FIGGCTTSVLHVIITAQIKLHRGPLSPCSVHEMGALCLVYIGINSAGMYTKYLTDRGQR  331 (362)
Q Consensus       257 iIf~iYtmLPl~l~~a----il~g~~~Sl~hliv~~~~~~~~~~~~~~~~~ql~an~ll~lc~NliG~~~~~l~e~~qR  331 (362)
                      .+|+.|++.|+-++.+    +-+|.++|..|-++...+. +..   ...+..+++-     +.-++|.+.+...+....
T Consensus       242 ~lf~~y~l~p~~l~~ssAt~~nLsLLTsd~~ali~~i~~-f~~---~~~~ly~~af-----~lIiiG~vvy~~~~~~~~  311 (334)
T PF06027_consen  242 CLFLFYSLVPIVLRMSSATFFNLSLLTSDFYALIIDIFF-FGY---KFSWLYILAF-----ALIIIGFVVYNLAESPEE  311 (334)
T ss_pred             HHHHHHHHHHHHHHhCccceeehHHHHhhHHHHHHHHHh-cCc---cccHHHHHHH-----HHHHHHhheEEccCCccc
Confidence            3688899999986533    4467777777766644321 111   1122233332     233678888877765443


No 86 
>COG3083 Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only]
Probab=26.70  E-value=6.7e+02  Score=27.03  Aligned_cols=10  Identities=30%  Similarity=0.650  Sum_probs=5.9

Q ss_pred             HHHhhhhhhh
Q psy17567        228 TWILLNTQGF  237 (362)
Q Consensus       228 ~~v~~~~q~~  237 (362)
                      +++++|.+++
T Consensus        99 tLLlvD~evf  108 (600)
T COG3083          99 TLLLVDSEVF  108 (600)
T ss_pred             HHHhhhHHHH
Confidence            4455676655


No 87 
>PF05087 Rota_VP2:  Rotavirus VP2 protein;  InterPro: IPR007779 Rotavirus particles consist of three concentric proteinaceous capsid layers. The innermost capsid (core) is made of VP2. The genomic RNA and the two minor proteins VP1 and VP3 are encapsidated within this layer []. The N terminus of rotavirus VP2 is necessary for the encapsidation of VP1 and VP3 [].; GO: 0003723 RNA binding, 0019013 viral nucleocapsid; PDB: 3N09_A 3GZU_A 3KZ4_A.
Probab=26.68  E-value=37  Score=36.77  Aligned_cols=18  Identities=28%  Similarity=0.218  Sum_probs=9.6

Q ss_pred             CHHhHH-HHHHHhhhhccC
Q psy17567         67 SVKEIE-ESLKERKEKTLT   84 (362)
Q Consensus        67 ~~~~~~-~~l~e~~~~~lt   84 (362)
                      -..||| +++.-..+...+
T Consensus        89 hqKEIqyEIlqKtIPTFep  107 (887)
T PF05087_consen   89 HQKEIQYEILQKTIPTFEP  107 (887)
T ss_dssp             HHHHHHHHHHHTTS-B-SS
T ss_pred             HHHHHHHHHHHhhCCCCCc
Confidence            556777 666655554443


No 88 
>PF01086 Clathrin_lg_ch:  Clathrin light chain;  InterPro: IPR000996 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ].  Clathrin is a trimer composed of three heavy chains and three light chains, each monomer projecting outwards like a leg; this three-legged structure is known as a triskelion [, ]. The heavy chains form the legs, their N-terminal beta-propeller regions extending outwards, while their C-terminal alpha-alpha-superhelical regions form the central hub of the triskelion. Peptide motifs can bind between the beta-propeller blades. The light chains appear to have a regulatory role, and may help orient the assembly and disassembly of clathrin coats as they interact with hsc70 uncoating ATPase []. Clathrin triskelia self-polymerise into a curved lattice by twisting individual legs together. The clathrin lattice forms around a vesicle as it buds from the TGN, plasma membrane or endosomes, acting to stabilise the vesicle and facilitate the budding process []. The multiple blades created when the triskelia polymerise are involved in multiple protein interactions, enabling the recruitment of different cargo adaptors and membrane attachment proteins [].  This entry represents clathrin light chains, which are more divergent in sequence than the heavy chains []. In higher eukaryotes, two genes encode distinct but related light chains, each of which can yield two separate forms via alternative splicing. In yeast there is a single light chain whose sequence is only distantly related to that of higher eukaryotes. Clathrin light chains have a conserved acidic N-terminal domain, a central coiled-coil domain and a conserved C-terminal domain.  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030130 clathrin coat of trans-Golgi network vesicle, 0030132 clathrin coat of coated pit; PDB: 3LVG_E 3LVH_D.
Probab=26.22  E-value=99  Score=29.09  Aligned_cols=9  Identities=11%  Similarity=0.287  Sum_probs=0.0

Q ss_pred             ccccccccc
Q psy17567         88 QCDTMIPVF   96 (362)
Q Consensus        88 ~~~~~~~~f   96 (362)
                      .-++|-.+.
T Consensus       205 D~sRmR~iL  213 (225)
T PF01086_consen  205 DVSRMREIL  213 (225)
T ss_dssp             ---------
T ss_pred             cHHHHHHHH
Confidence            334444443


No 89 
>KOG2256|consensus
Probab=26.15  E-value=20  Score=38.77  Aligned_cols=8  Identities=38%  Similarity=0.467  Sum_probs=3.7

Q ss_pred             hcccccch
Q psy17567        262 YAMLPLPL  269 (362)
Q Consensus       262 YtmLPl~l  269 (362)
                      +.++|+++
T Consensus       439 ~qy~PLRl  446 (661)
T KOG2256|consen  439 PQYYPLRL  446 (661)
T ss_pred             ccchhHHH
Confidence            34445553


No 90 
>PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed
Probab=25.77  E-value=3e+02  Score=28.09  Aligned_cols=31  Identities=26%  Similarity=0.510  Sum_probs=22.7

Q ss_pred             HHHHhcccc---cchHHHHHhhhhhHHHHHHHHH
Q psy17567        258 VFVTYAMLP---LPLKWCFIGGCTTSVLHVIITA  288 (362)
Q Consensus       258 If~iYtmLP---l~l~~ail~g~~~Sl~hliv~~  288 (362)
                      ...+|.++|   +++++++..|++.++...+.-+
T Consensus       194 f~~lY~~~Pn~~v~~r~al~Gai~a~vl~~~~~~  227 (412)
T PRK04214        194 LTLLYRVVPNHFVPLRHALPGALLTAVLLELVKW  227 (412)
T ss_pred             HHHHHHHcCCCccchHHhHHHHHHHHHHHHHHHH
Confidence            346799999   5578888888888777766544


No 91 
>KOG1070|consensus
Probab=25.68  E-value=29  Score=40.85  Aligned_cols=14  Identities=14%  Similarity=0.351  Sum_probs=10.5

Q ss_pred             cCHHhHHHHHHHhh
Q psy17567         66 QSVKEIEESLKERK   79 (362)
Q Consensus        66 ~~~~~~~~~l~e~~   79 (362)
                      ++.|||++.+....
T Consensus      1442 esaeDferlvrssP 1455 (1710)
T KOG1070|consen 1442 ESAEDFERLVRSSP 1455 (1710)
T ss_pred             cCHHHHHHHHhcCC
Confidence            58899998876543


No 92 
>KOG1098|consensus
Probab=25.49  E-value=37  Score=36.90  Aligned_cols=25  Identities=28%  Similarity=0.405  Sum_probs=13.3

Q ss_pred             HhhHHHHhhhhhhHHHHhhhhhhHH
Q psy17567         25 EENEQEEKEKEDVEEEKNKKKKKKK   49 (362)
Q Consensus        25 ~e~~e~~~~~e~~~~e~~~~~~~~~   49 (362)
                      .|+||.++..++-++.+++.-|+|+
T Consensus       340 teEeeld~~l~~l~E~e~~~lkRkk  364 (780)
T KOG1098|consen  340 TEEEELDKLLAELSEDEKAALKRKK  364 (780)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444555666666555555444443


No 93 
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=24.99  E-value=15  Score=41.62  Aligned_cols=11  Identities=18%  Similarity=0.244  Sum_probs=6.0

Q ss_pred             ccccccccccc
Q psy17567         87 SQCDTMIPVFK   97 (362)
Q Consensus        87 ~~~~~~~~~f~   97 (362)
                      +.|.....+|.
T Consensus       901 ~~~~~~~wvl~  911 (1096)
T TIGR00927       901 TRQKQAIYLFL  911 (1096)
T ss_pred             cccceeEeEEe
Confidence            44566555554


No 94 
>KOG0299|consensus
Probab=24.88  E-value=60  Score=33.79  Aligned_cols=7  Identities=0%  Similarity=0.321  Sum_probs=4.1

Q ss_pred             cCHHhHH
Q psy17567         66 QSVKEIE   72 (362)
Q Consensus        66 ~~~~~~~   72 (362)
                      .|++|+|
T Consensus        94 ~d~~~~~  100 (479)
T KOG0299|consen   94 FDADDLD  100 (479)
T ss_pred             cccchhh
Confidence            4556665


No 95 
>KOG0949|consensus
Probab=24.83  E-value=1.2e+02  Score=35.09  Aligned_cols=20  Identities=40%  Similarity=0.433  Sum_probs=14.0

Q ss_pred             ccccccccCccCcCCCcchH
Q psy17567        101 LYKGIYCPSLTNSFREPSLE  120 (362)
Q Consensus       101 ~~~g~~~p~L~~kF~s~~LE  120 (362)
                      ..-|+++|.=+.-|--++|-
T Consensus       998 LsLGiNMPCrTVvF~gDsLQ 1017 (1330)
T KOG0949|consen  998 LSLGINMPCRTVVFAGDSLQ 1017 (1330)
T ss_pred             hhcccCCCceeEEEeccccc
Confidence            45688888877777666654


No 96 
>PF12757 DUF3812:  Protein of unknown function (DUF3812);  InterPro: IPR024527 This family of fungal proteins represents the eisosome 1 family. Eisosome protein 1 is required for normal formation of eisosomes, large cytoplasmic protein assemblies that localize to specialised domains on plasma membrane and mark the site of endocytosis [].
Probab=24.68  E-value=1.1e+02  Score=26.22  Aligned_cols=19  Identities=26%  Similarity=0.435  Sum_probs=9.9

Q ss_pred             hhHHHhhhHHHHHhhHHHH
Q psy17567         13 KRIEKRNKEEEKEENEQEE   31 (362)
Q Consensus        13 ~~~~~~~~~~~e~e~~e~~   31 (362)
                      .++|++|..+++.+.++++
T Consensus        91 erae~qRa~d~e~k~~~~~  109 (126)
T PF12757_consen   91 ERAEAQRARDEEIKLDEEE  109 (126)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4556666655555444443


No 97 
>PF06645 SPC12:  Microsomal signal peptidase 12 kDa subunit (SPC12);  InterPro: IPR009542  This family consists of several microsomal signal peptidase 12 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains. This family represents the 12 kDa subunit (SPC12).; GO: 0008233 peptidase activity, 0006465 signal peptide processing, 0005787 signal peptidase complex, 0016021 integral to membrane
Probab=24.58  E-value=2.1e+02  Score=22.27  Aligned_cols=12  Identities=25%  Similarity=0.844  Sum_probs=6.7

Q ss_pred             hhhhhcchhhHH
Q psy17567        187 WWRCFANNYLQW  198 (362)
Q Consensus       187 ~~~~~~~~~l~~  198 (362)
                      .|..+.++.++|
T Consensus        55 ~Wp~y~r~p~~W   66 (76)
T PF06645_consen   55 PWPFYNRHPLKW   66 (76)
T ss_pred             CcHhhcCCcccC
Confidence            566555555555


No 98 
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis]
Probab=24.08  E-value=55  Score=27.34  Aligned_cols=23  Identities=9%  Similarity=0.127  Sum_probs=15.9

Q ss_pred             hcccccCHHhHHHHHHHhhhhcc
Q psy17567         61 KKKEEQSVKEIEESLKERKEKTL   83 (362)
Q Consensus        61 ~~~~~~~~~~~~~~l~e~~~~~l   83 (362)
                      +....=|++-+|++++|..-...
T Consensus        37 ~~av~vdee~~~ki~KEV~~~r~   59 (107)
T COG4901          37 RRAVTVDEELLDKIRKEVPRERV   59 (107)
T ss_pred             hhhhhccHHHHHHHHHhccccee
Confidence            33344577889999999876443


No 99 
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]
Probab=23.96  E-value=20  Score=38.57  Aligned_cols=34  Identities=26%  Similarity=0.487  Sum_probs=19.2

Q ss_pred             cCHHhHHHHHHHhhhhccCccccccccccc--cccccc
Q psy17567         66 QSVKEIEESLKERKEKTLTEDSQCDTMIPV--FKKGVL  101 (362)
Q Consensus        66 ~~~~~~~~~l~e~~~~~lt~~~~~~~~~~~--f~~g~~  101 (362)
                      +-.|++.+++- ++..+-+= --=+++.||  |+.|+.
T Consensus       849 ~~vdn~trilp-~q~~yisf-~~d~r~~pvrkf~ggvv  884 (926)
T COG5116         849 YKVDNMTRILP-QQSRYISF-IKDDRFVPVRKFKGGVV  884 (926)
T ss_pred             cchhhhhhhcc-ccCceeEE-eeCCceEEeEeecCcEE
Confidence            46788888874 33333321 112567775  777554


No 100
>PRK07668 hypothetical protein; Validated
Probab=23.70  E-value=6.7e+02  Score=24.21  Aligned_cols=17  Identities=12%  Similarity=-0.144  Sum_probs=6.7

Q ss_pred             hhhhhcchhhHHHHHHHH
Q psy17567        187 WWRCFANNYLQWAAVGTW  204 (362)
Q Consensus       187 ~~~~~~~~~l~~~~~~~w  204 (362)
                      +...| +....|-..+.|
T Consensus       129 r~~~f-k~~~~~~~~i~~  145 (254)
T PRK07668        129 RMASF-KSKLTEKWFLII  145 (254)
T ss_pred             HHHHH-hccchhHHHHHH
Confidence            44434 333444333333


No 101
>KOG3915|consensus
Probab=23.43  E-value=1.8e+02  Score=30.64  Aligned_cols=18  Identities=44%  Similarity=0.523  Sum_probs=7.6

Q ss_pred             hHHHHHHHHHhhhhhccc
Q psy17567         47 KKKKKKKKKKKKKKKKKE   64 (362)
Q Consensus        47 ~~~~~~k~~~~~~~~~~~   64 (362)
                      |+-||-||-|++++++-+
T Consensus       563 kr~kkEkk~k~k~qe~L~  580 (641)
T KOG3915|consen  563 KRLKKEKKAKRKLQEALE  580 (641)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            443344443444444433


No 102
>KOG3045|consensus
Probab=23.36  E-value=22  Score=34.75  Aligned_cols=14  Identities=21%  Similarity=0.088  Sum_probs=7.6

Q ss_pred             cchHHhHHHHHHHH
Q psy17567        117 PSLEMSYQRYSHRQ  130 (362)
Q Consensus       117 ~~LE~LYq~Y~~r~  130 (362)
                      +.+=.+|+.=|..|
T Consensus       146 p~afdlYH~gfr~Q  159 (325)
T KOG3045|consen  146 PTAFDLYHAGFRSQ  159 (325)
T ss_pred             cHHHHHHHHHHHHH
Confidence            35556676655444


No 103
>PF13829 DUF4191:  Domain of unknown function (DUF4191)
Probab=23.23  E-value=4.2e+02  Score=25.14  Aligned_cols=20  Identities=10%  Similarity=0.227  Sum_probs=14.0

Q ss_pred             chHHhHHHHHHHHhhhHHHH
Q psy17567        118 SLEMSYQRYSHRQRQKSLII  137 (362)
Q Consensus       118 ~LE~LYq~Y~~r~~q~sL~v  137 (362)
                      -+-.+.|.|....++.+-+.
T Consensus         9 ~~~Qi~q~y~~trk~dp~l~   28 (224)
T PF13829_consen    9 RRKQIWQAYKMTRKEDPKLP   28 (224)
T ss_pred             HHHHHHHHHHHHHHHCcchH
Confidence            45677888988877765443


No 104
>KOG2138|consensus
Probab=23.02  E-value=42  Score=36.80  Aligned_cols=7  Identities=14%  Similarity=0.193  Sum_probs=2.8

Q ss_pred             CHHhHHH
Q psy17567         67 SVKEIEE   73 (362)
Q Consensus        67 ~~~~~~~   73 (362)
                      |-|+=|+
T Consensus       851 Ssd~sdk  857 (883)
T KOG2138|consen  851 SSDSSDK  857 (883)
T ss_pred             ccccchh
Confidence            4444343


No 105
>PHA02644 hypothetical protein; Provisional
Probab=22.95  E-value=6.7  Score=31.46  Aligned_cols=13  Identities=38%  Similarity=0.547  Sum_probs=5.8

Q ss_pred             hcccc-cCHHhHHH
Q psy17567         61 KKKEE-QSVKEIEE   73 (362)
Q Consensus        61 ~~~~~-~~~~~~~~   73 (362)
                      +.+++ +++.||+.
T Consensus        91 pekpenedekefed  104 (112)
T PHA02644         91 PEKPENEDEKEFED  104 (112)
T ss_pred             CCCCCCcchhhhcc
Confidence            33444 44455543


No 106
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=22.16  E-value=2.4e+02  Score=29.00  Aligned_cols=7  Identities=14%  Similarity=0.520  Sum_probs=2.9

Q ss_pred             hHHHHHH
Q psy17567         70 EIEESLK   76 (362)
Q Consensus        70 ~~~~~l~   76 (362)
                      ++|-.|.
T Consensus       258 ~~dd~~~  264 (387)
T PRK09510        258 EVDDLFG  264 (387)
T ss_pred             HHHHHhh
Confidence            3444443


No 107
>KOG2507|consensus
Probab=22.16  E-value=66  Score=33.40  Aligned_cols=9  Identities=22%  Similarity=0.490  Sum_probs=3.5

Q ss_pred             cCccCcCCC
Q psy17567        108 PSLTNSFRE  116 (362)
Q Consensus       108 p~L~~kF~s  116 (362)
                      ||=+..|..
T Consensus       360 pyPRReft~  368 (506)
T KOG2507|consen  360 PYPRREFTD  368 (506)
T ss_pred             ccccccccc
Confidence            333334433


No 108
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.87  E-value=1.4e+02  Score=29.76  Aligned_cols=51  Identities=27%  Similarity=0.305  Sum_probs=0.0

Q ss_pred             hhhhhhHHHhhhHHHHHhhHHHHhhhhhhHH-------------------HHhhhhhhHHHHHHHHHhhh
Q psy17567          9 GEKKKRIEKRNKEEEKEENEQEEKEKEDVEE-------------------EKNKKKKKKKKKKKKKKKKK   59 (362)
Q Consensus         9 ~~~~~~~~~~~~~~~e~e~~e~~~~~e~~~~-------------------e~~~~~~~~~~~~k~~~~~~   59 (362)
                      +..+..+++||++..+++++|+...+.+.++                   .+++..+|++-.+++.-++.
T Consensus       152 ~~E~~~~~~rr~~~~~~e~ee~~~~~~~~~~~ld~L~~s~~~~~~~i~~~~~~~~~~k~~~~r~~~~~~~  221 (309)
T TIGR00570       152 EFEKEEEEQRRLLLQKEEEEQQMNKRKNKQALLDELETSTLPAAELIAQHKKNSVKLEMQVEKPKPEKPN  221 (309)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHhhhhhccccchh


No 109
>PF08243 SPT2:  SPT2 chromatin protein;  InterPro: IPR013256 This entry includes the Saccharomyces cerevisiae (Baker's yeast) protein SPT2 which is a chromatin protein involved in transcriptional regulation []. These proteins shows conservation of several domains across numerous species, including having a cluster of positively charged amino acids. This cluster probably functions in the binding properties of the proteins []. Sin1p/Spt2p probably modulates the local chromatin structure by binding two strands of double-stranded DNA at their crossover point. Sin1p/Spt2p has sequence similarity to HMG1 and serves as a negative transcriptional regulator of a small family of genes that are activated by the SWI/SNF chromatin-remodelling complex. It is also involved in maintaining the integrity of chromatin during transcription elongation. Sin1p/Spt2 is required for, and is directly involved in, the efficient recruitment of the mRNA cleavage/polyadenylation complex []. Spt2 is also involved in regulating levels of histone H3 over transcribed regions [].
Probab=21.75  E-value=1.3e+02  Score=25.55  Aligned_cols=13  Identities=31%  Similarity=0.486  Sum_probs=5.4

Q ss_pred             hhhhhHHHHhhhh
Q psy17567         33 EKEDVEEEKNKKK   45 (362)
Q Consensus        33 ~~e~~~~e~~~~~   45 (362)
                      ..|+.+++...+.
T Consensus        93 ~~ED~~e~~~e~~  105 (116)
T PF08243_consen   93 RLEDEREERREEE  105 (116)
T ss_pred             HhhhHHHHHHHHH
Confidence            4444444444333


No 110
>PF07701 HNOBA:  Heme NO binding associated;  InterPro: IPR011645 The HNOBA (Haem NO Binding) domain is found associated with the HNOB domain and IPR001054 from INTERPRO in soluble cyclases and signalling proteins. The HNOB domain is predicted to function as a haem-dependent sensor for gaseous ligands, and transduce diverse downstream signals in both bacteria and animals.; GO: 0004383 guanylate cyclase activity, 0006182 cGMP biosynthetic process; PDB: 2P04_B 2P08_A 3HLS_E.
Probab=21.30  E-value=2.3e+02  Score=26.54  Aligned_cols=44  Identities=14%  Similarity=0.126  Sum_probs=30.6

Q ss_pred             hhhhhhhhhHHhHHHHHHHHHHHHHHHHhhhHHHHHHHHhhhcC
Q psy17567        319 GMYTKYLTDRGQRRAFLETHRSTETRMKTQKENDQQEKLLLSGM  362 (362)
Q Consensus       319 G~~~~~l~e~~qR~aFLetrq~i~~rl~Le~E~~qQErLLLSVL  362 (362)
                      |....-..+.+.+...-.+.+.=++...++.|+++-++||.|+|
T Consensus       168 ~~q~~a~~~l~~~le~~~~~~Le~~~~~l~~ek~ktd~LL~~ml  211 (219)
T PF07701_consen  168 GQQQSAELKLAKQLEQEKSAELEESMRELEEEKKKTDELLYSML  211 (219)
T ss_dssp             HHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            44444444555555545555566778899999999999999986


No 111
>PF01698 FLO_LFY:  Floricaula / Leafy protein;  InterPro: IPR002910 This family consists of various plant development proteins which are homologues of Floricaula (FLO) and leafy (LFY) proteins which are floral meristem identity proteins. Mutations in the sequences of these proteins affect flower and leaf development.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2VY1_A 2VY2_A.
Probab=20.88  E-value=55  Score=33.39  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=12.0

Q ss_pred             cccccccccccccCccCcCCCcchHHhHHHHH
Q psy17567         96 FKKGVLYKGIYCPSLTNSFREPSLEMSYQRYS  127 (362)
Q Consensus        96 f~~g~~~~g~~~p~L~~kF~s~~LE~LYq~Y~  127 (362)
                      =+.|-++||.          -.+|+=||..|-
T Consensus       236 TEPGEVARGK----------KNGLDYLFHLYE  257 (386)
T PF01698_consen  236 TEPGEVARGK----------KNGLDYLFHLYE  257 (386)
T ss_dssp             --TT----SS-----------B-HHHHHHHHH
T ss_pred             cccchhhccc----------ccCcchHHHHHH
Confidence            3999999994          259999999996


No 112
>KOG2662|consensus
Probab=20.61  E-value=9.6e+02  Score=24.88  Aligned_cols=16  Identities=25%  Similarity=0.191  Sum_probs=13.2

Q ss_pred             CCCcchHHhHHHHHHH
Q psy17567        114 FREPSLEMSYQRYSHR  129 (362)
Q Consensus       114 F~s~~LE~LYq~Y~~r  129 (362)
                      -+-+++|.|-+.|+.+
T Consensus       297 dd~eElEMLLEaYf~q  312 (414)
T KOG2662|consen  297 DDVEELEMLLEAYFMQ  312 (414)
T ss_pred             ccHHHHHHHHHHHHHH
Confidence            4557899999999976


No 113
>KOG3142|consensus
Probab=20.27  E-value=6.9e+02  Score=23.06  Aligned_cols=28  Identities=18%  Similarity=0.232  Sum_probs=19.5

Q ss_pred             CHHhHHHHHHHhhhhccCcccccccccc
Q psy17567         67 SVKEIEESLKERKEKTLTEDSQCDTMIP   94 (362)
Q Consensus        67 ~~~~~~~~l~e~~~~~lt~~~~~~~~~~   94 (362)
                      +-+++-....+..+..+++...|..+.+
T Consensus        18 ~~~~~~~~~~~~~~~~lst~RpW~ef~d   45 (187)
T KOG3142|consen   18 SVESISSRAKQTIQSGLSTRRPWSEFFD   45 (187)
T ss_pred             chhhHHHHHHHHHHHHHhccCCHHHHHc
Confidence            3455666677777777777766887766


No 114
>smart00441 FF Contains two conserved F residues. A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues.
Probab=20.18  E-value=74  Score=22.41  Aligned_cols=50  Identities=22%  Similarity=0.282  Sum_probs=37.1

Q ss_pred             HHhHHHHHHHhhhhccCccccccccccccccccccccccccCccCcCCCcchHHhHHHHH
Q psy17567         68 VKEIEESLKERKEKTLTEDSQCDTMIPVFKKGVLYKGIYCPSLTNSFREPSLEMSYQRYS  127 (362)
Q Consensus        68 ~~~~~~~l~e~~~~~lt~~~~~~~~~~~f~~g~~~~g~~~p~L~~kF~s~~LE~LYq~Y~  127 (362)
                      -++|...|++...  .+.++.|+...+.+.....|+.+        ..+..-|.+|+.|.
T Consensus         4 ~~~F~~LL~e~~~--~~~~~~W~~~~~~~~~d~ry~~l--------~~~~~r~~lF~~~i   53 (55)
T smart00441        4 KEAFKELLKEHEV--ITPDTTWSEARKKLKNDPRYKAL--------LSESEREQLFEDHI   53 (55)
T ss_pred             HHHHHHHHHhCCC--CCCCCcHHHHHHHHhcChHHHHh--------cChHHHHHHHHHHH
Confidence            4678888988743  45789999999998776666543        44567778888885


No 115
>KOG1059|consensus
Probab=20.06  E-value=35  Score=37.59  Aligned_cols=20  Identities=60%  Similarity=0.624  Sum_probs=10.2

Q ss_pred             hhHHHHHHHHHhhhhhcccc
Q psy17567         46 KKKKKKKKKKKKKKKKKKEE   65 (362)
Q Consensus        46 ~~~~~~~k~~~~~~~~~~~~   65 (362)
                      ||||||++||+++.+....+
T Consensus       850 KkKskk~~k~~t~a~~~~~~  869 (877)
T KOG1059|consen  850 KKKSKKKNKKKTKAKNVPEP  869 (877)
T ss_pred             hhhhcccchhhhhhhcccCc
Confidence            34444444555666655543


Done!