Query         psy17586
Match_columns 106
No_of_seqs    103 out of 574
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:25:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17586.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17586hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2792|consensus               99.6 2.3E-16 4.9E-21  125.9   4.8   69   11-80    209-279 (280)
  2 COG1999 Uncharacterized protei  99.2 3.8E-11 8.2E-16   91.4   5.5   71    7-78    134-206 (207)
  3 PF02630 SCO1-SenC:  SCO1/SenC;  98.6   2E-08 4.2E-13   74.0   1.0   52   10-61    120-173 (174)
  4 TIGR02540 gpx7 putative glutat  97.3 0.00025 5.3E-09   50.2   2.9   40   37-76    107-153 (153)
  5 cd02968 SCO SCO (an acronym fo  96.4  0.0049 1.1E-07   42.0   3.9   38   21-60    104-141 (142)
  6 PLN02399 phospholipid hydroper  95.0   0.041   9E-07   43.1   4.5   38   40-77    198-235 (236)
  7 PLN02412 probable glutathione   95.0    0.06 1.3E-06   39.1   5.0   34   45-78    133-166 (167)
  8 PTZ00056 glutathione peroxidas  94.9   0.082 1.8E-06   39.7   5.6   39   41-79    143-181 (199)
  9 PTZ00256 glutathione peroxidas  94.8   0.055 1.2E-06   39.7   4.5   39   39-77    144-182 (183)
 10 COG0386 BtuE Glutathione perox  94.7   0.041 8.8E-07   41.7   3.7   32   46-77    130-161 (162)
 11 PRK10606 btuE putative glutath  94.6   0.039 8.4E-07   41.5   3.3   31   46-76    149-181 (183)
 12 cd00340 GSH_Peroxidase Glutath  93.2    0.12 2.6E-06   36.5   3.4   32   40-71    120-151 (152)
 13 PRK15412 thiol:disulfide inter  92.8    0.29 6.3E-06   35.9   5.2   43   37-79    137-179 (185)
 14 PRK03147 thiol-disulfide oxido  92.7    0.24 5.3E-06   34.7   4.5   38   37-74    133-170 (173)
 15 TIGR00385 dsbE periplasmic pro  92.1    0.29 6.3E-06   35.4   4.3   41   37-77    132-172 (173)
 16 cd03015 PRX_Typ2cys Peroxiredo  91.0    0.54 1.2E-05   33.8   4.8   32   44-75    121-156 (173)
 17 KOG1651|consensus               89.8    0.32   7E-06   37.1   2.8   33   45-77    138-170 (171)
 18 PRK09437 bcp thioredoxin-depen  89.1    0.84 1.8E-05   31.8   4.4   30   37-67    115-144 (154)
 19 cd02969 PRX_like1 Peroxiredoxi  88.6    0.76 1.6E-05   32.7   4.0   42   37-78    104-154 (171)
 20 cd02950 TxlA TRX-like protein   88.0     1.3 2.8E-05   31.4   4.8   42   36-77     70-111 (142)
 21 cd02958 UAS UAS family; UAS is  88.0     1.2 2.5E-05   29.9   4.4   42   37-78     71-113 (114)
 22 cd03017 PRX_BCP Peroxiredoxin   87.5    0.68 1.5E-05   31.2   3.0   29   44-72    111-139 (140)
 23 cd03016 PRX_1cys Peroxiredoxin  87.4    0.94   2E-05   33.8   4.0   30   45-74    119-152 (203)
 24 TIGR03137 AhpC peroxiredoxin.   87.2    0.77 1.7E-05   33.8   3.3   37   42-78    118-154 (187)
 25 cd03011 TlpA_like_ScsD_MtbDsbE  86.6       1 2.2E-05   29.8   3.4   34   37-71     88-121 (123)
 26 PF02824 TGS:  TGS domain;  Int  85.5     1.8 3.8E-05   26.8   3.9   31   45-78      2-32  (60)
 27 cd02966 TlpA_like_family TlpA-  85.0    0.88 1.9E-05   28.3   2.4   25   36-60     91-115 (116)
 28 TIGR01626 ytfJ_HI0045 conserve  85.0     2.2 4.9E-05   32.3   5.0   40   37-77    140-180 (184)
 29 PTZ00253 tryparedoxin peroxida  84.6     1.4 3.1E-05   32.6   3.7   37   44-80    128-164 (199)
 30 PRK13599 putative peroxiredoxi  84.3     1.5 3.2E-05   33.5   3.7   32   43-74    119-154 (215)
 31 PRK13190 putative peroxiredoxi  84.2     2.9 6.3E-05   31.3   5.2   34   43-76    117-154 (202)
 32 PF13098 Thioredoxin_2:  Thiore  84.0     1.5 3.2E-05   28.6   3.2   36   37-72     77-112 (112)
 33 PRK13189 peroxiredoxin; Provis  83.4     1.7 3.7E-05   33.2   3.8   31   44-74    127-161 (222)
 34 PRK10382 alkyl hydroperoxide r  81.2     1.8   4E-05   32.4   3.2   29   44-72    120-152 (187)
 35 PRK15000 peroxidase; Provision  80.2     2.3   5E-05   31.9   3.4   32   43-74    125-160 (200)
 36 cd02951 SoxW SoxW family; SoxW  80.0     5.3 0.00012   26.8   4.9   41   37-77     79-120 (125)
 37 PF05176 ATP-synt_10:  ATP10 pr  79.5     3.7 7.9E-05   32.5   4.5   31   40-70    214-244 (252)
 38 COG1225 Bcp Peroxiredoxin [Pos  78.0     3.4 7.3E-05   30.9   3.7   26   40-66    117-142 (157)
 39 TIGR02738 TrbB type-F conjugat  77.5       4 8.7E-05   29.7   3.9   37   39-75    115-152 (153)
 40 PRK13728 conjugal transfer pro  77.0     6.1 0.00013   30.0   4.9   38   41-78    135-173 (181)
 41 COG0450 AhpC Peroxiredoxin [Po  75.1     4.5 9.7E-05   31.4   3.7   46   44-89    125-176 (194)
 42 PRK13191 putative peroxiredoxi  74.9     3.9 8.5E-05   31.1   3.4   31   44-74    125-159 (215)
 43 cd03012 TlpA_like_DipZ_like Tl  74.5     2.9 6.2E-05   28.2   2.3   24   37-60    100-123 (126)
 44 PTZ00137 2-Cys peroxiredoxin;   74.2     4.2 9.2E-05   32.4   3.5   31   43-73    188-222 (261)
 45 PLN02919 haloacid dehalogenase  73.4     6.1 0.00013   36.9   4.8   46   37-82    497-542 (1057)
 46 TIGR02739 TraF type-F conjugat  71.5     7.2 0.00016   31.1   4.2   43   37-79    208-251 (256)
 47 cd03010 TlpA_like_DsbE TlpA-li  68.4     5.8 0.00013   26.4   2.7   31   37-67     95-125 (127)
 48 PRK00522 tpx lipid hydroperoxi  68.2      11 0.00025   27.0   4.4   16   45-60    133-148 (167)
 49 cd03018 PRX_AhpE_like Peroxire  68.0     5.1 0.00011   27.3   2.4   21   43-63    114-134 (149)
 50 PRK14552 C/D box methylation g  67.7     7.1 0.00015   33.2   3.7   38   38-75      3-40  (414)
 51 PF13642 DUF4144:  protein stru  65.7      17 0.00036   25.3   4.6   60   35-94     33-95  (101)
 52 TIGR02661 MauD methylamine deh  65.0      14  0.0003   27.1   4.4   23   36-58    140-162 (189)
 53 cd02971 PRX_family Peroxiredox  64.9     6.8 0.00015   26.2   2.5   22   43-64    110-131 (140)
 54 KOG4107|consensus               64.1      23 0.00051   25.6   5.2   45   45-89     21-66  (125)
 55 cd02967 mauD Methylamine utili  62.9     6.3 0.00014   25.5   2.0   21   37-57     90-110 (114)
 56 PRK13703 conjugal pilus assemb  62.4      15 0.00033   29.2   4.4   43   37-79    201-244 (248)
 57 cd08348 BphC2-C3-RGP6_C_like T  61.0      14 0.00031   24.3   3.5   27   44-70    103-129 (134)
 58 PF03259 Robl_LC7:  Roadblock/L  60.2      15 0.00033   22.9   3.4   39   43-81     15-54  (91)
 59 PF08534 Redoxin:  Redoxin;  In  59.9     8.2 0.00018   26.3   2.2   23   42-64    114-136 (146)
 60 PF10029 DUF2271:  Predicted pe  59.0      19 0.00042   26.0   4.1   52   44-97     23-74  (139)
 61 cd02953 DsbDgamma DsbD gamma f  57.6      12 0.00025   24.2   2.5   36   37-72     67-103 (104)
 62 PF14639 YqgF:  Holliday-juncti  56.7      28  0.0006   25.4   4.7   40   40-79     17-62  (150)
 63 PF13778 DUF4174:  Domain of un  56.0      24 0.00053   24.5   4.1   32   44-75     80-111 (118)
 64 PF06491 Disulph_isomer:  Disul  55.3      22 0.00048   26.3   3.9   36   43-79     96-135 (136)
 65 PF11760 CbiG_N:  Cobalamin syn  54.5      25 0.00054   23.8   3.8   35   43-77     38-74  (84)
 66 PF12681 Glyoxalase_2:  Glyoxal  53.4      14 0.00031   23.1   2.4   16   44-59     93-108 (108)
 67 cd07266 HPCD_N_class_II N-term  52.6      15 0.00033   23.6   2.5   17   44-60    101-117 (121)
 68 PRK11440 putative hydrolase; P  51.8      33 0.00071   24.9   4.4   47   42-88      7-53  (188)
 69 cd04468 S1_eIF5A S1_eIF5A: Euk  51.1      29 0.00063   22.6   3.6   32   44-77     14-45  (69)
 70 PF00578 AhpC-TSA:  AhpC/TSA fa  51.1      13 0.00027   24.2   1.9   16   42-57    108-123 (124)
 71 PRK14018 trifunctional thiored  50.7      33 0.00071   30.1   4.9   37   37-73    134-170 (521)
 72 PRK09381 trxA thioredoxin; Pro  50.7      29 0.00062   22.4   3.6   39   37-76     70-108 (109)
 73 PF02743 Cache_1:  Cache domain  50.5      11 0.00025   23.4   1.6   23   37-59     47-69  (81)
 74 PF01295 Adenylate_cycl:  Adeny  50.5      36 0.00079   30.4   5.2   40   41-80    526-565 (604)
 75 cd07253 Glo_EDI_BRP_like_2 Thi  50.0      19 0.00041   22.7   2.6   18   43-60    107-124 (125)
 76 cd09013 BphC-JF8_N_like N-term  49.3      19  0.0004   23.4   2.6   20   41-60     98-117 (121)
 77 cd07237 BphC1-RGP6_C_like C-te  48.8      17 0.00038   25.4   2.5   22   41-62    111-132 (154)
 78 cd08344 MhqB_like_N N-terminal  47.1      27 0.00058   22.5   3.0   17   45-61     93-109 (112)
 79 cd08362 BphC5-RrK37_N_like N-t  47.0      25 0.00055   22.4   2.9   18   44-61    100-117 (120)
 80 TIGR02740 TraF-like TraF-like   47.0      35 0.00076   26.9   4.2   40   37-76    224-264 (271)
 81 cd07252 BphC1-RGP6_N_like N-te  46.5      23 0.00051   23.1   2.7   18   44-61    100-117 (120)
 82 TIGR01068 thioredoxin thioredo  46.3      40 0.00086   20.7   3.6   38   37-75     63-100 (101)
 83 cd08351 ChaP_like ChaP, an enz  46.1      25 0.00055   23.0   2.8   19   44-62    104-122 (123)
 84 PF09695 YtfJ_HI0045:  Bacteria  46.0      48   0.001   25.1   4.6   32   41-72    123-154 (160)
 85 PF13905 Thioredoxin_8:  Thiore  45.6      11 0.00025   23.6   1.0   19   37-55     77-95  (95)
 86 TIGR01126 pdi_dom protein disu  45.0      32 0.00069   21.3   3.0   37   37-74     64-100 (102)
 87 cd07242 Glo_EDI_BRP_like_6 Thi  44.8      26 0.00056   22.7   2.7   19   42-60    109-127 (128)
 88 cd01014 nicotinamidase_related  44.6      33 0.00071   24.2   3.4   42   46-87      2-43  (155)
 89 cd07238 Glo_EDI_BRP_like_5 Thi  44.6      25 0.00054   22.3   2.6   17   44-60     94-110 (112)
 90 cd07255 Glo_EDI_BRP_like_12 Th  44.1      25 0.00054   22.6   2.5   18   44-61    102-119 (125)
 91 PF03396 Pox_RNA_pol_35:  Poxvi  44.0 1.1E+02  0.0025   25.2   6.7   55   20-80     73-127 (292)
 92 smart00497 IENR1 Intron encode  43.8      24 0.00051   20.2   2.2   34   44-77      2-35  (53)
 93 cd09011 Glo_EDI_BRP_like_23 Th  42.4      29 0.00063   22.5   2.6   17   44-60    102-118 (120)
 94 COG2443 Sss1 Preprotein transl  41.8      36 0.00077   22.2   2.9   27   65-91      4-34  (65)
 95 cd08361 PpCmtC_N N-terminal do  41.8      30 0.00064   23.0   2.7   19   43-61    101-119 (124)
 96 cd07254 Glo_EDI_BRP_like_20 Th  41.6      28 0.00061   22.4   2.5   18   43-60     99-116 (120)
 97 cd07244 FosA FosA, a Fosfomyci  41.6      28 0.00061   22.7   2.5   18   43-60     92-109 (121)
 98 cd03014 PRX_Atyp2cys Peroxired  41.3      27 0.00059   23.6   2.4   17   44-60    111-127 (143)
 99 cd08357 Glo_EDI_BRP_like_18 Th  41.2      33 0.00072   21.9   2.8   17   43-59    107-123 (125)
100 cd08360 MhqB_like_C C-terminal  41.2      28 0.00062   23.3   2.5   19   44-62    103-121 (134)
101 TIGR00068 glyox_I lactoylgluta  40.7      37 0.00079   23.3   3.1   21   44-64    124-144 (150)
102 cd02961 PDI_a_family Protein D  40.6      26 0.00056   21.2   2.1   35   36-70     65-99  (101)
103 PF11141 DUF2914:  Protein of u  40.5      67  0.0014   20.3   4.0   33   22-60     30-62  (66)
104 cd08350 BLMT_like BLMT, a bleo  40.3      32  0.0007   22.3   2.6   17   44-60    102-118 (120)
105 cd08364 FosX FosX, a fosfomyci  40.3      34 0.00074   23.0   2.8   19   43-61    104-122 (131)
106 PRK04101 fosfomycin resistance  40.2      33 0.00073   23.2   2.8   25   42-66    100-124 (139)
107 cd09012 Glo_EDI_BRP_like_24 Th  40.1      31 0.00067   22.5   2.5   15   45-59    108-122 (124)
108 cd03009 TryX_like_TryX_NRX Try  39.9      22 0.00047   23.8   1.8   22   37-58     94-115 (131)
109 cd07267 THT_Oxygenase_N N-term  39.9      32 0.00069   22.2   2.5   17   44-60     93-109 (113)
110 PRK11478 putative lyase; Provi  39.7      34 0.00073   22.2   2.6   18   43-60    111-128 (129)
111 cd07240 ED_TypeI_classII_N N-t  39.3      34 0.00073   21.5   2.5   17   44-60     97-113 (117)
112 cd02956 ybbN ybbN protein fami  39.1      54  0.0012   20.5   3.5   35   37-72     61-95  (96)
113 cd07247 SgaA_N_like N-terminal  38.1      36 0.00078   21.5   2.6   18   42-59     96-113 (114)
114 PF00571 CBS:  CBS domain CBS d  36.7      46 0.00099   18.8   2.6   18   43-60     30-47  (57)
115 cd02949 TRX_NTR TRX domain, no  36.5      51  0.0011   21.0   3.1   35   37-72     62-96  (97)
116 PF02625 XdhC_CoxI:  XdhC and C  36.3      84  0.0018   19.9   4.0   39   42-80     25-63  (71)
117 cd07257 THT_oxygenase_C The C-  36.3      39 0.00084   23.6   2.7   20   43-62    107-126 (153)
118 cd07265 2_3_CTD_N N-terminal d  36.3      39 0.00085   21.8   2.5   17   44-60    102-118 (122)
119 cd02964 TryX_like_family Trypa  36.0      28  0.0006   23.6   1.8   22   37-58     94-115 (132)
120 cd09014 BphC-JF8_C_like C-term  35.9      39 0.00085   24.0   2.7   21   41-61    107-127 (166)
121 cd07264 Glo_EDI_BRP_like_15 Th  35.5      45 0.00097   21.3   2.7   16   45-60    109-124 (125)
122 PF13728 TraF:  F plasmid trans  35.1      53  0.0011   25.1   3.4   35   38-72    179-214 (215)
123 cd08352 Glo_EDI_BRP_like_1 Thi  34.9      42 0.00091   21.1   2.5   17   43-59    108-124 (125)
124 cd07245 Glo_EDI_BRP_like_9 Thi  34.9      37  0.0008   20.7   2.1   14   44-57    100-113 (114)
125 cd02963 TRX_DnaJ TRX domain, D  34.9      59  0.0013   21.5   3.3   37   37-74     74-110 (111)
126 PF08448 PAS_4:  PAS fold;  Int  34.6      43 0.00092   20.4   2.4   16   43-58      5-20  (110)
127 cd08345 Fosfomycin_RP Fosfomyc  34.3      45 0.00097   21.0   2.5   17   44-60     94-110 (113)
128 PF00085 Thioredoxin:  Thioredo  34.3      71  0.0015   19.6   3.4   37   37-74     66-102 (103)
129 cd03008 TryX_like_RdCVF Trypar  34.1      80  0.0017   22.9   4.1   22   37-58    107-128 (146)
130 PF05228 CHASE4:  CHASE4 domain  33.4      71  0.0015   21.9   3.6   37   44-80     51-92  (161)
131 cd02970 PRX_like2 Peroxiredoxi  33.4      42 0.00091   22.4   2.4   18   42-59    129-146 (149)
132 PF00857 Isochorismatase:  Isoc  33.4      29 0.00063   24.2   1.6   46   44-89      1-46  (174)
133 cd08349 BLMA_like Bleomycin bi  33.3      44 0.00096   20.7   2.3   16   44-59     96-111 (112)
134 cd08363 FosB FosB, a fosfomyci  33.2      34 0.00073   23.0   1.9   21   43-63     97-117 (131)
135 cd07243 2_3_CTD_C C-terminal d  33.2      44 0.00096   23.0   2.5   17   44-60    108-124 (143)
136 cd07262 Glo_EDI_BRP_like_19 Th  32.9      49  0.0011   21.3   2.6   16   44-59    107-122 (123)
137 PRK10291 glyoxalase I; Provisi  32.6      42  0.0009   22.1   2.2   20   44-63    103-122 (129)
138 cd07261 Glo_EDI_BRP_like_11 Th  32.4      48   0.001   21.0   2.4   16   44-59     98-113 (114)
139 cd06587 Glo_EDI_BRP_like This   32.3      44 0.00094   19.8   2.1   16   42-57     96-111 (112)
140 KOG0180|consensus               32.1      56  0.0012   25.6   3.1   53   35-90    132-185 (204)
141 smart00594 UAS UAS domain.      31.4      75  0.0016   21.5   3.4   36   37-72     81-121 (122)
142 PF02563 Poly_export:  Polysacc  31.3      45 0.00097   21.4   2.1   35   46-80     32-71  (82)
143 cd08354 Glo_EDI_BRP_like_13 Th  31.1      59  0.0013   20.6   2.7   19   42-60    103-121 (122)
144 PRK02134 hypothetical protein;  31.1      50  0.0011   25.9   2.8   39   47-85     75-119 (249)
145 cd08355 Glo_EDI_BRP_like_14 Th  31.0      57  0.0012   21.0   2.7   16   45-60    106-121 (122)
146 cd07235 MRD Mitomycin C resist  30.8      54  0.0012   21.0   2.5   16   44-59    106-121 (122)
147 PTZ00443 Thioredoxin domain-co  30.6 1.1E+02  0.0024   23.6   4.6   43   37-80    101-143 (224)
148 cd07233 Glyoxalase_I Glyoxalas  30.5      52  0.0011   20.8   2.4   17   42-58    104-120 (121)
149 cd07263 Glo_EDI_BRP_like_16 Th  30.4      59  0.0013   20.1   2.6   17   43-59    102-118 (119)
150 PRK09450 cyaA adenylate cyclas  30.3   1E+02  0.0022   28.8   4.9   38   41-78    750-787 (830)
151 KOG4614|consensus               29.9 1.1E+02  0.0025   25.0   4.6   29   42-70    247-275 (287)
152 KOG0852|consensus               29.7      81  0.0018   24.7   3.6   37   44-80    125-161 (196)
153 TIGR03645 glyox_marine lactoyl  29.6      59  0.0013   23.0   2.7   19   44-62    134-152 (162)
154 PF12791 RsgI_N:  Anti-sigma fa  29.3      60  0.0013   19.3   2.3   19   45-63      7-25  (56)
155 cd07258 PpCmtC_C C-terminal do  29.2      67  0.0015   22.3   2.9   22   41-62     94-115 (141)
156 cd08343 ED_TypeI_classII_C C-t  28.9      72  0.0016   21.1   2.9   18   45-62    101-118 (131)
157 COG0346 GloA Lactoylglutathion  28.7      61  0.0013   19.7   2.4   15   45-59    123-137 (138)
158 TIGR01501 MthylAspMutase methy  28.5      58  0.0013   23.5   2.5   23   55-77    111-133 (134)
159 PF09142 TruB_C:  tRNA Pseudour  28.3      48   0.001   20.4   1.8   19   42-60     25-43  (56)
160 cd07256 HPCD_C_class_II C-term  27.6      61  0.0013   22.8   2.5   18   44-61    106-123 (161)
161 PF10921 DUF2710:  Protein of u  27.5 2.3E+02   0.005   20.1   6.8   46   35-80     43-93  (109)
162 cd07239 BphC5-RK37_C_like C-te  27.5      60  0.0013   22.5   2.4   17   45-61    101-117 (144)
163 PHA02533 17 large terminase pr  27.4 1.3E+02  0.0027   26.4   4.8   39   44-82    331-373 (534)
164 PRK06724 hypothetical protein;  27.2      65  0.0014   22.0   2.5   18   44-61    106-123 (128)
165 PF15384 DUF4610:  Domain of un  27.2 1.3E+02  0.0027   23.7   4.3   65   39-104    84-150 (197)
166 TIGR01570 A_thal_3588 uncharac  27.2      40 0.00086   25.6   1.5   12   43-54    138-149 (161)
167 PF11065 DUF2866:  Protein of u  27.1      76  0.0016   20.8   2.6   28   49-76     27-55  (65)
168 PF04759 DUF617:  Protein of un  26.8      40 0.00087   25.7   1.5   13   43-55    143-155 (166)
169 TIGR01352 tonB_Cterm TonB fami  26.7 1.1E+02  0.0023   18.2   3.2   37   43-79     12-49  (74)
170 cd08359 Glo_EDI_BRP_like_22 Th  26.6      74  0.0016   20.2   2.6   17   43-59    102-118 (119)
171 cd04604 CBS_pair_KpsF_GutQ_ass  26.6      76  0.0016   19.6   2.6   19   43-61     25-43  (114)
172 PF02772 S-AdoMet_synt_M:  S-ad  26.6      38 0.00081   24.3   1.2   18   37-55    103-120 (120)
173 cd02991 UAS_ETEA UAS family, E  26.2 1.5E+02  0.0033   20.3   4.3   39   40-78     74-115 (116)
174 PRK10996 thioredoxin 2; Provis  26.2 1.2E+02  0.0026   21.1   3.8   38   37-75    101-138 (139)
175 COG4191 Signal transduction hi  26.1      65  0.0014   29.1   2.8   56   42-101    99-156 (603)
176 cd08346 PcpA_N_like N-terminal  25.8      75  0.0016   20.0   2.5   17   42-58    109-125 (126)
177 cd02955 SSP411 TRX domain, SSP  25.8      99  0.0022   21.6   3.3   20   40-59     78-97  (124)
178 cd07251 Glo_EDI_BRP_like_10 Th  25.7      76  0.0017   19.9   2.5   17   43-59    103-119 (121)
179 PF14326 DUF4384:  Domain of un  25.6      79  0.0017   20.2   2.6   23   44-66     21-43  (83)
180 PF10084 DUF2322:  Uncharacteri  25.5 1.4E+02  0.0031   21.0   3.9   27   40-66     11-37  (100)
181 PRK05788 cobalamin biosynthesi  25.0 1.4E+02  0.0031   24.2   4.5   35   44-78     79-115 (315)
182 cd04582 CBS_pair_ABC_OpuCA_ass  24.9      86  0.0019   19.2   2.6   18   43-60     24-41  (106)
183 PF14284 PcfJ:  PcfJ-like prote  24.9      73  0.0016   23.4   2.5   66    8-80     95-162 (169)
184 cd07241 Glo_EDI_BRP_like_3 Thi  24.8      75  0.0016   20.0   2.3   13   46-58    112-124 (125)
185 PRK12359 flavodoxin FldB; Prov  24.6 1.9E+02  0.0041   21.5   4.7   44   35-80    121-165 (172)
186 smart00116 CBS Domain in cysta  24.4      65  0.0014   16.1   1.7   17   44-60     24-40  (49)
187 cd02947 TRX_family TRX family;  24.3 1.2E+02  0.0027   17.5   3.1   35   37-72     58-92  (93)
188 smart00732 YqgFc Likely ribonu  24.2 1.2E+02  0.0027   19.0   3.3   37   43-79     12-50  (99)
189 cd08353 Glo_EDI_BRP_like_7 Thi  24.0      85  0.0018   20.8   2.6   17   44-60    124-140 (142)
190 PF01863 DUF45:  Protein of unk  23.8 1.7E+02  0.0037   21.1   4.3   27   49-75      7-33  (205)
191 cd08356 Glo_EDI_BRP_like_17 Th  23.7      84  0.0018   20.4   2.5   16   44-59     97-112 (113)
192 PF13426 PAS_9:  PAS domain; PD  23.5      86  0.0019   18.7   2.3   14   45-58      3-16  (104)
193 PF06057 VirJ:  Bacterial virul  23.5      76  0.0017   24.5   2.5   26   57-82     39-64  (192)
194 TIGR03211 catechol_2_3 catecho  23.4      77  0.0017   24.3   2.5   18   42-59    246-263 (303)
195 PF01939 DUF91:  Protein of unk  23.3 2.4E+02  0.0052   22.3   5.3   39   45-83    139-178 (228)
196 PF07293 DUF1450:  Protein of u  23.2 1.2E+02  0.0025   20.2   3.0   23   52-78     52-74  (78)
197 PF06018 CodY:  CodY GAF-like d  22.7 1.4E+02  0.0029   22.8   3.7   20   44-63     36-55  (177)
198 PRK06777 4-aminobutyrate amino  22.6 1.7E+02  0.0037   24.1   4.5   42   38-79     24-72  (421)
199 COG2088 SpoVG Uncharacterized   22.6 1.4E+02  0.0031   20.8   3.5   33   51-84     53-85  (95)
200 PRK13669 hypothetical protein;  22.3 1.3E+02  0.0028   20.2   3.1   23   52-78     52-74  (78)
201 TIGR02295 HpaD 3,4-dihydroxyph  21.9      87  0.0019   23.7   2.6   20   42-61    237-256 (294)
202 PF00480 ROK:  ROK family;  Int  21.8 1.9E+02  0.0042   20.1   4.2   39   43-81      8-48  (179)
203 PRK07482 hypothetical protein;  21.7 1.9E+02  0.0041   24.3   4.7   41   38-78     34-81  (461)
204 cd07246 Glo_EDI_BRP_like_8 Thi  21.7 1.1E+02  0.0024   19.2   2.7   18   43-60    104-121 (122)
205 PRK12381 bifunctional succinyl  21.7 1.8E+02  0.0039   23.6   4.5   41   38-78     23-70  (406)
206 PF12401 DUF3662:  Protein of u  21.6      37  0.0008   23.7   0.4   28   52-79     13-40  (116)
207 PRK06058 4-aminobutyrate amino  21.3 2.1E+02  0.0046   23.7   4.9   41   38-78     40-87  (443)
208 PF01472 PUA:  PUA domain;  Int  21.3 1.5E+02  0.0033   18.5   3.2   26   45-70     36-61  (74)
209 PRK07483 hypothetical protein;  21.2 2.3E+02   0.005   23.7   5.1   41   38-78     14-61  (443)
210 PF00932 LTD:  Lamin Tail Domai  21.0      82  0.0018   20.8   2.0   21   43-63     93-113 (116)
211 PLN02300 lactoylglutathione ly  20.9      86  0.0019   24.2   2.4   23   44-66    131-153 (286)
212 PF00903 Glyoxalase:  Glyoxalas  20.6      90  0.0019   19.4   2.1   17   42-58    112-128 (128)
213 PRK06173 adenosylmethionine--8  20.3 2.1E+02  0.0047   23.8   4.7   41   38-78     28-75  (429)
214 PF14269 Arylsulfotran_2:  Aryl  20.2 1.2E+02  0.0026   24.3   3.1   28   35-62    154-184 (299)
215 PRK02261 methylaspartate mutas  20.2   1E+02  0.0022   21.9   2.4   23   55-77    113-135 (137)
216 cd01015 CSHase N-carbamoylsarc  20.1   2E+02  0.0043   20.6   4.0   42   46-87      2-44  (179)
217 TIGR03027 pepcterm_export puta  20.1   2E+02  0.0044   20.6   4.1   35   47-81     23-62  (165)
218 cd01668 TGS_RelA_SpoT TGS_RelA  20.1 1.9E+02   0.004   16.4   3.5   27   46-73      1-27  (60)
219 cd02998 PDI_a_ERp38 PDIa famil  20.0   1E+02  0.0022   19.0   2.2   34   37-70     70-103 (105)
220 PRK09792 4-aminobutyrate trans  20.0 2.3E+02   0.005   23.3   4.8   41   38-78     24-71  (421)

No 1  
>KOG2792|consensus
Probab=99.63  E-value=2.3e-16  Score=125.87  Aligned_cols=69  Identities=38%  Similarity=0.599  Sum_probs=61.6

Q ss_pred             cCCccccce--eeEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         11 GGTLPLCRP--LMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        11 ~g~~~~~~~--~~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      -||.+.+++  +.||||+++++.+. ++||+||||+++|||||+|+|+.+|+.+.+++++++.|+..|+.|+
T Consensus       209 TGT~eqvk~vak~yRVYfs~gp~d~-~~DYlVDHSi~mYLidPeg~Fvd~~GrN~~~~~~~~~I~~~v~~y~  279 (280)
T KOG2792|consen  209 TGTTEQVKQVAKKYRVYFSTGPKDE-DQDYLVDHSIFMYLIDPEGEFVDYYGRNYDADELADSILKHVASYR  279 (280)
T ss_pred             cCCHHHHHHHHHHhEEeeccCCCCC-CCCeeeeeeEEEEEECCCcceehhhcccCCHHHHHHHHHHHHHhcc
Confidence            488888887  34999999866444 7899999999999999999999999999999999999999998875


No 2  
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]
Probab=99.17  E-value=3.8e-11  Score=91.41  Aligned_cols=71  Identities=23%  Similarity=0.317  Sum_probs=59.7

Q ss_pred             eeeecCCccccce--eeEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586          7 LHFIGGTLPLCRP--LMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus         7 ~~~~~g~~~~~~~--~~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      .+++.|+.+.+..  +.|+|++++.+.+++ ++|+||||+.+||+||+|++...+....+|++|+++|+.++++
T Consensus       134 ~~~ltg~~~~~~~~~k~~~V~~~~v~~~~~-~~y~~~Hs~~~~lid~~G~~~~~~~~~~~~~~i~~~l~~l~~~  206 (207)
T COG1999         134 WIGLTGTPEQIEEVAKAYGVFYSKVPLDDS-QNYTIDHSAGFYLIDADGRFLGTYDYGEPPEEIAADLKKLLKE  206 (207)
T ss_pred             eeeeeCCHHHHHHHHHHhcceeeecccCCC-CCceeeeeeEEEEECCCCeEEEEecCCCChHHHHHHHHHHhhc
Confidence            4566777666666  459999876665543 6899999999999999999999999999999999999998854


No 3  
>PF02630 SCO1-SenC:  SCO1/SenC;  InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems. In yeast the SCO1 protein is specifically required for a post-translational step in the accumulation of subunits 1 and 2 of cytochrome c oxidase (COXI and COX-II) []. It is a mitochondrion-associated cytochrome c oxidase assembly factor. The purple nonsulphur photosynthetic eubacterium Rhodobacter capsulatus is a versatile organism that can obtain cellular energy by several means, including the capture of light energy for photosynthesis as well as the use of light-independent respiration, in which molecular oxygen serves as a terminal electron acceptor. The SenC protein is required for optimal cytochrome c oxidase activity in aerobically grown R. capsulatus cells and is involved in the induction of structural polypeptides of the light-harvesting and reaction centre complexes [].; PDB: 2K6V_A 3ME8_A 3ME7_A 2GT6_A 2GQL_A 2GQK_A 2GGT_B 1WP0_C 2HRN_A 2GQM_A ....
Probab=98.55  E-value=2e-08  Score=74.00  Aligned_cols=52  Identities=21%  Similarity=0.264  Sum_probs=40.0

Q ss_pred             ecCCccccce--eeEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecC
Q psy17586         10 IGGTLPLCRP--LMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        10 ~~g~~~~~~~--~~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~   61 (106)
                      .-|+.+.+++  ..|++++.+...+.++++|.|+||+.+||+||+||++..|..
T Consensus       120 ltg~~~~i~~l~~~~~v~~~~~~~~~~~~~~~i~Hs~~~~Lidp~G~i~~~y~~  173 (174)
T PF02630_consen  120 LTGSREEIEELAKQFGVYYEKVPEDKPEGDYQIDHSAFIYLIDPDGRIRAIYNL  173 (174)
T ss_dssp             EEEEHHHHHHHHHHCTHCEEEEESSSTTSCEEEEESSEEEEE-TTSEEEEEECS
T ss_pred             eEeCHHHHHHHHHHHHhhhcccccccCCCCceEecccEEEEEcCCCcEEEEEcc
Confidence            3455555555  238888887776666778999999999999999999999864


No 4  
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7. This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Probab=97.25  E-value=0.00025  Score=50.24  Aligned_cols=40  Identities=30%  Similarity=0.535  Sum_probs=35.6

Q ss_pred             ceeEeccee-------EEEEcCCCcEEEeecCCCCHHHHHHHHHHHH
Q psy17586         37 WFQVDHTII-------MYLIDPEGLFVDYYGQNKKPEEVSNSIIVNM   76 (106)
Q Consensus        37 dY~VDHSa~-------iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l   76 (106)
                      +|.++|+..       +||||++|+++..+....++++|.++|+.+|
T Consensus       107 ~~~~~~~~~~p~~~~~tflID~~G~v~~~~~g~~~~~~l~~~i~~l~  153 (153)
T TIGR02540       107 RFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPVEEIRPEITALV  153 (153)
T ss_pred             HHHHhcCCCCCCCccEEEEEcCCCcEEEEECCCCCHHHHHHHHHHhC
Confidence            588899765       9999999999999999999999999888764


No 5  
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properti
Probab=96.42  E-value=0.0049  Score=42.00  Aligned_cols=38  Identities=32%  Similarity=0.517  Sum_probs=29.7

Q ss_pred             eEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeec
Q psy17586         21 MYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        21 ~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~   60 (106)
                      .|+++..+...+  ..+|.+.|+..+|||||+|+++..+.
T Consensus       104 ~~g~~~~~~~~~--~~~~~~~~~~~~~lid~~G~i~~~~~  141 (142)
T cd02968         104 AFGVYYEKVPED--DGDYLVDHSAAIYLVDPDGKLVRYYG  141 (142)
T ss_pred             HhcEEEEecCCC--CCceeEeccceEEEECCCCCEEEeec
Confidence            388877654322  24688999999999999999998875


No 6  
>PLN02399 phospholipid hydroperoxide glutathione peroxidase
Probab=95.01  E-value=0.041  Score=43.09  Aligned_cols=38  Identities=18%  Similarity=0.374  Sum_probs=33.3

Q ss_pred             EecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         40 VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      |-|--..||||++|+++..+....++++|.+.|+.+|+
T Consensus       198 i~~~PttfLIDk~GkVv~~~~G~~~~~~le~~I~~lL~  235 (236)
T PLN02399        198 IKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLLA  235 (236)
T ss_pred             cccCceEEEECCCCcEEEEECCCCCHHHHHHHHHHHhc
Confidence            45556799999999999999999999999999998874


No 7  
>PLN02412 probable glutathione peroxidase
Probab=94.98  E-value=0.06  Score=39.07  Aligned_cols=34  Identities=21%  Similarity=0.373  Sum_probs=30.8

Q ss_pred             eEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         45 IMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      ..||+|++|+++..+....+++++.+.|+.+|.+
T Consensus       133 ~tflId~~G~vv~~~~g~~~~~~l~~~i~~~l~~  166 (167)
T PLN02412        133 TKFLVSKEGKVVQRYAPTTSPLKIEKDIQNLLGQ  166 (167)
T ss_pred             eeEEECCCCcEEEEECCCCCHHHHHHHHHHHHhh
Confidence            5899999999999999999999999999988753


No 8  
>PTZ00056 glutathione peroxidase; Provisional
Probab=94.86  E-value=0.082  Score=39.73  Aligned_cols=39  Identities=18%  Similarity=0.305  Sum_probs=32.9

Q ss_pred             ecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHH
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~   79 (106)
                      .+....||+|++|+++..+....+++++.+.|..++++.
T Consensus       143 ~~~~~tflID~~G~iv~~~~g~~~~~~l~~~I~~ll~~~  181 (199)
T PTZ00056        143 GWNFGKFLVNKSGNVVAYFSPRTEPLELEKKIAELLGVK  181 (199)
T ss_pred             CCCCEEEEECCCCcEEEEeCCCCCHHHHHHHHHHHHHHH
Confidence            343359999999999999988889999999999999543


No 9  
>PTZ00256 glutathione peroxidase; Provisional
Probab=94.81  E-value=0.055  Score=39.72  Aligned_cols=39  Identities=26%  Similarity=0.457  Sum_probs=33.3

Q ss_pred             eEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         39 QVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        39 ~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .+.++...||+|++|+++..+....+++++.+.|..+++
T Consensus       144 ~iP~~~~tflID~~G~Iv~~~~g~~~~~~l~~~I~~ll~  182 (183)
T PTZ00256        144 QIPWNFAKFLIDGQGKVVKYFSPKVNPNEMIQDIEKLLN  182 (183)
T ss_pred             ccCcceEEEEECCCCCEEEEECCCCCHHHHHHHHHHHhc
Confidence            456666789999999999999888889999888888774


No 10 
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones]
Probab=94.74  E-value=0.041  Score=41.66  Aligned_cols=32  Identities=25%  Similarity=0.485  Sum_probs=29.7

Q ss_pred             EEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         46 MYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        46 iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      =||+|++|+.+..|.+.+.|+++..+|+.+|.
T Consensus       130 KFLvdr~G~VV~Rf~p~t~P~d~~~~Ie~lL~  161 (162)
T COG0386         130 KFLVDRDGNVVKRFSPKTKPEDIELAIEKLLA  161 (162)
T ss_pred             EEEEcCCCcEEEeeCCCCChhhHHHHHHHHhc
Confidence            59999999999999999999999999988874


No 11 
>PRK10606 btuE putative glutathione peroxidase; Provisional
Probab=94.60  E-value=0.039  Score=41.50  Aligned_cols=31  Identities=23%  Similarity=0.553  Sum_probs=28.4

Q ss_pred             EEEEcCCCcEEEeecCCCCHHH--HHHHHHHHH
Q psy17586         46 MYLIDPEGLFVDYYGQNKKPEE--VSNSIIVNM   76 (106)
Q Consensus        46 iYLmDPdGrfv~~f~~~~spee--iAe~Ir~~l   76 (106)
                      -||+|++|+.+..|.+...|++  |.+.|.++|
T Consensus       149 KFLv~~~G~vv~r~~~~~~p~~~~i~~~i~~~l  181 (183)
T PRK10606        149 KFLVGRDGQVIQRFSPDMTPEDPIVMESIKLAL  181 (183)
T ss_pred             EEEECCCCcEEEEECCCCCCCHHHHHHHHHHHh
Confidence            7999999999999999999987  888888776


No 12 
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.
Probab=93.18  E-value=0.12  Score=36.49  Aligned_cols=32  Identities=22%  Similarity=0.538  Sum_probs=26.3

Q ss_pred             EecceeEEEEcCCCcEEEeecCCCCHHHHHHH
Q psy17586         40 VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNS   71 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~   71 (106)
                      +-|...+||+|++|+++..+....+++++.+.
T Consensus       120 ~~~~~ttflId~~G~i~~~~~G~~~~~~l~~~  151 (152)
T cd00340         120 IKWNFTKFLVDRDGEVVKRFAPTTDPEELEKD  151 (152)
T ss_pred             cccccEEEEECCCCcEEEEECCCCCHHHHHhc
Confidence            44555799999999999999988888877654


No 13 
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional
Probab=92.81  E-value=0.29  Score=35.87  Aligned_cols=43  Identities=21%  Similarity=0.147  Sum_probs=37.5

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~   79 (106)
                      .|-|...-.+||+|++|+++....-..+.+++-+.|+.++++.
T Consensus       137 ~~gv~~~P~t~vid~~G~i~~~~~G~~~~~~l~~~i~~~~~~~  179 (185)
T PRK15412        137 DLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWESEIKPLWEKY  179 (185)
T ss_pred             hcCCCcCCeEEEECCCceEEEEEecCCCHHHHHHHHHHHHHHH
Confidence            5778888899999999999999888888889888888888655


No 14 
>PRK03147 thiol-disulfide oxidoreductase; Provisional
Probab=92.69  E-value=0.24  Score=34.72  Aligned_cols=38  Identities=18%  Similarity=0.231  Sum_probs=31.5

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIV   74 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~   74 (106)
                      .|-|.+...+||+|++|+.+..+....+++++.+.+..
T Consensus       133 ~~~v~~~P~~~lid~~g~i~~~~~g~~~~~~l~~~l~~  170 (173)
T PRK03147        133 AYGVGPLPTTFLIDKDGKVVKVITGEMTEEQLEEYLEK  170 (173)
T ss_pred             HcCCCCcCeEEEECCCCcEEEEEeCCCCHHHHHHHHHH
Confidence            47788899999999999999888888888877765543


No 15 
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily. Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins.
Probab=92.08  E-value=0.29  Score=35.36  Aligned_cols=41  Identities=15%  Similarity=0.105  Sum_probs=34.8

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .|.|-....+|++|++|+.+..+.-..+.+++.+.|.++|.
T Consensus       132 ~~~v~~~P~~~~id~~G~i~~~~~G~~~~~~l~~~l~~~~~  172 (173)
T TIGR00385       132 DLGVYGAPETFLVDGNGVILYRHAGPLNNEVWTEGFLPAME  172 (173)
T ss_pred             hcCCeeCCeEEEEcCCceEEEEEeccCCHHHHHHHHHHHhh
Confidence            46677778899999999999888777889999998888874


No 16 
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides. The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric 
Probab=90.96  E-value=0.54  Score=33.77  Aligned_cols=32  Identities=19%  Similarity=0.256  Sum_probs=23.7

Q ss_pred             eeEEEEcCCCcEEEee----cCCCCHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYY----GQNKKPEEVSNSIIVN   75 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f----~~~~speeiAe~Ir~~   75 (106)
                      ..+||+||+|+++..+    +...+.+++.+.|+.+
T Consensus       121 p~~~lID~~G~I~~~~~~~~~~~~~~~~il~~l~~~  156 (173)
T cd03015         121 RGTFIIDPEGIIRHITVNDLPVGRSVDETLRVLDAL  156 (173)
T ss_pred             eEEEEECCCCeEEEEEecCCCCCCCHHHHHHHHHHh
Confidence            3689999999999999    4444566666666553


No 17 
>KOG1651|consensus
Probab=89.81  E-value=0.32  Score=37.12  Aligned_cols=33  Identities=18%  Similarity=0.412  Sum_probs=29.8

Q ss_pred             eEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         45 IMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .=||+||+|..+..|.+.++|.++..+|..+|.
T Consensus       138 ~KFLVd~~G~vv~Ry~ptt~p~~~~~dIe~lL~  170 (171)
T KOG1651|consen  138 TKFLVDKDGHVVKRFSPTTSPLDIEKDIEKLLA  170 (171)
T ss_pred             EEEeECCCCcEEEeeCCCCCccccchhHHHHhc
Confidence            359999999999999999999999999888874


No 18 
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed
Probab=89.09  E-value=0.84  Score=31.78  Aligned_cols=30  Identities=23%  Similarity=0.402  Sum_probs=21.2

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEE   67 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~spee   67 (106)
                      .|...|. .+||+||+|+++..+.....++.
T Consensus       115 ~~~~~~~-~~~lid~~G~i~~~~~g~~~~~~  144 (154)
T PRK09437        115 TYDGIHR-ISFLIDADGKIEHVFDKFKTSNH  144 (154)
T ss_pred             cccCcce-EEEEECCCCEEEEEEcCCCcchh
Confidence            3544565 46999999999999875444443


No 19 
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.
Probab=88.63  E-value=0.76  Score=32.72  Aligned_cols=42  Identities=14%  Similarity=0.175  Sum_probs=30.1

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCC---------CCHHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQN---------KKPEEVSNSIIVNMMK   78 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~---------~speeiAe~Ir~~l~~   78 (106)
                      .|-|.+...+||+||+|+++.....+         .+.+++.+.|+.++..
T Consensus       104 ~~~v~~~P~~~lid~~G~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~  154 (171)
T cd02969         104 AYGAACTPDFFLFDPDGKLVYRGRIDDSRPGNDPPVTGRDLRAALDALLAG  154 (171)
T ss_pred             HcCCCcCCcEEEECCCCeEEEeecccCCcccccccccHHHHHHHHHHHHcC
Confidence            47788889999999999988664322         2346677777776643


No 20 
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus. It is found only in oxygenic photosynthetic organisms. TRX is a small enzyme that participate in redox reactions, via the reversible oxidation of an active site dithiol present in a CXXC motif. Disruption of the txlA gene suggests that the protein is involved in the redox regulation  of the structure and function of photosynthetic apparatus. The plant homolog (designated as HCF164) is localized in the chloroplast and is involved in the assembly of the cytochrome b6f complex, which takes a central position in photosynthetic electron transport.
Probab=88.04  E-value=1.3  Score=31.40  Aligned_cols=42  Identities=12%  Similarity=0.018  Sum_probs=34.4

Q ss_pred             CceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         36 FWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        36 ~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      ..|-|..--.++++|++|+.+..+.-..+.+++.+.|+.++.
T Consensus        70 ~~~~V~~iPt~v~~~~~G~~v~~~~G~~~~~~l~~~l~~l~~  111 (142)
T cd02950          70 DRYRVDGIPHFVFLDREGNEEGQSIGLQPKQVLAQNLDALVA  111 (142)
T ss_pred             HHcCCCCCCEEEEECCCCCEEEEEeCCCCHHHHHHHHHHHHc
Confidence            358899999999999999999888766777788777777664


No 21 
>cd02958 UAS UAS family; UAS is a domain of unknown function. Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), 
Probab=87.99  E-value=1.2  Score=29.87  Aligned_cols=42  Identities=24%  Similarity=0.426  Sum_probs=36.6

Q ss_pred             ceeEecceeEEEEcC-CCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDP-EGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        37 dY~VDHSa~iYLmDP-dGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      .|.+.=.-.++++|| +|+.+..+.-..+++++...|+.++..
T Consensus        71 ~~~~~~~P~~~~i~~~~g~~l~~~~G~~~~~~f~~~L~~~~~~  113 (114)
T cd02958          71 SYKVDKYPHIAIIDPRTGEVLKVWSGNITPEDLLSQLIEFLEE  113 (114)
T ss_pred             HhCccCCCeEEEEeCccCcEeEEEcCCCCHHHHHHHHHHHHhc
Confidence            367777889999999 899999999999999999999887753


No 22 
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of  thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein,  Dot5p (for disrupter of telomere silencing protein 5), w
Probab=87.48  E-value=0.68  Score=31.23  Aligned_cols=29  Identities=24%  Similarity=0.445  Sum_probs=22.4

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~I   72 (106)
                      ..+||+|++|+++..+......+.+.+.+
T Consensus       111 p~~~lid~~G~v~~~~~g~~~~~~~~~~~  139 (140)
T cd03017         111 RSTFLIDPDGKIVKVWRKVKPKGHAEEVL  139 (140)
T ss_pred             eeEEEECCCCEEEEEEecCCccchHHHHh
Confidence            46899999999999997666556665543


No 23 
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes an
Probab=87.42  E-value=0.94  Score=33.83  Aligned_cols=30  Identities=13%  Similarity=0.166  Sum_probs=20.8

Q ss_pred             eEEEEcCCCcEEEeecCCC----CHHHHHHHHHH
Q psy17586         45 IMYLIDPEGLFVDYYGQNK----KPEEVSNSIIV   74 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~----speeiAe~Ir~   74 (106)
                      .+|||||+|+++..+....    +.+++...|..
T Consensus       119 ~~fiID~~G~I~~~~~~~~~~gr~~~ell~~l~~  152 (203)
T cd03016         119 AVFIIDPDKKIRLILYYPATTGRNFDEILRVVDA  152 (203)
T ss_pred             EEEEECCCCeEEEEEecCCCCCCCHHHHHHHHHH
Confidence            5899999999998875543    34555554443


No 24 
>TIGR03137 AhpC peroxiredoxin. This gene contains two invariant cysteine residues, one near the N-terminus and one near the C-terminus, each followed immediately by a proline residue.
Probab=87.18  E-value=0.77  Score=33.81  Aligned_cols=37  Identities=14%  Similarity=0.192  Sum_probs=24.6

Q ss_pred             cceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      +...+||+|++|+++..+.....++.-++.|.+.|++
T Consensus       118 ~~p~tfiID~~G~I~~~~~~~~~~~~~~~~ll~~l~~  154 (187)
T TIGR03137       118 ADRGTFVIDPEGVIQAVEITDNGIGRDASELLRKIKA  154 (187)
T ss_pred             eeeEEEEECCCCEEEEEEEeCCCCCCCHHHHHHHHHH
Confidence            4567999999999999886544444344444444433


No 25 
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif. The Salmonella typhimurium ScsD is a thioredoxin-like protein which confers copper tolerance to copper-sensitive mutants of E. coli. MtbDsbE has been characterized as an oxidase in vitro, catalyzing the disulfide bond formation of substrates like hirudin. The reduced form of MtbDsbE is more stable than its oxidized form, consistent with an oxidase function. This is in contrast to the function of DsbE from gram-negative bacteria which is a specific reductase of apocytochrome c.
Probab=86.59  E-value=1  Score=29.78  Aligned_cols=34  Identities=18%  Similarity=0.130  Sum_probs=28.9

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNS   71 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~   71 (106)
                      .|.|.+...+||+|++| .+..+..-.+++++.++
T Consensus        88 ~~~i~~~P~~~vid~~g-i~~~~~g~~~~~~~~~~  121 (123)
T cd03011          88 RWGVSVTPAIVIVDPGG-IVFVTTGVTSEWGLRLR  121 (123)
T ss_pred             hCCCCcccEEEEEcCCC-eEEEEeccCCHHHHHhh
Confidence            58899999999999999 77777777788888765


No 26 
>PF02824 TGS:  TGS domain;  InterPro: IPR004095  The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) []. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).  TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role []. ; PDB: 1WXQ_A 1NYR_B 1NYQ_B 2KMM_A 1WWT_A 1TKE_A 1TKG_A 1TJE_A 1QF6_A 1TKY_A ....
Probab=85.54  E-value=1.8  Score=26.83  Aligned_cols=31  Identities=26%  Similarity=0.419  Sum_probs=26.2

Q ss_pred             eEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         45 IMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      .+||  |+|+.+. |+.+.++.++|..|..-+.+
T Consensus         2 ~v~l--pdG~~~~-~~~g~T~~d~A~~I~~~l~~   32 (60)
T PF02824_consen    2 RVYL--PDGSIKE-LPEGSTVLDVAYSIHSSLAK   32 (60)
T ss_dssp             EEEE--TTSCEEE-EETTBBHHHHHHHHSHHHHH
T ss_pred             EEEC--CCCCeee-CCCCCCHHHHHHHHCHHHHh
Confidence            4566  9999888 79999999999999887754


No 27 
>cd02966 TlpA_like_family TlpA-like family; composed of  TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.
Probab=85.04  E-value=0.88  Score=28.32  Aligned_cols=25  Identities=20%  Similarity=0.125  Sum_probs=21.4

Q ss_pred             CceeEecceeEEEEcCCCcEEEeec
Q psy17586         36 FWFQVDHTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        36 ~dY~VDHSa~iYLmDPdGrfv~~f~   60 (106)
                      ..|-+.+...+||+||+|+++..+.
T Consensus        91 ~~~~~~~~P~~~l~d~~g~v~~~~~  115 (116)
T cd02966          91 KAYGVRGLPTTFLIDRDGRIRARHV  115 (116)
T ss_pred             HhcCcCccceEEEECCCCcEEEEec
Confidence            4588889999999999999987653


No 28 
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626. This model represents sequences from gamma proteobacteria that are related to the E. coli protein, YtfJ.
Probab=85.00  E-value=2.2  Score=32.33  Aligned_cols=40  Identities=10%  Similarity=0.117  Sum_probs=29.9

Q ss_pred             ceeEecc-eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         37 WFQVDHT-IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        37 dY~VDHS-a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .|-|.-- ..+||+|++|+.+....-..+.+++.+ +..+|+
T Consensus       140 ~~gv~~~P~T~fVIDk~GkVv~~~~G~l~~ee~e~-~~~li~  180 (184)
T TIGR01626       140 AWQLNSEDSAIIVLDKTGKVKFVKEGALSDSDIQT-VISLVN  180 (184)
T ss_pred             hcCCCCCCceEEEECCCCcEEEEEeCCCCHHHHHH-HHHHHH
Confidence            4667665 445999999999999888888887755 555553


No 29 
>PTZ00253 tryparedoxin peroxidase; Provisional
Probab=84.58  E-value=1.4  Score=32.62  Aligned_cols=37  Identities=11%  Similarity=0.275  Sum_probs=23.6

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      ..+|||||+|+++..+....+...-++.+.+.|++.+
T Consensus       128 r~~fiID~~G~i~~~~~~~~~~~r~~~e~l~~l~a~~  164 (199)
T PTZ00253        128 RGLFIIDPKGMLRQITVNDMPVGRNVEEVLRLLEAFQ  164 (199)
T ss_pred             EEEEEECCCCEEEEEEecCCCCCCCHHHHHHHHHhhh
Confidence            5789999999999887554444433344444444443


No 30 
>PRK13599 putative peroxiredoxin; Provisional
Probab=84.25  E-value=1.5  Score=33.55  Aligned_cols=32  Identities=9%  Similarity=0.183  Sum_probs=22.6

Q ss_pred             ceeEEEEcCCCcEEEeecCCC----CHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK----KPEEVSNSIIV   74 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~----speeiAe~Ir~   74 (106)
                      .-.+|||||+|+++..+-+..    +.+++...|..
T Consensus       119 ~R~tfIID~dG~Ir~~~~~p~~~gr~~~eilr~l~~  154 (215)
T PRK13599        119 VRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKA  154 (215)
T ss_pred             eeEEEEECCCCEEEEEEEcCCCCCCCHHHHHHHHHH
Confidence            478899999999998874333    35566655554


No 31 
>PRK13190 putative peroxiredoxin; Provisional
Probab=84.21  E-value=2.9  Score=31.29  Aligned_cols=34  Identities=12%  Similarity=0.135  Sum_probs=24.7

Q ss_pred             ceeEEEEcCCCcEEEee----cCCCCHHHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYY----GQNKKPEEVSNSIIVNM   76 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f----~~~~speeiAe~Ir~~l   76 (106)
                      --.+|||||+|+++...    .-+.+.+++...|..+.
T Consensus       117 ~p~~fiId~~G~I~~~~~~~~~~gr~~~ellr~l~~l~  154 (202)
T PRK13190        117 VRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRITKALQ  154 (202)
T ss_pred             EeEEEEECCCCEEEEEEEeCCCCCCCHHHHHHHHHHhh
Confidence            36789999999998766    44456677776666554


No 32 
>PF13098 Thioredoxin_2:  Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A ....
Probab=83.98  E-value=1.5  Score=28.59  Aligned_cols=36  Identities=22%  Similarity=0.310  Sum_probs=26.5

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~I   72 (106)
                      .|-|.=+-.++++|++|+.+..+.--.+++++.+.|
T Consensus        77 ~~~v~gtPt~~~~d~~G~~v~~~~G~~~~~~l~~~L  112 (112)
T PF13098_consen   77 RYGVNGTPTIVFLDKDGKIVYRIPGYLSPEELLKML  112 (112)
T ss_dssp             HTT--SSSEEEECTTTSCEEEEEESS--HHHHHHHH
T ss_pred             HcCCCccCEEEEEcCCCCEEEEecCCCCHHHHHhhC
Confidence            366888899999999999998888777888887643


No 33 
>PRK13189 peroxiredoxin; Provisional
Probab=83.42  E-value=1.7  Score=33.21  Aligned_cols=31  Identities=16%  Similarity=0.336  Sum_probs=20.5

Q ss_pred             eeEEEEcCCCcEEEeecCCC----CHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNK----KPEEVSNSIIV   74 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~----speeiAe~Ir~   74 (106)
                      -.+|||||+|+++...-...    +.+++...|..
T Consensus       127 r~tfIID~~G~Ir~~~~~~~~~gr~~~eilr~l~a  161 (222)
T PRK13189        127 RAVFIIDPKGIIRAILYYPQEVGRNMDEILRLVKA  161 (222)
T ss_pred             eEEEEECCCCeEEEEEecCCCCCCCHHHHHHHHHH
Confidence            35899999999987765433    34555544443


No 34 
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional
Probab=81.21  E-value=1.8  Score=32.40  Aligned_cols=29  Identities=14%  Similarity=0.355  Sum_probs=20.6

Q ss_pred             eeEEEEcCCCcEEEeecCCC----CHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNK----KPEEVSNSI   72 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~----speeiAe~I   72 (106)
                      -.+|||||+|+.+..+-...    +.+++.+.|
T Consensus       120 r~tfIID~~G~I~~~~~~~~~~~~~~~eil~~l  152 (187)
T PRK10382        120 RATFVVDPQGIIQAIEVTAEGIGRDASDLLRKI  152 (187)
T ss_pred             eEEEEECCCCEEEEEEEeCCCCCCCHHHHHHHH
Confidence            77899999999988875443    445555444


No 35 
>PRK15000 peroxidase; Provisional
Probab=80.19  E-value=2.3  Score=31.95  Aligned_cols=32  Identities=16%  Similarity=0.151  Sum_probs=22.1

Q ss_pred             ceeEEEEcCCCcEEEeecCCC----CHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK----KPEEVSNSIIV   74 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~----speeiAe~Ir~   74 (106)
                      --.+|||||+|+++..+....    +.+++...|+.
T Consensus       125 ~r~tfiID~~G~I~~~~~~~~~~gr~~~eilr~l~a  160 (200)
T PRK15000        125 LRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDA  160 (200)
T ss_pred             EeEEEEECCCCEEEEEEecCCCCCCCHHHHHHHHHH
Confidence            578899999999988765544    44555544443


No 36 
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation. Sulfur bacteria oxidize sulfur compounds to provide reducing equivalents for carbon dioxide fixation during autotrophic growth and the respiratory electron transport chain. It is unclear what the role of SoxW is, since it has been found to be dispensable in the oxidation of thiosulfate to sulfate. SoxW is specifically kept in the reduced state by SoxV, which is essential in thiosulfate oxidation.
Probab=80.00  E-value=5.3  Score=26.78  Aligned_cols=41  Identities=20%  Similarity=0.208  Sum_probs=33.5

Q ss_pred             ceeEecceeEEEEcCC-CcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPE-GLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        37 dY~VDHSa~iYLmDPd-Grfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .|-|.-.-.++++|++ |+.+..+.-..+.+++.+.|..++.
T Consensus        79 ~~~v~~~Pt~~~~~~~gg~~~~~~~G~~~~~~~~~~l~~~~~  120 (125)
T cd02951          79 KYRVRFTPTVIFLDPEGGKEIARLPGYLPPDEFLAYLEYVQE  120 (125)
T ss_pred             HcCCccccEEEEEcCCCCceeEEecCCCCHHHHHHHHHHHHh
Confidence            4778888999999999 8998887766778888877777663


No 37 
>PF05176 ATP-synt_10:  ATP10 protein;  InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex. A yeast nuclear gene (ATP10) encodes a product that is essential for the assembly of a functional mitochondrial ATPase complex. Mutations in ATP10 induce a loss of rutamycin sensitivity in the mitochondrial ATPase, but do not affect the respiratory enzymes. ATP10 has an Mr of 30,293 and its primary structure is not related to any known subunit of the yeast or mammalian mitochondrial ATPase complexes. ATP10 is associated with the mitochondrial membrane. It is suggested that the ATP10 product is not a subunit of the ATPase complex but rather a protein required for the assembly of the F0 sector of the complex [].; GO: 0033615 mitochondrial proton-transporting ATP synthase complex assembly, 0005743 mitochondrial inner membrane
Probab=79.54  E-value=3.7  Score=32.54  Aligned_cols=31  Identities=26%  Similarity=0.308  Sum_probs=22.4

Q ss_pred             EecceeEEEEcCCCcEEEeecCCCCHHHHHH
Q psy17586         40 VDHTIIMYLIDPEGLFVDYYGQNKKPEEVSN   70 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f~~~~speeiAe   70 (106)
                      =..+..+||+|++||++=.=.-..+++|+..
T Consensus       214 N~~~GYvyLVD~~grIRWagsG~At~~E~~~  244 (252)
T PF05176_consen  214 NSYVGYVYLVDPNGRIRWAGSGPATPEELES  244 (252)
T ss_pred             CCCcCeEEEECCCCeEEeCccCCCCHHHHHH
Confidence            3468899999999997766444446776544


No 38 
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=77.99  E-value=3.4  Score=30.89  Aligned_cols=26  Identities=19%  Similarity=0.353  Sum_probs=19.3

Q ss_pred             EecceeEEEEcCCCcEEEeecCCCCHH
Q psy17586         40 VDHTIIMYLIDPEGLFVDYYGQNKKPE   66 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f~~~~spe   66 (106)
                      +-.--.+||||++|+++..+ ....++
T Consensus       117 ~~~~R~TfvId~dG~I~~~~-~~v~~~  142 (157)
T COG1225         117 MGIERSTFVIDPDGKIRYVW-RKVKVK  142 (157)
T ss_pred             ccccceEEEECCCCeEEEEe-cCCCCc
Confidence            34556789999999999999 444433


No 39 
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=77.49  E-value=4  Score=29.72  Aligned_cols=37  Identities=11%  Similarity=-0.029  Sum_probs=26.7

Q ss_pred             eEecceeEEEEcCCCcEEE-eecCCCCHHHHHHHHHHH
Q psy17586         39 QVDHTIIMYLIDPEGLFVD-YYGQNKKPEEVSNSIIVN   75 (106)
Q Consensus        39 ~VDHSa~iYLmDPdGrfv~-~f~~~~speeiAe~Ir~~   75 (106)
                      .|...-.+||+|++|+.+. ...-..+.+++.+.|..+
T Consensus       115 ~v~~iPTt~LID~~G~~i~~~~~G~~s~~~l~~~I~~l  152 (153)
T TIGR02738       115 RPVVTPATFLVNVNTRKAYPVLQGAVDEAELANRMDEI  152 (153)
T ss_pred             CCCCCCeEEEEeCCCCEEEEEeecccCHHHHHHHHHHh
Confidence            5678889999999988544 444455677777776654


No 40 
>PRK13728 conjugal transfer protein TrbB; Provisional
Probab=77.04  E-value=6.1  Score=30.01  Aligned_cols=38  Identities=8%  Similarity=0.001  Sum_probs=30.2

Q ss_pred             ecceeEEEEcCCCcEE-EeecCCCCHHHHHHHHHHHHHH
Q psy17586         41 DHTIIMYLIDPEGLFV-DYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv-~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      .+.-.+||+|++|+.+ ..+.-..+.+++.+.|..++..
T Consensus       135 ~~iPttfLId~~G~i~~~~~~G~~~~~~L~~~I~~ll~~  173 (181)
T PRK13728        135 VATPTTFLVNVNTLEALPLLQGATDAAGFMARMDTVLQM  173 (181)
T ss_pred             CCCCeEEEEeCCCcEEEEEEECCCCHHHHHHHHHHHHhh
Confidence            5778899999999986 3455566788888888888865


No 41 
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=75.14  E-value=4.5  Score=31.44  Aligned_cols=46  Identities=17%  Similarity=0.232  Sum_probs=28.9

Q ss_pred             eeEEEEcCCCcEEEeecCCCC----HHHHHHHHHHHH--HHHHhhhcCCcch
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKK----PEEVSNSIIVNM--MKYENLKKKSWFE   89 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~s----peeiAe~Ir~~l--~~~~~~~~~~~~~   89 (106)
                      -.+|||||+|..+....+..+    .+++...|..+-  +++.+.---.|-.
T Consensus       125 R~~FIIDp~g~ir~~~v~~~~iGRn~dEilR~idAlq~~~~hg~vcPanW~~  176 (194)
T COG0450         125 RGTFIIDPDGVIRHILVNPLTIGRNVDEILRVIDALQFVAKHGEVCPANWKP  176 (194)
T ss_pred             eEEEEECCCCeEEEEEEecCCCCcCHHHHHHHHHHHHHHHHhCCCccCCCCC
Confidence            368999999998888866654    566665555432  3334444445543


No 42 
>PRK13191 putative peroxiredoxin; Provisional
Probab=74.92  E-value=3.9  Score=31.15  Aligned_cols=31  Identities=13%  Similarity=0.195  Sum_probs=21.7

Q ss_pred             eeEEEEcCCCcEEEeecCC----CCHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQN----KKPEEVSNSIIV   74 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~----~speeiAe~Ir~   74 (106)
                      -.+|||||+|+++..+-++    .+.+++...|..
T Consensus       125 r~tfIID~~G~Ir~~~~~~~~~gr~~~eilr~l~a  159 (215)
T PRK13191        125 RAVFIVDDKGTVRLILYYPMEIGRNIDEILRAIRA  159 (215)
T ss_pred             EEEEEECCCCEEEEEEecCCCCCCCHHHHHHHHHH
Confidence            5789999999999876333    345666655554


No 43 
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=74.54  E-value=2.9  Score=28.24  Aligned_cols=24  Identities=25%  Similarity=0.203  Sum_probs=21.0

Q ss_pred             ceeEecceeEEEEcCCCcEEEeec
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~   60 (106)
                      .|.+.|...+||+|++|+++..+.
T Consensus       100 ~~~v~~~P~~~vid~~G~v~~~~~  123 (126)
T cd03012         100 AYGNQYWPALYLIDPTGNVRHVHF  123 (126)
T ss_pred             HhCCCcCCeEEEECCCCcEEEEEe
Confidence            488999999999999999987653


No 44 
>PTZ00137 2-Cys peroxiredoxin; Provisional
Probab=74.19  E-value=4.2  Score=32.39  Aligned_cols=31  Identities=13%  Similarity=0.025  Sum_probs=21.1

Q ss_pred             ceeEEEEcCCCcEEEeecCCC----CHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK----KPEEVSNSII   73 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~----speeiAe~Ir   73 (106)
                      --.+|||||+|+++..+-.+.    +.+++...|.
T Consensus       188 ~R~tFIID~dG~I~~~~~~~~~~gr~v~eiLr~l~  222 (261)
T PTZ00137        188 HRASVLVDKAGVVKHVAVYDLGLGRSVDETLRLFD  222 (261)
T ss_pred             ecEEEEECCCCEEEEEEEeCCCCCCCHHHHHHHHH
Confidence            357899999999998874433    4455554443


No 45 
>PLN02919 haloacid dehalogenase-like hydrolase family protein
Probab=73.36  E-value=6.1  Score=36.94  Aligned_cols=46  Identities=9%  Similarity=0.187  Sum_probs=39.2

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHHhh
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENL   82 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~~~   82 (106)
                      .|-|..--.+||+|++|+.+..+.-....+++.+.|..++.-|++.
T Consensus       497 ~~~V~~iPt~ilid~~G~iv~~~~G~~~~~~l~~~l~~~l~~~~~~  542 (1057)
T PLN02919        497 ELGVSSWPTFAVVSPNGKLIAQLSGEGHRKDLDDLVEAALQYYGEK  542 (1057)
T ss_pred             hcCCCccceEEEECCCCeEEEEEecccCHHHHHHHHHHHHHhhccc
Confidence            4778888899999999999998877778889999999998877643


No 46 
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm. Unlike the related protein TrbB (TIGR02738), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. Even more closely related than TrbB is a clade of genes (TIGR02740) which do contain the CXXC motif, but it is unclear whether these genes are involved in type-F conjugation systems per se.
Probab=71.48  E-value=7.2  Score=31.11  Aligned_cols=43  Identities=14%  Similarity=0.276  Sum_probs=33.4

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCC-CHHHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNK-KPEEVSNSIIVNMMKY   79 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~-speeiAe~Ir~~l~~~   79 (106)
                      ..-|.++-.+||++|+.+-..-+.++. +.++|.++|-..+..+
T Consensus       208 ~l~v~~~Pal~Lv~~~t~~~~pv~~G~iS~deL~~Ri~~v~~~f  251 (256)
T TIGR02739       208 HLGVKYFPALYLVNPKSQKMSPLAYGFISQDELKERILNVLTQF  251 (256)
T ss_pred             hcCCccCceEEEEECCCCcEEEEeeccCCHHHHHHHHHHHHhcc
Confidence            355789999999999955444455555 7899999999888776


No 47 
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif. Assembly of cytochrome c requires the ligation of heme to reduced thiols of the apocytochrome. In bacteria, this assembly occurs in the periplasm. The reductase activity of DsbE in the oxidizing environment of the periplasm is crucial in the maturation of cytochrome c.
Probab=68.39  E-value=5.8  Score=26.43  Aligned_cols=31  Identities=23%  Similarity=0.125  Sum_probs=23.8

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEE   67 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~spee   67 (106)
                      .|-|-..-.+||+|++|+++..+.-..+.+.
T Consensus        95 ~~~v~~~P~~~~ld~~G~v~~~~~G~~~~~~  125 (127)
T cd03010          95 DLGVYGVPETFLIDGDGIIRYKHVGPLTPEV  125 (127)
T ss_pred             hcCCCCCCeEEEECCCceEEEEEeccCChHh
Confidence            4667777789999999999988766655543


No 48 
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional
Probab=68.17  E-value=11  Score=27.02  Aligned_cols=16  Identities=13%  Similarity=0.119  Sum_probs=14.3

Q ss_pred             eEEEEcCCCcEEEeec
Q psy17586         45 IMYLIDPEGLFVDYYG   60 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~   60 (106)
                      .+||+|++|+++..+.
T Consensus       133 ~tfvId~~G~I~~~~~  148 (167)
T PRK00522        133 AVFVLDENNKVVYSEL  148 (167)
T ss_pred             EEEEECCCCeEEEEEE
Confidence            7999999999998873


No 49 
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers.
Probab=68.03  E-value=5.1  Score=27.26  Aligned_cols=21  Identities=14%  Similarity=0.363  Sum_probs=17.3

Q ss_pred             ceeEEEEcCCCcEEEeecCCC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK   63 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~   63 (106)
                      +..+||+|++|+++..+....
T Consensus       114 ~~~~~lid~~G~v~~~~~~~~  134 (149)
T cd03018         114 ERAVFVIDRDGIIRYAWVSDD  134 (149)
T ss_pred             cceEEEECCCCEEEEEEecCC
Confidence            457899999999998886655


No 50 
>PRK14552 C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional
Probab=67.70  E-value=7.1  Score=33.17  Aligned_cols=38  Identities=16%  Similarity=0.327  Sum_probs=34.3

Q ss_pred             eeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVN   75 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~   75 (106)
                      |+++|...+|++|.+|+.+.......+++++++.+..+
T Consensus         3 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~   40 (414)
T PRK14552          3 YIAEHVIGAFAFDENGKLIDKIFNPEDIPKIVEELLNN   40 (414)
T ss_pred             eeeeccceeeEEccCcchhhhhcCCCCHHHHHHHHHHH
Confidence            89999999999999999999888888898888877755


No 51 
>PF13642 DUF4144:  protein structure with unknown function; PDB: 2L6O_A.
Probab=65.73  E-value=17  Score=25.35  Aligned_cols=60  Identities=15%  Similarity=-0.029  Sum_probs=30.8

Q ss_pred             CCceeEecceeEEEEcC-CCcEEE--eecCCCCHHHHHHHHHHHHHHHHhhhcCCcchhhhhh
Q psy17586         35 IFWFQVDHTIIMYLIDP-EGLFVD--YYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIES   94 (106)
Q Consensus        35 ~~dY~VDHSa~iYLmDP-dGrfv~--~f~~~~speeiAe~Ir~~l~~~~~~~~~~~~~~~~~~   94 (106)
                      .+||+||-....|.+.. .+.-..  .-....+.+++.+-||.+-.....-=..|...++++.
T Consensus        33 ~~D~LIDs~G~~y~l~~~~~~~~~l~~~~~~lsl~ev~~LIq~H~~~~g~cC~~Ki~f~si~q   95 (101)
T PF13642_consen   33 DDDRLIDSQGQSYQLKQSNSNKLSLQPSSQQLSLEEVTELIQAHAFSLGQCCIAKIQFNSIEQ   95 (101)
T ss_dssp             TT--EEETT-EEEEE-T-----TSSEEEEEE--HHHHHHHHHHHHHHHT---SSSSS-SSHHH
T ss_pred             CCCEEEeCCCCEEEeccccccchhcccCCCcccHHHHHHHHHHHHHhcCCeeeecccCCCHHH
Confidence            57899999999999987 332222  2244557788888777776554444445555555443


No 52 
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD. This protein, MauD, appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulfide bonds. MauD shares sequence similarity, including a CPxC motif, with a number of thiol:disulfide interchange proteins. In MauD mutants, the small subunit apparently does not form properly and is rapidly degraded.
Probab=64.98  E-value=14  Score=27.14  Aligned_cols=23  Identities=26%  Similarity=0.268  Sum_probs=19.6

Q ss_pred             CceeEecceeEEEEcCCCcEEEe
Q psy17586         36 FWFQVDHTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        36 ~dY~VDHSa~iYLmDPdGrfv~~   58 (106)
                      ..|-|......||+|++|+++..
T Consensus       140 ~~y~v~~~P~~~lID~~G~I~~~  162 (189)
T TIGR02661       140 MAFQVGKIPYGVLLDQDGKIRAK  162 (189)
T ss_pred             HhccCCccceEEEECCCCeEEEc
Confidence            35888888889999999998875


No 53 
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified. PRXs are thiol-specific antioxidant (TSA) proteins also known as TRX peroxidases and alkyl hydroperoxide reductase C22 (AhpC) proteins. They confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either TRX, glutathione, trypanothione and AhpF. They are distinct from other peroxidases in that they have no cofactors such as metals or prosthetic groups. The first step of catalysis, common to all PRXs, is the nucleophilic attack by the catalytic cysteine (also known as the peroxidatic cysteine) on the peroxide leading to cleavage of the oxygen-oxygen bond and the formation of a 
Probab=64.88  E-value=6.8  Score=26.18  Aligned_cols=22  Identities=18%  Similarity=0.235  Sum_probs=17.5

Q ss_pred             ceeEEEEcCCCcEEEeecCCCC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNKK   64 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~s   64 (106)
                      ...+||||++|+++..+.....
T Consensus       110 ~p~~~lid~~g~i~~~~~~~~~  131 (140)
T cd02971         110 ARATFIIDPDGKIRYVEVEPLP  131 (140)
T ss_pred             eEEEEEECCCCcEEEEEecCCC
Confidence            3479999999999988765554


No 54 
>KOG4107|consensus
Probab=64.09  E-value=23  Score=25.56  Aligned_cols=45  Identities=29%  Similarity=0.479  Sum_probs=34.6

Q ss_pred             eEEEEcCCCcEEEeecCCCCHHHHHHHHHHHH-HHHHhhhcCCcch
Q psy17586         45 IMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNM-MKYENLKKKSWFE   89 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l-~~~~~~~~~~~~~   89 (106)
                      ...|++.+|-+.++.+++.....+...|..-| .+++|.+-+-+-+
T Consensus        21 ~tlLln~EG~LLAYsGygdkdarvtaAiasniWAAyer~gn~af~e   66 (125)
T KOG4107|consen   21 GTLLLNKEGLLLAYSGYGDKDARVTAAIASNIWAAYERRGNQAFNE   66 (125)
T ss_pred             ceEEEcCCCcEEEecccCcchhHHHHHHHHHHHHHHHHhccccccc
Confidence            35799999999999999999888877776655 7777666544433


No 55 
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source. mauD is an essential accessory protein for the biosynthesis of methylamine dehydrogenase (MADH), the enzyme that catalyzes the oxidation of methylamine and other primary amines. MADH possesses an alpha2beta2 subunit structure; the alpha subunit is also referred to as the large subunit. Each beta (small) subunit contains a tryptophan tryptophylquinone (TTQ) prosthetic group. Accessory proteins are essential for the proper transport of MADH to the periplasm, TTQ synthesis and the formation of several structural disulfide bonds. Bacterial mutants containing an insertion on the mauD gene were unable to grow on methylamine as a sole carbon source, were found to lack the MADH small subunit and had decreased amounts of the MADH large subunit.
Probab=62.89  E-value=6.3  Score=25.54  Aligned_cols=21  Identities=24%  Similarity=0.358  Sum_probs=17.8

Q ss_pred             ceeEecceeEEEEcCCCcEEE
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVD   57 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~   57 (106)
                      .|.+.+.-.+||+|++|+++.
T Consensus        90 ~~~~~~~P~~~vid~~G~v~~  110 (114)
T cd02967          90 AYQVSKLPYAVLLDEAGVIAA  110 (114)
T ss_pred             hcCCCCcCeEEEECCCCeEEe
Confidence            577888899999999998764


No 56 
>PRK13703 conjugal pilus assembly protein TraF; Provisional
Probab=62.38  E-value=15  Score=29.20  Aligned_cols=43  Identities=12%  Similarity=0.153  Sum_probs=33.7

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCC-CHHHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNK-KPEEVSNSIIVNMMKY   79 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~-speeiAe~Ir~~l~~~   79 (106)
                      ...|.++-.+||+||+.+-..-+.++. +.+++.++|-.....+
T Consensus       201 ~l~v~~~PAl~Lv~~~t~~~~pv~~G~iS~deL~~Ri~~v~t~~  244 (248)
T PRK13703        201 RLGVKYFPALMLVDPKSGSVRPLSYGFITQDDLAKRFLNVSTDF  244 (248)
T ss_pred             hcCCcccceEEEEECCCCcEEEEeeccCCHHHHHHHHHHHHhcc
Confidence            467889999999999975555556655 8899999998877665


No 57 
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1.13.11.39) from Rhodococcus globerulus P6, BphC2-RGP6 and BphC3-RGP6,  and similar proteins. This subfamily contains Rhodococcus globerulus P6 BphC2-RGP6 and BphC3-RGP6, and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, yielding 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid. This is the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Most type I extradiol dioxygenases are activated by Fe(II). Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC2-RGP6 and BphC3-RGP6 are 
Probab=61.03  E-value=14  Score=24.34  Aligned_cols=27  Identities=15%  Similarity=0.244  Sum_probs=20.1

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSN   70 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe   70 (106)
                      -.+|+.||+|..+.++........+++
T Consensus       103 ~~~~~~DP~G~~ie~~~~~~~~~~~~~  129 (134)
T cd08348         103 WSIYFRDPDGNRLELFVDTPWYVAQAA  129 (134)
T ss_pred             eEEEEECCCCCEEEEEEcCCCChhhHH
Confidence            468999999999999966555444443


No 58 
>PF03259 Robl_LC7:  Roadblock/LC7 domain;  InterPro: IPR004942 This family includes proteins that are about 100 amino acids long and have been shown to be related []. Members of this family of proteins are associated with both flagellar outer arm dynein and Drosophila and rat brain cytoplasmic dynein. It is proposed that roadblock/LC7 family members may modulate specific dynein functions []. This family also includes Golgi-associated MP1 adapter protein (Q9Y2Q5 from SWISSPROT) and MglB from Myxococcus xanthus (Q50883 from SWISSPROT), a protein involved in gliding motility []. However the family also includes members from non-motile bacteria such as Streptomyces coelicolor, suggesting that the protein may play a structural or regulatory role.; PDB: 2B95_B 1Z09_A 2E8J_B 2HZ5_B 3KYE_A 2ZL1_B 1SKO_B 3CPT_B 1VEU_B 1VET_B ....
Probab=60.23  E-value=15  Score=22.93  Aligned_cols=39  Identities=15%  Similarity=0.147  Sum_probs=26.4

Q ss_pred             ceeEEEEcCCCcEEEe-ecCCCCHHHHHHHHHHHHHHHHh
Q psy17586         43 TIIMYLIDPEGLFVDY-YGQNKKPEEVSNSIIVNMMKYEN   81 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~-f~~~~speeiAe~Ir~~l~~~~~   81 (106)
                      -....|+|.||..+.. ......++.+++....++...++
T Consensus        15 v~~~~l~~~dG~~i~~~~~~~~~~~~~aa~~a~~~~~~~~   54 (91)
T PF03259_consen   15 VRGAVLVDKDGLVIASSGIDDDDAEKLAAMAASLLAAAEK   54 (91)
T ss_dssp             EEEEEEEETTSEEEEETSSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             eeEEEEEcCCCCEEEEecCCcccHHHHHHHHHHHHHHHHH
Confidence            3467899999999999 33333556677766666654443


No 59 
>PF08534 Redoxin:  Redoxin;  InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins. Peroxiredoxins (Prxs) constitute a family of thiol peroxidases that reduce hydrogen peroxide, peroxinitrite, and hydroperoxides using a strictly conserved cysteine []. Chloroplast thioredoxin systems in plants regulate the enzymes involved in photosynthetic carbon assimilation []. It is thought that redoxins have a large role to play in anti-oxidant defence. Cadmium-sensitive proteins are also regulated via thioredoxin and glutaredoxin thiol redox systems [].; GO: 0016491 oxidoreductase activity; PDB: 2H30_A 1TP9_A 1Y25_A 1XVQ_A 2B1K_A 2G0F_A 2B1L_B 3K8N_A 1Z5Y_E 3OR5_A ....
Probab=59.94  E-value=8.2  Score=26.28  Aligned_cols=23  Identities=22%  Similarity=0.147  Sum_probs=19.6

Q ss_pred             cceeEEEEcCCCcEEEeecCCCC
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKK   64 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~s   64 (106)
                      ..-.+||||++|+.+.......+
T Consensus       114 ~~P~~~lId~~G~V~~~~~g~~~  136 (146)
T PF08534_consen  114 GIPTTFLIDKDGKVVYRHVGPDP  136 (146)
T ss_dssp             SSSEEEEEETTSBEEEEEESSBT
T ss_pred             eecEEEEEECCCEEEEEEeCCCC
Confidence            78899999999999988766555


No 60 
>PF10029 DUF2271:  Predicted periplasmic protein (DUF2271);  InterPro: IPR014469 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=58.97  E-value=19  Score=25.99  Aligned_cols=52  Identities=15%  Similarity=0.092  Sum_probs=36.0

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHHhhhcCCcchhhhhhhcc
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFEDTIESLTS   97 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~~~~~~~~~~~~~~~~~~   97 (106)
                      .+++|.|++|+++..+--.....+...+|+..-++.  .+...-.-|++-.+|-
T Consensus        23 vAvWled~~g~~v~TL~v~~~~~kW~kdLr~Wwr~~--~~~~~~~vDgiTgAT~   74 (139)
T PF10029_consen   23 VAVWLEDADGKYVKTLAVWGDKKKWLKDLRQWWRKS--GRSNKEPVDGITGATR   74 (139)
T ss_pred             EEEEEECCCCCEEEEEEEEcCchHHHHHHHHHHHHh--cccccccccccccCCC
Confidence            689999999999988876666668888887775422  2334444566655553


No 61 
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha).  DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes.
Probab=57.55  E-value=12  Score=24.21  Aligned_cols=36  Identities=11%  Similarity=-0.054  Sum_probs=30.0

Q ss_pred             ceeEecceeEEEEcC-CCcEEEeecCCCCHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDP-EGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        37 dY~VDHSa~iYLmDP-dGrfv~~f~~~~speeiAe~I   72 (106)
                      .|-|...-.++++++ +|+.+..+.-..+.+++.+.|
T Consensus        67 ~~~i~~~Pti~~~~~~~g~~~~~~~G~~~~~~l~~~l  103 (104)
T cd02953          67 RFGVFGPPTYLFYGPGGEPEPLRLPGFLTADEFLEAL  103 (104)
T ss_pred             HcCCCCCCEEEEECCCCCCCCcccccccCHHHHHHHh
Confidence            488899999999999 999888887777888777654


No 62 
>PF14639 YqgF:  Holliday-junction resolvase-like of SPT6 ; PDB: 3PSI_A 3PSF_A.
Probab=56.68  E-value=28  Score=25.43  Aligned_cols=40  Identities=20%  Similarity=0.233  Sum_probs=25.7

Q ss_pred             EecceeEEEEcCCCcEEEeecC--C----CCHHHHHHHHHHHHHHH
Q psy17586         40 VDHTIIMYLIDPEGLFVDYYGQ--N----KKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f~~--~----~speeiAe~Ir~~l~~~   79 (106)
                      -++.++..++|.+|+++.++.-  .    ...++-.+.|..+|.++
T Consensus        17 ~~~~~~~v~ld~~G~v~d~~~~~~~~~~~~~~~~~~~~l~~~i~~~   62 (150)
T PF14639_consen   17 GDDAVFCVVLDENGEVLDHLKLVYNERDRERKEEDMERLKKFIEKH   62 (150)
T ss_dssp             TTS-EEEEEE-TTS-EEEEEEE-S-TT-SS-SHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCcEEEEEEEcCCccchHHHHHHHHHHHHHHHHc
Confidence            5678899999999999987543  1    12345567777888766


No 63 
>PF13778 DUF4174:  Domain of unknown function (DUF4174)
Probab=56.04  E-value=24  Score=24.47  Aligned_cols=32  Identities=22%  Similarity=0.243  Sum_probs=27.6

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVN   75 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~   75 (106)
                      -.++|++.||....-++...++++|-+.|-..
T Consensus        80 f~~vLiGKDG~vK~r~~~p~~~~~lf~~ID~M  111 (118)
T PF13778_consen   80 FTVVLIGKDGGVKLRWPEPIDPEELFDTIDAM  111 (118)
T ss_pred             eEEEEEeCCCcEEEecCCCCCHHHHHHHHhCC
Confidence            46899999999999999999999998876543


No 64 
>PF06491 Disulph_isomer:  Disulphide isomerase;  InterPro: IPR009474 This entry consists of several hypothetical bacterial proteins of unknown function.; PDB: 3FHK_F.
Probab=55.28  E-value=22  Score=26.30  Aligned_cols=36  Identities=17%  Similarity=0.384  Sum_probs=26.2

Q ss_pred             ceeEEEEcCCCcEEEeecCC----CCHHHHHHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQN----KKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~----~speeiAe~Ir~~l~~~   79 (106)
                      |-.+-|+ .||+++-+++..    .++++|++.|.....+|
T Consensus        96 SPS~ALf-KdGelvh~ieRh~IEGr~a~~Ia~~L~~af~~~  135 (136)
T PF06491_consen   96 SPSIALF-KDGELVHFIERHHIEGRPAEEIAENLQDAFDEY  135 (136)
T ss_dssp             SSEEEEE-ETTEEEEEE-GGGTTTS-HHHHHHHHHHHHHHH
T ss_pred             Cchheee-eCCEEEEEeehhhcCCCCHHHHHHHHHHHHHhh
Confidence            4445555 899999999764    47899999999887664


No 65 
>PF11760 CbiG_N:  Cobalamin synthesis G N-terminal;  InterPro: IPR021744  Members of this family are involved in cobalamin synthesis. The gene encoded by P72862 from SWISSPROT has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process []. Within the cobalamin synthesis pathway CbiG catalyses the both the opening of the lactone ring and the extrusion of the two-carbon fragment of cobalt-precorrin-5A from C-20 and its associated methyl group (deacylation) to give cobalt-precorrin-5B. The N-terminal of the enzyme is conserved in this family, and the C-terminal and the mid-sections are conserved independently in other families, CbiG_C and CbiG_mid, although the distinct function of each region is unclear. ; PDB: 3EEQ_B.
Probab=54.53  E-value=25  Score=23.77  Aligned_cols=35  Identities=17%  Similarity=0.165  Sum_probs=23.7

Q ss_pred             ceeEEEEcCCCcEEEeecCCC-C-HHHHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK-K-PEEVSNSIIVNMM   77 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~-s-peeiAe~Ir~~l~   77 (106)
                      -..+.++|++|+|+--+-.+. . +.+++..|...|.
T Consensus        38 DPaVvvvde~g~~vIplL~GH~GGan~lA~~iA~~lg   74 (84)
T PF11760_consen   38 DPAVVVVDEDGRFVIPLLGGHRGGANELARQIAELLG   74 (84)
T ss_dssp             --EEEEE-TT--EEEEEE-TTTT-HHHHHHHHHHHTT
T ss_pred             CCCEEEEeCCCCEEEEeccCCcchHHHHHHHHHHHhC
Confidence            357899999999998876555 3 7899999988764


No 66 
>PF12681 Glyoxalase_2:  Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A ....
Probab=53.38  E-value=14  Score=23.06  Aligned_cols=16  Identities=31%  Similarity=0.771  Sum_probs=11.8

Q ss_pred             eeEEEEcCCCcEEEee
Q psy17586         44 IIMYLIDPEGLFVDYY   59 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f   59 (106)
                      -.+|+.||+|..+.++
T Consensus        93 ~~~~~~DPdG~~ie~~  108 (108)
T PF12681_consen   93 RSFYFIDPDGNRIEFC  108 (108)
T ss_dssp             EEEEEE-TTS-EEEEE
T ss_pred             EEEEEECCCCCEEEeC
Confidence            6899999999988763


No 67 
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=52.58  E-value=15  Score=23.65  Aligned_cols=17  Identities=24%  Similarity=0.596  Sum_probs=14.7

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.++.
T Consensus       101 ~~~~~~DPdG~~ve~~~  117 (121)
T cd07266         101 RALRVEDPLGFPIEFYA  117 (121)
T ss_pred             cEEEEECCCCCEEEEEe
Confidence            57899999999998873


No 68 
>PRK11440 putative hydrolase; Provisional
Probab=51.78  E-value=33  Score=24.91  Aligned_cols=47  Identities=15%  Similarity=0.159  Sum_probs=35.3

Q ss_pred             cceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHHhhhcCCcc
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWF   88 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~~~~~~~~~   88 (106)
                      ..+.+.++|-+..|+..-......+++.+.++++++.+++.+.+-.+
T Consensus         7 ~~~ALlvID~Qn~f~~~~~~~~~~~~~i~~i~~l~~~ar~~g~pVi~   53 (188)
T PRK11440          7 KTTALVVIDLQEGILPFAGGPHTADEVVARAARLAAKFRASGSPVVL   53 (188)
T ss_pred             CCEEEEEEecccccccCCCCcchHHHHHHHHHHHHHHHHHcCCcEEE
Confidence            35788899999988753222334678999999999999988887543


No 69 
>cd04468 S1_eIF5A S1_eIF5A: Eukaryotic translation Initiation Factor 5A (eIF5A), S1-like RNA-binding domain. eIF5A is an evolutionarily conserved protein found in eukaryotes. eIF5A is the only protein known to have the unusual amino acid hypusine. Hypusine is essential for eIF5A function and is a post-translationally modified lysine. eIF5A interacts with components of the 80S ribosome and translation elongation factors 2 (eEF2) in a hypusine-dependent manner. This C-terminal S1 domain resembles the oligonucleotides-binding fold (OB fold) which binds RNA. Moreover, eIF5A prefers binding to the actively translating ribosome. This evidence suggests that eIF5A plays a role in translation elongation instead of translation initiation as previously proposed.
Probab=51.12  E-value=29  Score=22.65  Aligned_cols=32  Identities=16%  Similarity=0.116  Sum_probs=25.2

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .++-||+.+|..+.=++  .+..++.+.|+....
T Consensus        14 GflsLm~e~G~~k~Dlk--lP~~elg~~I~~~f~   45 (69)
T cd04468          14 GFLSLMDDDGETREDLK--LPEGELGKEIREKFD   45 (69)
T ss_pred             CeEEEEcCCCCcccCCc--CCcHHHHHHHHHHHh
Confidence            88999999999887665  335788888887653


No 70 
>PF00578 AhpC-TSA:  AhpC/TSA family;  InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells. Prxs can be regulated by changes to phosphorylation, redox and possibly oligomerisation states. Prxs are divided into three classes: typical 2-Cys Prxs; atypical 2-Cys Prxs; and 1-Cys Prxs. All Prxs share the same basic catalytic mechanism, in which an active-site cysteine (the peroxidatic cysteine) is oxidised to a sulphenic acid by the peroxide substrate. The recycling of the sulphenic acid back to a thiol is what distinguishes the three enzyme classes. Using crystal structures, a detailed catalytic cycle has been derived for typical 2-Cys Prxs, including a model for the redox-regulated oligomeric state proposed to control enzyme activity []. Alkyl hydroperoxide reductase (AhpC) is responsible for directly reducing organic hyperoxides in its reduced dithiol form. Thiol specific antioxidant (TSA) is a physiologically important antioxidant which constitutes an enzymatic defence against sulphur-containing radicals. This family contains AhpC and TSA, as well as related proteins.; GO: 0016209 antioxidant activity, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1QMV_A 1PRX_B 3HJP_C 3HA9_A 2V41_G 2V32_C 2V2G_C 3LWA_A 3IA1_B 1ZYE_G ....
Probab=51.06  E-value=13  Score=24.23  Aligned_cols=16  Identities=31%  Similarity=0.520  Sum_probs=14.1

Q ss_pred             cceeEEEEcCCCcEEE
Q psy17586         42 HTIIMYLIDPEGLFVD   57 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~   57 (106)
                      ..-.+||+||+|+++.
T Consensus       108 ~~p~~~lid~~g~I~~  123 (124)
T PF00578_consen  108 ALPAVFLIDPDGKIRY  123 (124)
T ss_dssp             ESEEEEEEETTSBEEE
T ss_pred             eEeEEEEECCCCEEEe
Confidence            7789999999999874


No 71 
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=50.68  E-value=33  Score=30.12  Aligned_cols=37  Identities=8%  Similarity=-0.044  Sum_probs=31.2

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSII   73 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir   73 (106)
                      .|-|.--..+||+||+|+++..+.-..+.++|.+.|+
T Consensus       134 ~fgV~giPTt~IIDkdGkIV~~~~G~~~~eeL~a~Ie  170 (521)
T PRK14018        134 SLNISVYPSWAIIGKDGDVQRIVKGSISEAQALALIR  170 (521)
T ss_pred             HcCCCCcCeEEEEcCCCeEEEEEeCCCCHHHHHHHHH
Confidence            4777777889999999999999887888888877666


No 72 
>PRK09381 trxA thioredoxin; Provisional
Probab=50.66  E-value=29  Score=22.42  Aligned_cols=39  Identities=8%  Similarity=0.049  Sum_probs=29.5

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNM   76 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l   76 (106)
                      .|.|-....++++ ++|+.+..+.-..+.++|.+.|...+
T Consensus        70 ~~~v~~~Pt~~~~-~~G~~~~~~~G~~~~~~l~~~i~~~~  108 (109)
T PRK09381         70 KYGIRGIPTLLLF-KNGEVAATKVGALSKGQLKEFLDANL  108 (109)
T ss_pred             hCCCCcCCEEEEE-eCCeEEEEecCCCCHHHHHHHHHHhc
Confidence            4777777777777 69999988876777888777666554


No 73 
>PF02743 Cache_1:  Cache domain;  InterPro: IPR004010 Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins, including the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source []. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions [].; GO: 0016020 membrane; PDB: 3C8C_A 3LIB_D 3LIA_A 3LI8_A 3LI9_A.
Probab=50.53  E-value=11  Score=23.39  Aligned_cols=23  Identities=9%  Similarity=0.215  Sum_probs=18.1

Q ss_pred             ceeEecceeEEEEcCCCcEEEee
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f   59 (106)
                      +..+..+..+||+|.+|+++..=
T Consensus        47 ~~~~~~~g~~~ivd~~G~ii~hp   69 (81)
T PF02743_consen   47 NIKFGNNGYAFIVDKNGTIIAHP   69 (81)
T ss_dssp             TSBBTTTBEEEEEETTSBBCE-S
T ss_pred             eeEECCCEEEEEEECCCCEEEeC
Confidence            35567788999999999998763


No 74 
>PF01295 Adenylate_cycl:  Adenylate cyclase, class-I;  InterPro: IPR000274 Adenylate cyclase is the enzyme responsible for the synthesis of cAMP from ATP. On the basis of sequence similarity, it has been proposed that there are three different classes of adenylate cyclases [, ]. Class I cyclases are found in enterobacteria and related Gram-negative bacteria.; GO: 0004016 adenylate cyclase activity, 0006171 cAMP biosynthetic process
Probab=50.52  E-value=36  Score=30.42  Aligned_cols=40  Identities=20%  Similarity=0.257  Sum_probs=35.7

Q ss_pred             ecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      |.+..||++|-.|++..+.....+.++++..|.++...-.
T Consensus       526 ~~~~~vYILDE~n~l~~y~~~~~~~~~lv~~i~~fy~~~~  565 (604)
T PF01295_consen  526 DNGFNVYILDEKNSLEHYQQCDGSKEELVREINRFYQSSE  565 (604)
T ss_pred             CCceEEEEEcCCCcEEEEEeCCCCHHHHHHHHHHHHHhhh
Confidence            5789999999999999999999999999999999886543


No 75 
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=49.96  E-value=19  Score=22.73  Aligned_cols=18  Identities=22%  Similarity=0.573  Sum_probs=15.0

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      ...+|+.||+|..+.+..
T Consensus       107 ~~~~~~~DPdG~~ve~~~  124 (125)
T cd07253         107 ITSVYFRDPDGNLIELSN  124 (125)
T ss_pred             ccEEEEECCCCCEEEeee
Confidence            457899999999998754


No 76 
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=49.34  E-value=19  Score=23.45  Aligned_cols=20  Identities=20%  Similarity=0.326  Sum_probs=16.5

Q ss_pred             ecceeEEEEcCCCcEEEeec
Q psy17586         41 DHTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~   60 (106)
                      .+...+|+.||+|..+.++-
T Consensus        98 ~~~~~~~~~DPdG~~iEl~~  117 (121)
T cd09013          98 GHGKAYRFRSPDGHPMELYW  117 (121)
T ss_pred             CCcceEEEECCCCCEEEEEE
Confidence            45667899999999998874


No 77 
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the C-terminal, catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its C-terminal repeat is represented in thi
Probab=48.78  E-value=17  Score=25.37  Aligned_cols=22  Identities=23%  Similarity=0.510  Sum_probs=17.9

Q ss_pred             ecceeEEEEcCCCcEEEeecCC
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~~   62 (106)
                      ++...+|+.||+|..+.++-..
T Consensus       111 ~~~~~~y~~DPdG~~iEl~~~~  132 (154)
T cd07237         111 DRMLSFYVRTPSGFAIEYGWGG  132 (154)
T ss_pred             CCcEEEEEECCCCcEEEeccCc
Confidence            4567899999999999997543


No 78 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=47.12  E-value=27  Score=22.50  Aligned_cols=17  Identities=18%  Similarity=0.342  Sum_probs=14.6

Q ss_pred             eEEEEcCCCcEEEeecC
Q psy17586         45 IMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~   61 (106)
                      .+|+.||+|..+.++..
T Consensus        93 ~~~~~DP~Gn~iel~~~  109 (112)
T cd08344          93 GVWFRDPDGNLLQVKVA  109 (112)
T ss_pred             EEEEECCCCCEEEEecC
Confidence            58999999999998754


No 79 
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the N-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dioxyge
Probab=47.05  E-value=25  Score=22.41  Aligned_cols=18  Identities=17%  Similarity=0.545  Sum_probs=14.8

Q ss_pred             eeEEEEcCCCcEEEeecC
Q psy17586         44 IIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~   61 (106)
                      ..+|+.||+|..+.++..
T Consensus       100 ~~~~~~DP~G~~iel~~~  117 (120)
T cd08362         100 YGFRFFDPDGRLIEFSAD  117 (120)
T ss_pred             eEEEEECCCCCEEEEEec
Confidence            468999999999988643


No 80 
>TIGR02740 TraF-like TraF-like protein. This protein is related to the F-type conjugation system pilus assembly proteins TraF (TIGR02739)and TrbB (TIGR02738) both of which exhibit a thioredoxin fold. The protein represented by this model has the same length and architecture as TraF, but lacks the CXXC-motif found in TrbB and believed to be responsible for the disulfide isomerase activity of that protein.
Probab=47.02  E-value=35  Score=26.95  Aligned_cols=40  Identities=15%  Similarity=0.285  Sum_probs=30.1

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCC-CCHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQN-KKPEEVSNSIIVNM   76 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~-~speeiAe~Ir~~l   76 (106)
                      .|-|.+.-.+||+|++|+-+..+..+ .+.++|.+.|..+.
T Consensus       224 ~~gV~~vPtl~Lv~~~~~~v~~v~~G~~s~~eL~~~i~~~a  264 (271)
T TIGR02740       224 QLKIRTVPAVFLADPDPNQFTPIGFGVMSADELVDRILLAA  264 (271)
T ss_pred             HcCCCcCCeEEEEECCCCEEEEEEeCCCCHHHHHHHHHHHh
Confidence            57899999999999966555544444 67888888777654


No 81 
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=46.47  E-value=23  Score=23.14  Aligned_cols=18  Identities=17%  Similarity=0.305  Sum_probs=15.2

Q ss_pred             eeEEEEcCCCcEEEeecC
Q psy17586         44 IIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~   61 (106)
                      .++|+.||+|..+.++--
T Consensus       100 ~~~~~~DPdG~~iE~~~~  117 (120)
T cd07252         100 GLIRFADPDGNRHELFWG  117 (120)
T ss_pred             EEEEEECCCCCEEEEEec
Confidence            478999999999988743


No 82 
>TIGR01068 thioredoxin thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model.
Probab=46.31  E-value=40  Score=20.69  Aligned_cols=38  Identities=16%  Similarity=0.076  Sum_probs=28.2

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVN   75 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~   75 (106)
                      .|.|.....+.++ ++|+.+..+....+++++.+.|++.
T Consensus        63 ~~~v~~~P~~~~~-~~g~~~~~~~g~~~~~~l~~~l~~~  100 (101)
T TIGR01068        63 KYGIRSIPTLLLF-KNGKEVDRSVGALPKAALKQLINKN  100 (101)
T ss_pred             HcCCCcCCEEEEE-eCCcEeeeecCCCCHHHHHHHHHhh
Confidence            4778888888888 7898887776566677777766543


No 83 
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins. ChaP is an enzyme involved in the biosynthesis of the potent antitumor agent chartreusin (cha). Cha is an aromatic polyketide glycoside produced by Streptomyces chartreusis. ChaP may play a role as a meta-cleavage dioxygenase in the oxidative rearrangement of the anthracyclic polyketide. ChaP belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=46.11  E-value=25  Score=23.01  Aligned_cols=19  Identities=21%  Similarity=0.555  Sum_probs=16.2

Q ss_pred             eeEEEEcCCCcEEEeecCC
Q psy17586         44 IIMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~   62 (106)
                      -.+|+.||+|..+.++..+
T Consensus       104 ~~~~f~DPdG~~iEl~~~~  122 (123)
T cd08351         104 RGVYFLDPDGHLLEIITRP  122 (123)
T ss_pred             eEEEEECCCCCEEEEEecc
Confidence            5799999999999988653


No 84 
>PF09695 YtfJ_HI0045:  Bacterial protein of unknown function (YtfJ_HI0045);  InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ. 
Probab=45.98  E-value=48  Score=25.08  Aligned_cols=32  Identities=19%  Similarity=0.252  Sum_probs=24.3

Q ss_pred             ecceeEEEEcCCCcEEEeecCCCCHHHHHHHH
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~~~speeiAe~I   72 (106)
                      +-|+.|.++|.+|+.+-+-.-..+++++.+.|
T Consensus       123 ~~~SaiiVlDK~G~V~F~k~G~Ls~~Ev~qVi  154 (160)
T PF09695_consen  123 EESSAIIVLDKQGKVQFVKEGALSPAEVQQVI  154 (160)
T ss_pred             CCCceEEEEcCCccEEEEECCCCCHHHHHHHH
Confidence            45677889999999776666667888876644


No 85 
>PF13905 Thioredoxin_8:  Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A ....
Probab=45.63  E-value=11  Score=23.61  Aligned_cols=19  Identities=21%  Similarity=0.522  Sum_probs=15.7

Q ss_pred             ceeEecceeEEEEcCCCcE
Q psy17586         37 WFQVDHTIIMYLIDPEGLF   55 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrf   55 (106)
                      .|.|.....++|+||+|+.
T Consensus        77 ~~~i~~iP~~~lld~~G~I   95 (95)
T PF13905_consen   77 KYGINGIPTLVLLDPDGKI   95 (95)
T ss_dssp             HTT-TSSSEEEEEETTSBE
T ss_pred             HCCCCcCCEEEEECCCCCC
Confidence            4788889999999999974


No 86 
>TIGR01126 pdi_dom protein disulfide-isomerase domain. This model describes a domain of eukaryotic protein disulfide isomerases, generally found in two copies. The high cutoff for total score reflects the expectation of finding both copies. The domain is similar to thioredoxin but the redox-active disulfide region motif is APWCGHCK.
Probab=44.95  E-value=32  Score=21.32  Aligned_cols=37  Identities=11%  Similarity=0.017  Sum_probs=27.1

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIV   74 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~   74 (106)
                      .|.|.....++++++++. +..+.-..+.+++...|++
T Consensus        64 ~~~i~~~P~~~~~~~~~~-~~~~~g~~~~~~l~~~i~~  100 (102)
T TIGR01126        64 RFGVSGFPTIKFFPKGKK-PVDYEGGRDLEAIVEFVNE  100 (102)
T ss_pred             hCCCCcCCEEEEecCCCc-ceeecCCCCHHHHHHHHHh
Confidence            588999999999999987 4444545667776665554


No 87 
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=44.76  E-value=26  Score=22.69  Aligned_cols=19  Identities=16%  Similarity=0.483  Sum_probs=15.4

Q ss_pred             cceeEEEEcCCCcEEEeec
Q psy17586         42 HTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~   60 (106)
                      +...+|+.||+|..+.++.
T Consensus       109 ~~~~~~~~DpdG~~ie~~~  127 (128)
T cd07242         109 GYYALFFEDPDGIRLELVA  127 (128)
T ss_pred             cEEEEEEECCCCcEEEEEe
Confidence            4457899999999988764


No 88 
>cd01014 nicotinamidase_related Nicotinamidase_ related amidohydrolases.  Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.
Probab=44.60  E-value=33  Score=24.18  Aligned_cols=42  Identities=12%  Similarity=-0.009  Sum_probs=30.0

Q ss_pred             EEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHHhhhcCCc
Q psy17586         46 MYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSW   87 (106)
Q Consensus        46 iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~~~~~~~~   87 (106)
                      +.++|.+..|..--......+++.+.+.++++.+++.+.+-+
T Consensus         2 LlviD~Q~~f~~~~~~~~~~~~~v~~i~~li~~~r~~~~~Vi   43 (155)
T cd01014           2 LLVIDVQNGYFDGGLPPLNNEAALENIAALIAAARAAGIPVI   43 (155)
T ss_pred             EEEEeCchhhhCCCCCcCCHHHHHHHHHHHHHHHHHCCCeEE
Confidence            567788887764322223578899999999998887776533


No 89 
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structure of this family is a that of a strand-swapped dimer.
Probab=44.59  E-value=25  Score=22.35  Aligned_cols=17  Identities=24%  Similarity=0.393  Sum_probs=14.3

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.++.
T Consensus        94 ~~~~~~DP~Gn~i~~~~  110 (112)
T cd07238          94 RRFFVRDPFGKLVNILT  110 (112)
T ss_pred             EEEEEECCCCCEEEEEE
Confidence            46799999999998874


No 90 
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=44.11  E-value=25  Score=22.61  Aligned_cols=18  Identities=39%  Similarity=0.702  Sum_probs=15.0

Q ss_pred             eeEEEEcCCCcEEEeecC
Q psy17586         44 IIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~   61 (106)
                      ..+|+.||+|..+.++..
T Consensus       102 ~~~~~~DPdG~~iEi~~~  119 (125)
T cd07255         102 EALYLSDPEGNGIEIYAD  119 (125)
T ss_pred             eEEEEECCCCCEEEEEEe
Confidence            468999999999987643


No 91 
>PF03396 Pox_RNA_pol_35:  Poxvirus DNA-directed RNA polymerase, 35 kD subunit;  InterPro: IPR005059 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits.  The DNA-dependent RNA polymerase from vaccinia virions has a molecular weight of approximately 500 kDa and can be dissociated into putative subunits of 140, 137, 37, 35, 31, 22, and 17 kDa. This group represents a DNA-directed RNA polymerase, 35 kDa subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0019083 viral transcription
Probab=44.01  E-value=1.1e+02  Score=25.21  Aligned_cols=55  Identities=18%  Similarity=0.350  Sum_probs=41.3

Q ss_pred             eeEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         20 LMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        20 ~~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      +-|-||-++.|.+  +++|.==|---.|+++|||.+..+    ..|.++-+-|-....+|+
T Consensus        73 ~~fcvyLkksQt~--~~~YisL~DfDYyiI~~d~~~~~v----dKp~EL~eTLlHtFqeYR  127 (292)
T PF03396_consen   73 VGFCVYLKKSQTE--DKNYISLYDFDYYIIDPDGTFIKV----DKPKELKETLLHTFQEYR  127 (292)
T ss_pred             ccEEEEEeccccc--CcceEEEecccEEEECCCCCeeec----CCcHHHHHHHHHHHHhhh
Confidence            3377888877644  567887788889999999987766    567888886666666665


No 92 
>smart00497 IENR1 Intron encoded nuclease repeat motif. Repeat of unknown function, but possibly DNA-binding via helix-turn-helix motif (Ponting, unpublished).
Probab=43.79  E-value=24  Score=20.23  Aligned_cols=34  Identities=9%  Similarity=0.175  Sum_probs=22.6

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      .-+|++|.+|.++..|+.-..+.+....-+..|.
T Consensus         2 k~V~~~d~~~~~i~~f~S~~eAa~~lg~~~~~I~   35 (53)
T smart00497        2 KPVYVYDLDGNLIGEFSSIREAAKYLGISHSSIS   35 (53)
T ss_pred             ccEEEEeCCCCEEEEecCHHHHHHHhCCCHHHHH
Confidence            3589999999999888766555555333233343


No 93 
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=42.36  E-value=29  Score=22.48  Aligned_cols=17  Identities=12%  Similarity=0.290  Sum_probs=14.3

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.+..
T Consensus       102 r~~~~~DPdGn~iei~~  118 (120)
T cd09011         102 RVVRFYDPDKHIIEVGE  118 (120)
T ss_pred             EEEEEECCCCCEEEEec
Confidence            47899999999988754


No 94 
>COG2443 Sss1 Preprotein translocase subunit Sss1 [Intracellular trafficking and secretion]
Probab=41.78  E-value=36  Score=22.23  Aligned_cols=27  Identities=15%  Similarity=0.250  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHH----HhhhcCCcchhh
Q psy17586         65 PEEVSNSIIVNMMKY----ENLKKKSWFEDT   91 (106)
Q Consensus        65 peeiAe~Ir~~l~~~----~~~~~~~~~~~~   91 (106)
                      ..+..+.++..++++    +.+++|.|.+=.
T Consensus         4 ~~~~~e~~~~~lke~~rvl~~arKP~~eEy~   34 (65)
T COG2443           4 MMDKPEELREFLKEYRRVLKVARKPDWEEYS   34 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCCCHHHHH
Confidence            456677888888776    589999998754


No 95 
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=41.77  E-value=30  Score=22.96  Aligned_cols=19  Identities=16%  Similarity=0.289  Sum_probs=15.4

Q ss_pred             ceeEEEEcCCCcEEEeecC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~   61 (106)
                      ..++|+.||+|..+.++-.
T Consensus       101 ~~~~~f~DPdG~~iE~~~~  119 (124)
T cd08361         101 KAFIAFRDPSGNSIELVVR  119 (124)
T ss_pred             ceEEEEECcCCCEEEEEEe
Confidence            3468999999999988743


No 96 
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and types I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=41.62  E-value=28  Score=22.39  Aligned_cols=18  Identities=17%  Similarity=0.337  Sum_probs=15.3

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      ...+|+.||+|..+.++.
T Consensus        99 ~~~~~~~DP~G~~ie~~~  116 (120)
T cd07254          99 QDKVWVTDPDGNAWEVFV  116 (120)
T ss_pred             cceEEEECCCCCEEEEEE
Confidence            356999999999998874


No 97 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=41.60  E-value=28  Score=22.71  Aligned_cols=18  Identities=22%  Similarity=0.425  Sum_probs=15.7

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      ...+|+.||+|..+.++.
T Consensus        92 ~~~~~f~DPdG~~ie~~~  109 (121)
T cd07244          92 GDSFYFLDPDGHKLELHV  109 (121)
T ss_pred             ccEEEEECCCCCEEEEEe
Confidence            457999999999999984


No 98 
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx). Tpx is a bacterial periplasmic peroxidase which differs from other PRXs in that it shows substrate specificity toward alkyl hydroperoxides over hydrogen peroxide. As with all other PRXs, the peroxidatic cysteine (N-terminal) of Tpx is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Tpx is able to resolve this intermediate by forming an intramolecular disulfide bond with a conserved C-terminal cysteine (the resolving cysteine), which can then be reduced by thioredoxin. This differs from the typical 2-cys PRX which resolves the oxidized cysteine by forming an intermolecular disulfide bond with the resolving cysteine from the other subunit of the homodimer. Atypical 2-cys PRX homodimers have a loop-based 
Probab=41.32  E-value=27  Score=23.64  Aligned_cols=17  Identities=18%  Similarity=0.219  Sum_probs=14.7

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+||||++|+.+....
T Consensus       111 ~~~~iid~~G~I~~~~~  127 (143)
T cd03014         111 RAVFVIDENGKVIYVEL  127 (143)
T ss_pred             eEEEEEcCCCeEEEEEE
Confidence            47899999999988874


No 99 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=41.23  E-value=33  Score=21.85  Aligned_cols=17  Identities=24%  Similarity=0.522  Sum_probs=14.1

Q ss_pred             ceeEEEEcCCCcEEEee
Q psy17586         43 TIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f   59 (106)
                      +-.+|+.||+|..+.+-
T Consensus       107 ~~~~~~~DPdG~~iE~~  123 (125)
T cd08357         107 QETFFLKDPSGNALEFK  123 (125)
T ss_pred             eeEEEEECCCCCEEEEe
Confidence            46799999999988764


No 100
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp. NF100 MhqB and similar proteins; MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. This subfamily contains the C-terminal, catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=41.18  E-value=28  Score=23.31  Aligned_cols=19  Identities=32%  Similarity=0.389  Sum_probs=15.7

Q ss_pred             eeEEEEcCCCcEEEeecCC
Q psy17586         44 IIMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~   62 (106)
                      .++|+.||+|..+.++...
T Consensus       103 ~~~y~~DP~G~~iEl~~~~  121 (134)
T cd08360         103 YFWYFRDPWGGEVEYGADM  121 (134)
T ss_pred             EEEEEECCCCCEEEEEccc
Confidence            3589999999999998543


No 101
>TIGR00068 glyox_I lactoylglutathione lyase. Glyoxylase I is a homodimer in many species. In some eukaryotes, including yeasts and plants, the orthologous protein carries a tandem duplication, is twice as long, and hits this model twice.
Probab=40.66  E-value=37  Score=23.30  Aligned_cols=21  Identities=19%  Similarity=0.564  Sum_probs=17.4

Q ss_pred             eeEEEEcCCCcEEEeecCCCC
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKK   64 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~s   64 (106)
                      -..|+.||+|..+.++.+..+
T Consensus       124 ~~~~~~DPdG~~iel~~~~~~  144 (150)
T TIGR00068       124 VIAFVEDPDGYKIELIQRKST  144 (150)
T ss_pred             EEEEEECCCCCEEEEEECCch
Confidence            467899999999999876654


No 102
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI and PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5, PDIR, ERp46 and the transmembrane PDIs. PDI, ERp57, ERp72, P5, PDIR and ERp46 are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins usually contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and may also contain one or more redox inactive TRX-like (b) domains. Only one a domain is required for the oxidase function but multiple copies 
Probab=40.55  E-value=26  Score=21.18  Aligned_cols=35  Identities=11%  Similarity=-0.042  Sum_probs=26.2

Q ss_pred             CceeEecceeEEEEcCCCcEEEeecCCCCHHHHHH
Q psy17586         36 FWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSN   70 (106)
Q Consensus        36 ~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe   70 (106)
                      ..|.|.....+++++++|+....+....+++++.+
T Consensus        65 ~~~~i~~~Pt~~~~~~~~~~~~~~~g~~~~~~i~~   99 (101)
T cd02961          65 SEYGVRGYPTIKLFPNGSKEPVKYEGPRTLESLVE   99 (101)
T ss_pred             HhCCCCCCCEEEEEcCCCcccccCCCCcCHHHHHh
Confidence            35889999999999999765666655567777654


No 103
>PF11141 DUF2914:  Protein of unknown function (DUF2914);  InterPro: IPR022606  This bacterial family of proteins has no known function. 
Probab=40.54  E-value=67  Score=20.29  Aligned_cols=33  Identities=12%  Similarity=0.135  Sum_probs=26.0

Q ss_pred             EEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeec
Q psy17586         22 YSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        22 y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~   60 (106)
                      ||.|+.+.-.....|+..|+      |+|.+|+.++...
T Consensus        30 ~Rt~S~k~~~~~~~G~WrV~------V~~~~G~~l~~~~   62 (66)
T PF11141_consen   30 WRTWSSKQNFPDQPGDWRVE------VVDEDGQVLGSLR   62 (66)
T ss_pred             EEEEEEeecCCCCCcCEEEE------EEcCCCCEEEEEE
Confidence            89999887765556777665      8999999888754


No 104
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins. BLMT is a bleomycin (Bm) resistance protein, encoded by the ble gene on the transposon Tn5. This protein confers a survival advantage to Escherichia coli host cells. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMT has strong binding affinity to Bm and it protects against this lethal compound through drug sequestering. BLMT has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMT is a dimer with two Bm-binding pockets formed at the dimer interface.
Probab=40.35  E-value=32  Score=22.32  Aligned_cols=17  Identities=24%  Similarity=0.464  Sum_probs=14.5

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.+..
T Consensus       102 ~~~~~~DPdG~~ie~~~  118 (120)
T cd08350         102 REFALVDPDGNLLRFGQ  118 (120)
T ss_pred             eEEEEECCCCCEEEeec
Confidence            46899999999988764


No 105
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. This subfamily family contains FosX, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-Nacetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of the configuration at C1 in the presence of Mn(II). The hydrated fosfomycin loses the inhibition activity. FosX is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=40.33  E-value=34  Score=22.96  Aligned_cols=19  Identities=11%  Similarity=0.158  Sum_probs=16.2

Q ss_pred             ceeEEEEcCCCcEEEeecC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~   61 (106)
                      .-.+|+.||+|..+.++..
T Consensus       104 g~~~yf~DPdG~~iEl~~~  122 (131)
T cd08364         104 GRSIYFYDFDNHLFELHTG  122 (131)
T ss_pred             ceEEEEECCCCCEEEEecC
Confidence            4589999999999999753


No 106
>PRK04101 fosfomycin resistance protein FosB; Provisional
Probab=40.23  E-value=33  Score=23.18  Aligned_cols=25  Identities=16%  Similarity=0.373  Sum_probs=20.3

Q ss_pred             cceeEEEEcCCCcEEEeecCCCCHH
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKKPE   66 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~spe   66 (106)
                      +...+|+.||+|..+.+.....+++
T Consensus       100 ~~~~~~~~DPdGn~iEl~~~~~~~~  124 (139)
T PRK04101        100 DKKSIYFTDPDGHKFEFHTGTLQDR  124 (139)
T ss_pred             CceEEEEECCCCCEEEEEeCCHHHH
Confidence            5688999999999999877666443


No 107
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=40.14  E-value=31  Score=22.47  Aligned_cols=15  Identities=13%  Similarity=0.089  Sum_probs=12.8

Q ss_pred             eEEEEcCCCcEEEee
Q psy17586         45 IMYLIDPEGLFVDYY   59 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f   59 (106)
                      .+|+.||||..+.++
T Consensus       108 ~~~~~DPdG~~ie~~  122 (124)
T cd09012         108 GRSFADLDGHLWEVL  122 (124)
T ss_pred             EEEEECCCCCEEEEE
Confidence            369999999998875


No 108
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif. TryX is involved in the regulation of oxidative stress in parasitic trypanosomatids by reducing TryX peroxidase, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. TryX derives reducing equivalents from reduced trypanothione, a polyamine peptide conjugate unique to trypanosomatids, which is regenerated by the NADPH-dependent flavoprotein trypanothione reductase. Vertebrate NRX is a 400-amino acid nuclear protein with one redox active TRX domain containing a CPPC active site motif followed by one redox inactive TRX-like domain. Mouse NRX transcripts are expressed in all adult tissues but is restricted to the nervous system and limb buds in embryos. Plant NRX, longer than the 
Probab=39.93  E-value=22  Score=23.79  Aligned_cols=22  Identities=18%  Similarity=0.401  Sum_probs=18.8

Q ss_pred             ceeEecceeEEEEcCCCcEEEe
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~   58 (106)
                      .|-|-..-.+||+|++|+.+..
T Consensus        94 ~~~v~~~P~~~lid~~G~i~~~  115 (131)
T cd03009          94 TFKIEGIPTLIILDADGEVVTT  115 (131)
T ss_pred             HcCCCCCCEEEEECCCCCEEcc
Confidence            4788888999999999997754


No 109
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase. This subfamily contains the N-terminal, non-catalytic, domain of THT oxygenase. THT oxygenase is an extradiol dioxygenase in the 2,4-dinitrotoluene (DNT) degradation pathway. It catalyzes the conversion of 2,4,5-trihydroxytoluene to an unstable ring fission product, 2,4-dihydroxy-5-methyl-6-oxo-2,4-hexadienoic acid. The native protein was determined to be a dimer by gel filtration. The enzyme belongs to the type I family of extradiol dioxygenases which contains two structurally homologous barrel-shaped domains at the N- and C-terminus of each monomer. The active-site metal is located in the C-terminal barrel. Fe(II) is required for its catalytic activity.
Probab=39.88  E-value=32  Score=22.22  Aligned_cols=17  Identities=29%  Similarity=0.382  Sum_probs=14.4

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.++-
T Consensus        93 ~~~~~~DPdG~~iEl~~  109 (113)
T cd07267          93 KRVTLTDPDGFPVELVY  109 (113)
T ss_pred             eEEEEECCCCCEEEEEe
Confidence            47899999999998764


No 110
>PRK11478 putative lyase; Provisional
Probab=39.70  E-value=34  Score=22.17  Aligned_cols=18  Identities=28%  Similarity=0.661  Sum_probs=14.7

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      ...+|+.||+|..+.++.
T Consensus       111 ~~~~~~~DPdG~~iEl~~  128 (129)
T PRK11478        111 KRFTFFNDPDGLPLELYE  128 (129)
T ss_pred             CEEEEEECCCCCEEEEEe
Confidence            356899999999988764


No 111
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=39.27  E-value=34  Score=21.55  Aligned_cols=17  Identities=18%  Similarity=0.436  Sum_probs=14.6

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.++-
T Consensus        97 ~~~~~~DP~G~~ie~~~  113 (117)
T cd07240          97 RGLRFQDPDGHLLELFV  113 (117)
T ss_pred             eEEEEECCCCCEEEEEE
Confidence            57899999999998873


No 112
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=39.12  E-value=54  Score=20.46  Aligned_cols=35  Identities=23%  Similarity=0.324  Sum_probs=27.9

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~I   72 (106)
                      .|.|.....+++++ +|+.+..+....+.++|.+.|
T Consensus        61 ~~~i~~~Pt~~~~~-~g~~~~~~~g~~~~~~l~~~l   95 (96)
T cd02956          61 QFGVQALPTVYLFA-AGQPVDGFQGAQPEEQLRQML   95 (96)
T ss_pred             HcCCCCCCEEEEEe-CCEEeeeecCCCCHHHHHHHh
Confidence            58888888899997 999988877777777776643


No 113
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a strep
Probab=38.13  E-value=36  Score=21.51  Aligned_cols=18  Identities=22%  Similarity=0.383  Sum_probs=15.0

Q ss_pred             cceeEEEEcCCCcEEEee
Q psy17586         42 HTIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f   59 (106)
                      +...+|+.||+|..+.++
T Consensus        96 ~~~~~~~~DPdG~~~~l~  113 (114)
T cd07247          96 VGRFAVFADPEGAVFGLW  113 (114)
T ss_pred             cEEEEEEECCCCCEEEeE
Confidence            456899999999988764


No 114
>PF00571 CBS:  CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.;  InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations [].  In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=36.70  E-value=46  Score=18.78  Aligned_cols=18  Identities=17%  Similarity=0.292  Sum_probs=15.6

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      ...+.++|.+|++++++.
T Consensus        30 ~~~~~V~d~~~~~~G~is   47 (57)
T PF00571_consen   30 ISRLPVVDEDGKLVGIIS   47 (57)
T ss_dssp             SSEEEEESTTSBEEEEEE
T ss_pred             CcEEEEEecCCEEEEEEE
Confidence            556899999999999976


No 115
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains. The TRX domain functions as a protein disulfide reductase via the reversible oxidation of an active center dithiol present in a CXXC motif, while the NTR domain functions as a reductant to oxidized TRX. The fusion protein is  bifunctional, showing both TRX and NTR activities, but it is not an independent NTR/TRX system. In plants, the protein is found exclusively in shoots and mature leaves and is localized in the chloroplast. It is involved in plant protection against oxidative stress.
Probab=36.46  E-value=51  Score=21.01  Aligned_cols=35  Identities=14%  Similarity=-0.009  Sum_probs=28.4

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~I   72 (106)
                      .|.|.+...+++++ +|+.+..+.-..+.+++.+.|
T Consensus        62 ~~~v~~vPt~~i~~-~g~~v~~~~g~~~~~~~~~~l   96 (97)
T cd02949          62 AAGIMGTPTVQFFK-DKELVKEISGVKMKSEYREFI   96 (97)
T ss_pred             HCCCeeccEEEEEE-CCeEEEEEeCCccHHHHHHhh
Confidence            57889999999995 899999888878887766544


No 116
>PF02625 XdhC_CoxI:  XdhC and CoxI family;  InterPro: IPR003777 This entry is often found in association with an NAD-binding region, related to TrkA-N (IPR003148 from INTERPRO). XdhC is believed to be involved in the attachment of molybdenum to Xanthine Dehydrogenase [].; PDB: 3ON5_A 2WE8_B 2WE7_A.
Probab=36.32  E-value=84  Score=19.93  Aligned_cols=39  Identities=13%  Similarity=0.115  Sum_probs=29.4

Q ss_pred             cceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      ......|+.+||+....+.-+.--.++.+..+..|++.+
T Consensus        25 ~~Ga~mlv~~dg~~~GtigGG~lE~~v~~~A~~~l~~g~   63 (71)
T PF02625_consen   25 KVGAKMLVTPDGETIGTIGGGCLEADVIERAREALAEGR   63 (71)
T ss_dssp             GTT-EEEEETTS-EEE-SSSSCHHHHHHHHHHHHHHHT-
T ss_pred             cccCeEEEeCCCcEEEEeCcHHHHHHHHHHHHHHHHhCC
Confidence            456778999999999999988888888888888885543


No 117
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway. This subfamily contains the C-terminal, catalytic, domain of THT oxygenase. THT oxygenase is an extradiol dioxygenase in the 2,4-dinitrotoluene (DNT) degradation pathway. It catalyzes the conversion of 2,4,5-trihydroxytoluene to an unstable ring fission product, 2,4-dihydroxy-5-methyl-6-oxo-2,4-hexadienoic acid. The native protein was determined to be a dimer by gel filtration. The enzyme belongs to the type I family of extradiol dioxygenases which contains two structurally homologous barrel-shaped domains at the N- and C-terminus of each monomer. The active-site metal is located in the C-terminal barrel. Fe(II) is required for its catalytic activity.
Probab=36.30  E-value=39  Score=23.55  Aligned_cols=20  Identities=35%  Similarity=0.660  Sum_probs=16.2

Q ss_pred             ceeEEEEcCCCcEEEeecCC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~   62 (106)
                      ..++|+-||+|..+.++.-.
T Consensus       107 ~~~~y~~DPdG~~iEl~~~~  126 (153)
T cd07257         107 QIFDYWFDPWGFIVEHYTDG  126 (153)
T ss_pred             CEEEEEECCCCCEEEEEcCc
Confidence            44789999999999988543


No 118
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the N-terminal, non-catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase  (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the N-terminal do
Probab=36.26  E-value=39  Score=21.83  Aligned_cols=17  Identities=18%  Similarity=0.276  Sum_probs=14.6

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+-||+|..+.++.
T Consensus       102 ~~~~~~DPdG~~iE~~~  118 (122)
T cd07265         102 RRVRFQLPSGHTMELYA  118 (122)
T ss_pred             eEEEEECCCCCEEEEEE
Confidence            47899999999998864


No 119
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX. Most members of this family, except RdCVF, are protein disulfide oxidoreductases containing an active site CXXC motif, similar to TRX.
Probab=36.01  E-value=28  Score=23.56  Aligned_cols=22  Identities=23%  Similarity=0.425  Sum_probs=18.8

Q ss_pred             ceeEecceeEEEEcCCCcEEEe
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~   58 (106)
                      .|-|...-.+||+|++|+.+..
T Consensus        94 ~~~v~~iPt~~lid~~G~iv~~  115 (132)
T cd02964          94 QFKVEGIPTLVVLKPDGDVVTT  115 (132)
T ss_pred             HcCCCCCCEEEEECCCCCEEch
Confidence            3788899999999999997754


No 120
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C. Th
Probab=35.92  E-value=39  Score=23.99  Aligned_cols=21  Identities=29%  Similarity=0.714  Sum_probs=17.0

Q ss_pred             ecceeEEEEcCCCcEEEeecC
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~   61 (106)
                      +.+.++|+.||+|..+.++..
T Consensus       107 ~~~~~~y~~DPdG~~iEl~~~  127 (166)
T cd09014         107 QQTFFLYVYEPGGNRVELFGG  127 (166)
T ss_pred             CCceEEEEECCCCCEEEEEEc
Confidence            444569999999999988765


No 121
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=35.47  E-value=45  Score=21.29  Aligned_cols=16  Identities=19%  Similarity=0.603  Sum_probs=13.5

Q ss_pred             eEEEEcCCCcEEEeec
Q psy17586         45 IMYLIDPEGLFVDYYG   60 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~   60 (106)
                      ..|+.||+|..+.++.
T Consensus       109 ~~~~~DPdG~~~~~~~  124 (125)
T cd07264         109 VAYVRDINGFLIELCS  124 (125)
T ss_pred             EEEEECCCCCEEEEec
Confidence            5689999999988764


No 122
>PF13728 TraF:  F plasmid transfer operon protein
Probab=35.08  E-value=53  Score=25.11  Aligned_cols=35  Identities=20%  Similarity=0.229  Sum_probs=26.9

Q ss_pred             eeEecceeEEEEcCCCcEEEeecCCC-CHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEGLFVDYYGQNK-KPEEVSNSI   72 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdGrfv~~f~~~~-speeiAe~I   72 (106)
                      +-|.++-.+||++|+++-..-+.++. +.++|.++|
T Consensus       179 l~v~~~Pal~Lv~~~~~~~~pv~~G~~s~~~L~~ri  214 (215)
T PF13728_consen  179 LGVKVTPALFLVNPNTKKWYPVSQGFMSLDELEDRI  214 (215)
T ss_pred             cCCCcCCEEEEEECCCCeEEEEeeecCCHHHHHHhh
Confidence            67889999999999995555555555 677887765


No 123
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=34.93  E-value=42  Score=21.06  Aligned_cols=17  Identities=29%  Similarity=0.757  Sum_probs=13.8

Q ss_pred             ceeEEEEcCCCcEEEee
Q psy17586         43 TIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f   59 (106)
                      ...+|+.||+|..+.++
T Consensus       108 ~~~~~~~DP~G~~iEl~  124 (125)
T cd08352         108 KRFTFFYDPDGLPLELY  124 (125)
T ss_pred             eEEEEEECCCCCEEEec
Confidence            34689999999988875


No 124
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases.
Probab=34.89  E-value=37  Score=20.66  Aligned_cols=14  Identities=21%  Similarity=0.577  Sum_probs=11.5

Q ss_pred             eeEEEEcCCCcEEE
Q psy17586         44 IIMYLIDPEGLFVD   57 (106)
Q Consensus        44 a~iYLmDPdGrfv~   57 (106)
                      -.+|+.||+|..+.
T Consensus       100 ~~~~~~DP~G~~iE  113 (114)
T cd07245         100 RQLFVRDPDGNRIE  113 (114)
T ss_pred             cEEEEECCCCCEEe
Confidence            46899999998765


No 125
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain. DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network.
Probab=34.87  E-value=59  Score=21.52  Aligned_cols=37  Identities=11%  Similarity=0.004  Sum_probs=28.8

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIV   74 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~   74 (106)
                      .|-|.....++++ ++|+.+..+....+.+++.+-|++
T Consensus        74 ~~~V~~~Pt~~i~-~~g~~~~~~~G~~~~~~l~~~i~~  110 (111)
T cd02963          74 KLGAHSVPAIVGI-INGQVTFYHDSSFTKQHVVDFVRK  110 (111)
T ss_pred             HcCCccCCEEEEE-ECCEEEEEecCCCCHHHHHHHHhc
Confidence            4788888888888 599988887777777777766553


No 126
>PF08448 PAS_4:  PAS fold;  InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs []. The PAS fold appears in archaea, eubacteria and eukarya. ; PDB: 3K3D_A 3K3C_B 3KX0_X 3FC7_B 3LUQ_D 3MXQ_A 3BWL_C 3FG8_A.
Probab=34.57  E-value=43  Score=20.37  Aligned_cols=16  Identities=31%  Similarity=0.501  Sum_probs=13.0

Q ss_pred             ceeEEEEcCCCcEEEe
Q psy17586         43 TIIMYLIDPEGLFVDY   58 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~   58 (106)
                      ...++++|++|+++..
T Consensus         5 p~~i~v~D~~~~i~~~   20 (110)
T PF08448_consen    5 PDGIFVIDPDGRIVYA   20 (110)
T ss_dssp             SSEEEEEETTSBEEEE
T ss_pred             CceeEEECCCCEEEEE
Confidence            3568899999998875


No 127
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin. This family contains three types of fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. The three types of fosfomycin resistance proteins, employ different mechanisms to render fosfomycin [(1R,2S)-epoxypropylphosphonic acid] inactive. FosB catalyzes the addition of L-cysteine to the epoxide ring of fosfomycin. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. FosA catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. Catalytic activities of both FosX and FosA are Mn(II)-dependent, but FosB is activated by Mg(II). Fosfomycin resistant proteins are evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=34.31  E-value=45  Score=20.95  Aligned_cols=17  Identities=24%  Similarity=0.626  Sum_probs=14.6

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+|+.||+|..+.++.
T Consensus        94 ~~~~~~DPdG~~iEi~~  110 (113)
T cd08345          94 RSIYFYDPDGHLLELHA  110 (113)
T ss_pred             eEEEEECCCCCEEEEEe
Confidence            58899999999988874


No 128
>PF00085 Thioredoxin:  Thioredoxin;  InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses the reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide; reduced thioredoxin then directly reduces the disulphide in the substrate protein [].  Thioredoxin is present in prokaryotes and eukaryotes and the sequence around the redox-active disulphide bond is well conserved. All thioredoxins contain a cis-proline located in a loop preceding beta-strand 4, which makes contact with the active site cysteines, and is important for stability and function []. Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase []. Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.  A number of eukaryotic proteins contain domains evolutionary related to thioredoxin, most of them are protein disulphide isomerases (PDI). PDI (5.3.4.1 from EC) [, , ] is an endoplasmic reticulum multi-functional enzyme that catalyses the formation and rearrangement of disulphide bonds during protein folding []. All PDI contains two or three (ERp72) copies of the thioredoxin domain, each of which contributes to disulphide isomerase activity, but which are functionally non-equivalent []. Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity []. The various forms of PDI which are currently known are:   PDI major isozyme; a multifunctional protein that also function as the beta subunit of prolyl 4-hydroxylase (1.14.11.2 from EC), as a component of oligosaccharyl transferase (2.4.1.119 from EC), as thyroxine deiodinase (3.8.1.4 from EC), as glutathione-insulin transhydrogenase (1.8.4.2 from EC) and as a thyroid hormone-binding protein ERp60 (ER-60; 58 Kd microsomal protein). ERp60 was originally thought to be a phosphoinositide-specific phospholipase C isozyme and later to be a protease. ERp72. ERp5.    Bacterial proteins that act as thiol:disulphide interchange proteins that allows disulphide bond formation in some periplasmic proteins also contain a thioredoxin domain. These proteins include:    Escherichia coli DsbA (or PrfA) and its orthologs in Vibrio cholerae (TtcpG) and Haemophilus influenzae (Por). E. coli DsbC (or XpRA) and its orthologues in Erwinia chrysanthemi and H. influenzae. E. coli DsbD (or DipZ) and its H. influenzae orthologue. E. coli DsbE (or CcmG) and orthologues in H. influenzae.  Rhodobacter capsulatus (Rhodopseudomonas capsulata) (HelX), Rhiziobiacae (CycY and TlpA).   This entry represents the thioredoxin domain.; GO: 0045454 cell redox homeostasis; PDB: 3ED3_B 1EP7_A 1EP8_B 1TOF_A 2OE3_B 2OE1_B 2OE0_B 1V98_A 3H79_A 3CXG_A ....
Probab=34.27  E-value=71  Score=19.63  Aligned_cols=37  Identities=16%  Similarity=0.187  Sum_probs=29.0

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIV   74 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~   74 (106)
                      .|.|.....+.++ .+|+.+..+....++++|.+-|++
T Consensus        66 ~~~v~~~Pt~~~~-~~g~~~~~~~g~~~~~~l~~~i~~  102 (103)
T PF00085_consen   66 KYGVKSVPTIIFF-KNGKEVKRYNGPRNAESLIEFIEK  102 (103)
T ss_dssp             HTTCSSSSEEEEE-ETTEEEEEEESSSSHHHHHHHHHH
T ss_pred             ccCCCCCCEEEEE-ECCcEEEEEECCCCHHHHHHHHHc
Confidence            5889888888888 566666677777899999887765


No 129
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors. RdCVF was isolated and identified as a factor that supports cone survival in retinal cultures. Cone photoreceptor loss is responsible for the visual handicap resulting from the inherited disease, retinitis pigmentosa. RdCVF shows 33% similarity to TRX but does not exhibit any detectable thiol oxidoreductase activity.
Probab=34.09  E-value=80  Score=22.87  Aligned_cols=22  Identities=18%  Similarity=0.371  Sum_probs=18.2

Q ss_pred             ceeEecceeEEEEcCCCcEEEe
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~   58 (106)
                      .|-|.--..+||+||+|+.+..
T Consensus       107 ~y~v~~iPt~vlId~~G~Vv~~  128 (146)
T cd03008         107 QFSVEELPTVVVLKPDGDVLAA  128 (146)
T ss_pred             HcCCCCCCEEEEECCCCcEEee
Confidence            3667777889999999998865


No 130
>PF05228 CHASE4:  CHASE4 domain;  InterPro: IPR007892 CHASE4 is an extracellular sensory domain, which is present in various classes of transmembrane receptors that are upstream of signal transduction pathways in prokaryotes. Specifically, CHASE4 domains are found in histidine kinases in archaea and in predicted diguanylate cyclases/phosphodiesterases in bacteria. Environmental factors that are recognised by CHASE4 domains are not known at this time [].
Probab=33.44  E-value=71  Score=21.87  Aligned_cols=37  Identities=11%  Similarity=0.266  Sum_probs=22.6

Q ss_pred             eeEEEEcCCCcEEEeecCCCCH-----HHHHHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKP-----EEVSNSIIVNMMKYE   80 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~sp-----eeiAe~Ir~~l~~~~   80 (106)
                      -.++++|++|+.+-.+..+...     ..+.+.+..+++.-.
T Consensus        51 d~~~~~d~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (161)
T PF05228_consen   51 DLIFILDPDGRVLYSSSKGYDFEPGSFDPIPPSLSQLISDLR   92 (161)
T ss_pred             cEEEEEcCCCCEEEEeccCcccCccccccccHHHHHHHHHHH
Confidence            4689999999999633333322     224456666665544


No 131
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=33.41  E-value=42  Score=22.37  Aligned_cols=18  Identities=17%  Similarity=0.277  Sum_probs=14.3

Q ss_pred             cceeEEEEcCCCcEEEee
Q psy17586         42 HTIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f   59 (106)
                      --..+||+|++|+.+-..
T Consensus       129 ~~p~~fvid~~g~i~~~~  146 (149)
T cd02970         129 QLPGVFVIGPDGTILFAH  146 (149)
T ss_pred             ccceEEEECCCCeEEEEe
Confidence            356899999999977654


No 132
>PF00857 Isochorismatase:  Isochorismatase family;  InterPro: IPR000868 This is a family of hydrolase enzymes. Isochorismatase, also known as 2,3 dihydro-2,3 dihydroxybenzoate synthase catalyses the conversion of isochorismate, in the presence of water, to 2,3-dihydroxybenzoate and pyruvate (3.3.2.1 from EC).; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1XN4_A 3KL2_F 1YZV_A 3IRV_A 1IM5_A 1ILW_A 3PL1_A 1NF9_A 1NF8_A 1X9G_A ....
Probab=33.40  E-value=29  Score=24.21  Aligned_cols=46  Identities=11%  Similarity=0.001  Sum_probs=33.2

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHHhhhcCCcch
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKKKSWFE   89 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~~~~~~~~~~   89 (106)
                      +.+.++|-+..|..........+++.+.+.++++.+++.+.+-++.
T Consensus         1 TaLlvID~Q~~f~~~~~~~~~~~~~i~~i~~l~~~~r~~~~~Vi~~   46 (174)
T PF00857_consen    1 TALLVIDMQNDFINGSLAPPNAEAIIPNINRLLDAARAAGVPVIHT   46 (174)
T ss_dssp             EEEEEES-BHHHHTSTTTSTTHHHHHHHHHHHHHHHHHTTEEEEEE
T ss_pred             CEEEEEeChhhhhcCCccccCHHHHHHHHHHHHHHHHHhCCCeEEE
Confidence            4577888888888333444567889999999999998877655443


No 133
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the large
Probab=33.29  E-value=44  Score=20.74  Aligned_cols=16  Identities=19%  Similarity=0.353  Sum_probs=13.3

Q ss_pred             eeEEEEcCCCcEEEee
Q psy17586         44 IIMYLIDPEGLFVDYY   59 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f   59 (106)
                      ..+|+.||+|..+.+.
T Consensus        96 ~~~~~~DP~G~~ie~~  111 (112)
T cd08349          96 REFAVRDPDGNLLRFG  111 (112)
T ss_pred             EEEEEECCCCCEEEec
Confidence            5679999999988764


No 134
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin. This subfamily family contains FosB, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-Nacetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosB catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin, (1R,2S)-epoxypropylphosphonic acid, rendering it inactive. FosB is evolutionarily related to glyoxalase I and type I extradiol dioxygenases
Probab=33.24  E-value=34  Score=23.04  Aligned_cols=21  Identities=19%  Similarity=0.343  Sum_probs=17.1

Q ss_pred             ceeEEEEcCCCcEEEeecCCC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK   63 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~   63 (106)
                      ...+|+.||+|..+.++....
T Consensus        97 ~~~~~f~DPdG~~iEl~~~~~  117 (131)
T cd08363          97 RKSIYFTDPDGHKLEVHTGTL  117 (131)
T ss_pred             ceEEEEECCCCCEEEEecCcH
Confidence            357899999999999977543


No 135
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the C-terminal, catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the C-terminal domain.
Probab=33.20  E-value=44  Score=23.04  Aligned_cols=17  Identities=24%  Similarity=0.548  Sum_probs=14.8

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      .++|+.||+|..+.++.
T Consensus       108 ~~~yf~DPdG~~iEl~~  124 (143)
T cd07243         108 QTIYFFDPSGNRNETFA  124 (143)
T ss_pred             eEEEEECCCCCEEEEec
Confidence            56999999999999864


No 136
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=32.90  E-value=49  Score=21.25  Aligned_cols=16  Identities=25%  Similarity=0.476  Sum_probs=13.4

Q ss_pred             eeEEEEcCCCcEEEee
Q psy17586         44 IIMYLIDPEGLFVDYY   59 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f   59 (106)
                      -.+|+.||+|..+.++
T Consensus       107 ~~~~~~DPdG~~ie~~  122 (123)
T cd07262         107 YAAYVRDPDGNKIEAV  122 (123)
T ss_pred             EEEEEECCCCCEEEEe
Confidence            3689999999988765


No 137
>PRK10291 glyoxalase I; Provisional
Probab=32.63  E-value=42  Score=22.14  Aligned_cols=20  Identities=20%  Similarity=0.604  Sum_probs=16.5

Q ss_pred             eeEEEEcCCCcEEEeecCCC
Q psy17586         44 IIMYLIDPEGLFVDYYGQNK   63 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~   63 (106)
                      ...|+.||+|..+.++....
T Consensus       103 ~~~~i~DPdG~~iel~~~~~  122 (129)
T PRK10291        103 VIAFVEDPDGYKIELIEEKD  122 (129)
T ss_pred             EEEEEECCCCCEEEEEEccc
Confidence            35788999999999987654


No 138
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=32.36  E-value=48  Score=21.01  Aligned_cols=16  Identities=19%  Similarity=0.476  Sum_probs=13.4

Q ss_pred             eeEEEEcCCCcEEEee
Q psy17586         44 IIMYLIDPEGLFVDYY   59 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f   59 (106)
                      ...|+.||+|..+.++
T Consensus        98 ~~~~~~DPdGn~ie~~  113 (114)
T cd07261          98 YTFVALDPDGHRLRVF  113 (114)
T ss_pred             cEEEEECCCCCEEEee
Confidence            3579999999998875


No 139
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain clas
Probab=32.35  E-value=44  Score=19.85  Aligned_cols=16  Identities=25%  Similarity=0.652  Sum_probs=13.0

Q ss_pred             cceeEEEEcCCCcEEE
Q psy17586         42 HTIIMYLIDPEGLFVD   57 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~   57 (106)
                      ....+|+.||+|....
T Consensus        96 ~~~~~~~~Dp~G~~~~  111 (112)
T cd06587          96 GGRVAYFRDPDGNLIE  111 (112)
T ss_pred             CcEEEEEECCCCcEEe
Confidence            3578999999998764


No 140
>KOG0180|consensus
Probab=32.15  E-value=56  Score=25.55  Aligned_cols=53  Identities=21%  Similarity=0.198  Sum_probs=40.4

Q ss_pred             CCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHH-HHHHhhhcCCcchh
Q psy17586         35 IFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNM-MKYENLKKKSWFED   90 (106)
Q Consensus        35 ~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l-~~~~~~~~~~~~~~   90 (106)
                      .+|+.|.-|+.=+|+   |-.-.++.++..||++.+.|.+.| .+..|+-+++|=+.
T Consensus       132 ~~DFVvsGTa~e~L~---GmCE~ly~pnmepd~LFetisQa~Lna~DRDalSGwGa~  185 (204)
T KOG0180|consen  132 PKDFVVSGTASEQLY---GMCEALYEPNMEPDELFETISQALLNAVDRDALSGWGAV  185 (204)
T ss_pred             cCCeEEecchHHHHH---HHHHHhcCCCCCHHHHHHHHHHHHHhHhhhhhhccCCeE
Confidence            356777777666665   344567899999999999888776 66779999999653


No 141
>smart00594 UAS UAS domain.
Probab=31.40  E-value=75  Score=21.54  Aligned_cols=36  Identities=19%  Similarity=0.397  Sum_probs=28.4

Q ss_pred             ceeEecceeEEEEcCCC-----cEEEeecCCCCHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEG-----LFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdG-----rfv~~f~~~~speeiAe~I   72 (106)
                      -|.+.---.+-++||+|     ..+..+.-..++++++..|
T Consensus        81 ~~~~~~~P~~~~l~~~~g~~~~~~~~~~~G~~~~~~l~~~l  121 (122)
T smart00594       81 FYKLDSFPYVAIVDPRTGQRVIEWVGVVEGEISPEELMTFL  121 (122)
T ss_pred             hcCcCCCCEEEEEecCCCceeEEEeccccCCCCHHHHHHhh
Confidence            37777788999999998     4566777777899988765


No 142
>PF02563 Poly_export:  Polysaccharide biosynthesis/export protein;  InterPro: IPR003715 The extracellular polysaccharide colanic acid (CA) is produced by species of the family Enterobacteriaceae. In Escherichia coli (strain K12) the CA cluster comprises 19 genes. The wzx gene encodes a protein with multiple transmembrane segments that may function in export of the CA repeat unit from the cytoplasm into the periplasm in a process analogous to O-unit export. The CA gene clusters may be involved in the export of polysaccharide from the cell [].; GO: 0015159 polysaccharide transmembrane transporter activity, 0015774 polysaccharide transport, 0016020 membrane; PDB: 2W8I_E 2W8H_E 2J58_D.
Probab=31.31  E-value=45  Score=21.38  Aligned_cols=35  Identities=26%  Similarity=0.344  Sum_probs=20.3

Q ss_pred             EEEEcCCCcEE-----EeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         46 MYLIDPEGLFV-----DYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        46 iYLmDPdGrfv-----~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      .|.++|||.+.     .+--.+.+.+++.+.|+..++++-
T Consensus        32 ~~~V~~dG~I~lP~iG~v~v~G~T~~e~~~~I~~~l~~~~   71 (82)
T PF02563_consen   32 EYTVDPDGTISLPLIGPVKVAGLTLEEAEEEIKQRLQKYY   71 (82)
T ss_dssp             SEE--TTSEEEETTTEEEE-TT--HHHHHHHHHHHHTTTS
T ss_pred             ceEECCCCcEeecccceEEECCCCHHHHHHHHHHHHHHHh
Confidence            45556666533     333567899999999998886643


No 143
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=31.08  E-value=59  Score=20.57  Aligned_cols=19  Identities=21%  Similarity=0.445  Sum_probs=15.0

Q ss_pred             cceeEEEEcCCCcEEEeec
Q psy17586         42 HTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~   60 (106)
                      +.-.+|+.||+|..+.++.
T Consensus       103 ~~~~~~~~DP~G~~ie~~~  121 (122)
T cd08354         103 GGRSLYFRDPDGNLLELAT  121 (122)
T ss_pred             CeeEEEEECCCCCEEEEec
Confidence            3456899999999988753


No 144
>PRK02134 hypothetical protein; Provisional
Probab=31.06  E-value=50  Score=25.91  Aligned_cols=39  Identities=18%  Similarity=0.320  Sum_probs=29.1

Q ss_pred             EEEcCCCcEEEeec-----CCCCHHHHHHHHHHHHHHHHh-hhcC
Q psy17586         47 YLIDPEGLFVDYYG-----QNKKPEEVSNSIIVNMMKYEN-LKKK   85 (106)
Q Consensus        47 YLmDPdGrfv~~f~-----~~~speeiAe~Ir~~l~~~~~-~~~~   85 (106)
                      =|+|++|.|...+.     ...+++++...++.-|+++.. .|.+
T Consensus        75 sL~d~~G~F~~~~~~~~~~~~~~~~ev~~E~~aQi~~f~~~~G~~  119 (249)
T PRK02134         75 SLTDRDGLLGKWIWQLAEEGTLPLEEIAQELAAQYERFLSLFGRK  119 (249)
T ss_pred             CCcCCCCCccHHHHHHHhhcCCCHHHHHHHHHHHHHHHHHhhCCC
Confidence            48899999876432     356788999999999988887 4544


No 145
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=31.00  E-value=57  Score=20.96  Aligned_cols=16  Identities=25%  Similarity=0.258  Sum_probs=13.1

Q ss_pred             eEEEEcCCCcEEEeec
Q psy17586         45 IMYLIDPEGLFVDYYG   60 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~   60 (106)
                      ..++.||+|..+.+..
T Consensus       106 ~~~~~DPdG~~~~l~~  121 (122)
T cd08355         106 EFTARDPEGNLWTFGT  121 (122)
T ss_pred             EEEEECCCCCEEEEec
Confidence            4789999999888753


No 146
>cd07235 MRD Mitomycin C resistance protein (MRD). Mitomycin C (MC) is a naturally occurring antibiotic, and antitumor agent used in the treatment of cancer. Its antitumor activity is exerted primarily through monofunctional and bifunctional alkylation of DNA. MRD binds to MC and functions as a component of the MC exporting system. MC is bound to MRD by a stacking interaction between a His and a Trp. MRD adopts a structural fold similar to bleomycin resistance protein, glyoxalase I, and extradiol dioxygenases; and it has binding sites at an identical location to binding sites in these evolutionarily related enzymes.
Probab=30.82  E-value=54  Score=21.02  Aligned_cols=16  Identities=31%  Similarity=0.604  Sum_probs=13.5

Q ss_pred             eeEEEEcCCCcEEEee
Q psy17586         44 IIMYLIDPEGLFVDYY   59 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f   59 (106)
                      ...|+-||+|..+.++
T Consensus       106 ~~~~~~DPdG~~iel~  121 (122)
T cd07235         106 RYAIVKDPDGNLVDLF  121 (122)
T ss_pred             EEEEEECCCCCEEEEe
Confidence            4579999999998875


No 147
>PTZ00443 Thioredoxin domain-containing protein; Provisional
Probab=30.55  E-value=1.1e+02  Score=23.64  Aligned_cols=43  Identities=19%  Similarity=0.324  Sum_probs=33.5

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      .|.|..-..+++++ +|+.+.+.....+.+++.+-+....+...
T Consensus       101 ~~~I~~~PTl~~f~-~G~~v~~~~G~~s~e~L~~fi~~~~~~~~  143 (224)
T PTZ00443        101 RFAIKGYPTLLLFD-KGKMYQYEGGDRSTEKLAAFALGDFKKAL  143 (224)
T ss_pred             HcCCCcCCEEEEEE-CCEEEEeeCCCCCHHHHHHHHHHHHHhhc
Confidence            58888888899997 89988887766788888887766665443


No 148
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic gly
Probab=30.52  E-value=52  Score=20.79  Aligned_cols=17  Identities=24%  Similarity=0.675  Sum_probs=13.2

Q ss_pred             cceeEEEEcCCCcEEEe
Q psy17586         42 HTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~   58 (106)
                      ....+|+.||+|..+.+
T Consensus       104 ~~~~~~~~DpdG~~iE~  120 (121)
T cd07233         104 MKGIAFIKDPDGYWIEL  120 (121)
T ss_pred             CceEEEEECCCCCEEEe
Confidence            34568999999988765


No 149
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=30.40  E-value=59  Score=20.09  Aligned_cols=17  Identities=18%  Similarity=0.313  Sum_probs=13.9

Q ss_pred             ceeEEEEcCCCcEEEee
Q psy17586         43 TIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f   59 (106)
                      .-.+|+.||+|..+.+.
T Consensus       102 ~~~~~~~DP~G~~ie~~  118 (119)
T cd07263         102 GTVAVFRDPDGNLFVLV  118 (119)
T ss_pred             ceEEEEECCCCCEEEEe
Confidence            46899999999887763


No 150
>PRK09450 cyaA adenylate cyclase; Provisional
Probab=30.32  E-value=1e+02  Score=28.81  Aligned_cols=38  Identities=13%  Similarity=0.203  Sum_probs=34.7

Q ss_pred             ecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      +++..||++|-.|++-.+.....+.++++..|.++...
T Consensus       750 ~~~~~vyIlDE~n~l~~y~~~~~~~~~lv~~v~rf~~~  787 (830)
T PRK09450        750 EDGFNVYILDESNRLEHYHHCEGSKEELVRDVSRFYSS  787 (830)
T ss_pred             CCceEEEEEcCCCCEEEEEecCCCHHHHHHHHHHHHHh
Confidence            58899999999999999999999999999999999843


No 151
>KOG4614|consensus
Probab=29.90  E-value=1.1e+02  Score=25.02  Aligned_cols=29  Identities=28%  Similarity=0.161  Sum_probs=21.7

Q ss_pred             cceeEEEEcCCCcEEEeecCCCCHHHHHH
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKKPEEVSN   70 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~speeiAe   70 (106)
                      -|..+||+|..|+++=.=--..+|+|+-+
T Consensus       247 l~GyV~L~D~s~kIRW~g~G~aTp~Eve~  275 (287)
T KOG4614|consen  247 LTGYVLLLDKSGKIRWQGFGTATPEEVEQ  275 (287)
T ss_pred             eeEEEEEEccCceEEEeecCCCCHHHHHH
Confidence            47789999999998766555557777544


No 152
>KOG0852|consensus
Probab=29.68  E-value=81  Score=24.68  Aligned_cols=37  Identities=11%  Similarity=0.259  Sum_probs=25.9

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      ..++++||+|.++..--.......-++...+++++++
T Consensus       125 RglfIId~~gi~R~it~NDlpvgRSVdE~lRLvqAfQ  161 (196)
T KOG0852|consen  125 RGLFIIDPDGILRQITINDLPVGRSVDETLRLVQAFQ  161 (196)
T ss_pred             eeeEEEccccceEEeeecccCCCccHHHHHHHHHHHh
Confidence            4689999999988765555555555555556777775


No 153
>TIGR03645 glyox_marine lactoylglutathione lyase family protein. Members of this protein family share homology with lactoylglutathione lyase (glyoxalase I) and are found mainly in marine members of the gammaproteobacteria, including CPS_0532 from Colwellia psychrerythraea 34H. This family excludes a well-separated, more narrowly distributed paralogous family, exemplified by CPS_3492 from C. psychrerythraea. The function is of this protein family is unknown.
Probab=29.63  E-value=59  Score=22.96  Aligned_cols=19  Identities=26%  Similarity=0.660  Sum_probs=16.4

Q ss_pred             eeEEEEcCCCcEEEeecCC
Q psy17586         44 IIMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~   62 (106)
                      ..+|+.||+|..+.++.+.
T Consensus       134 ~~~~~~DPdG~~iEl~~~~  152 (162)
T TIGR03645       134 RMIYMEDPFGNILEIYSHS  152 (162)
T ss_pred             EEEEEECCCCCEEEEEEcC
Confidence            4789999999999998754


No 154
>PF12791 RsgI_N:  Anti-sigma factor N-terminus;  InterPro: IPR024449 The heat shock genes in Bacillus subtilis can be classified into several groups according to their regulation [], and the sigma gene, sigI, of Bacillus subtilis belongs to the group IV heat-shock response genes and has many orthologues in the bacterial phylum Firmicutes []. Regulation of sigma factor I is carried out by RsgI from the same operon. This entry represents the N-terminal cytoplasmic portion of RsgI ('upstream' of the single transmembrane helix) which has been shown to interact directly with Sigma-I [].
Probab=29.25  E-value=60  Score=19.29  Aligned_cols=19  Identities=16%  Similarity=0.403  Sum_probs=14.7

Q ss_pred             eEEEEcCCCcEEEeecCCC
Q psy17586         45 IMYLIDPEGLFVDYYGQNK   63 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~   63 (106)
                      ..++|.|+|+|+..-..+.
T Consensus         7 ~aiVlT~dGeF~~ik~~~~   25 (56)
T PF12791_consen    7 YAIVLTPDGEFIKIKRKPG   25 (56)
T ss_pred             EEEEEcCCCcEEEEeCCCC
Confidence            4789999999999754433


No 155
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the C-terminal, catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as for other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=29.22  E-value=67  Score=22.30  Aligned_cols=22  Identities=32%  Similarity=0.718  Sum_probs=17.1

Q ss_pred             ecceeEEEEcCCCcEEEeecCC
Q psy17586         41 DHTIIMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        41 DHSa~iYLmDPdGrfv~~f~~~   62 (106)
                      ....++|+-||+|..+.+.-..
T Consensus        94 ~~~~~~y~~DPdG~~iE~~~~~  115 (141)
T cd07258          94 SDSIFFYFLDPDGITVEYSFGM  115 (141)
T ss_pred             CCCEEEEEECCCCCEEEEEeCc
Confidence            3446789999999999886544


No 156
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain. This family contains the C-terminal, catalytic domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this family are 
Probab=28.87  E-value=72  Score=21.07  Aligned_cols=18  Identities=28%  Similarity=0.571  Sum_probs=14.8

Q ss_pred             eEEEEcCCCcEEEeecCC
Q psy17586         45 IMYLIDPEGLFVDYYGQN   62 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~   62 (106)
                      .+|+.||+|..+.+....
T Consensus       101 ~~~~~DPdG~~iei~~~~  118 (131)
T cd08343         101 FLYFRDPDGNRVELSAEM  118 (131)
T ss_pred             EEEEECCCCCEEEEEcCC
Confidence            579999999999887543


No 157
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism]
Probab=28.70  E-value=61  Score=19.68  Aligned_cols=15  Identities=27%  Similarity=0.817  Sum_probs=12.3

Q ss_pred             eEEEEcCCCcEEEee
Q psy17586         45 IMYLIDPEGLFVDYY   59 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f   59 (106)
                      .+|+.||+|..+.+.
T Consensus       123 ~~~~~dp~g~~~e~~  137 (138)
T COG0346         123 HVYFRDPDGILIELA  137 (138)
T ss_pred             EEEEECCCCcEEEee
Confidence            899999999877654


No 158
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit. This model represents the S (sigma) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation.
Probab=28.52  E-value=58  Score=23.51  Aligned_cols=23  Identities=17%  Similarity=0.304  Sum_probs=20.3

Q ss_pred             EEEeecCCCCHHHHHHHHHHHHH
Q psy17586         55 FVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        55 fv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      |-+.|+++++++++++.|++.|+
T Consensus       111 v~~vF~pgt~~~~iv~~l~~~~~  133 (134)
T TIGR01501       111 FDRVFAPGTPPEVVIADLKKDLN  133 (134)
T ss_pred             CCEEECcCCCHHHHHHHHHHHhc
Confidence            77899999999999999988763


No 159
>PF09142 TruB_C:  tRNA Pseudouridine synthase II, C terminal;  InterPro: IPR015225 Pseudouridine synthases catalyse the isomerisation of uridine to pseudouridine (Psi) in a variety of RNA molecules, and may function as RNA chaperones. Pseudouridine is the most abundant modified nucleotide found in all cellular RNAs. There are four distinct families of pseudouridine synthases that share no global sequence similarity, but which do share the same fold of their catalytic domain(s) and uracil-binding site and are descended from a common molecular ancestor. The catalytic domain consists of two subdomains, each of which has an alpha+beta structure that has some similarity to the ferredoxin-like fold (note: some pseudouridine synthases contain additional domains). The active site is the most conserved structural region of the superfamily and is located between the two homologous domains. These families are []:   Pseudouridine synthase I, TruA. Pseudouridine synthase II, TruB, which contains and additional C-terminal PUA domain. Pseudouridine synthase RsuA (ribosomal small subunit) and RluC/RluD (ribosomal large subunits), both of which contain an additional N-terminal alpha-L RNA-binding motif.  Pseudouridine synthase TruD, which has a natural circular permutation in the catalytic domain, as well as an insertion of a family-specific alpha+beta subdomain.    TruB is responsible for the pseudouridine residue present in the T loops of virtually all tRNAs. TruB recognises the preformed 3-D structure of the T loop primarily through shape complementarity. It accesses its substrate uridyl residue by flipping out the nucleotide and disrupts the tertiary structure of tRNA []. The C-terminal domain adopts a secondary structure consisting of a four-stranded beta sheet and one alpha helix, similar to that found in PUA domains. It is predominantly involved in RNA-binding, being mostly found in tRNA pseudouridine synthase B (TruB) []. ; GO: 0003723 RNA binding, 0009982 pseudouridine synthase activity, 0001522 pseudouridine synthesis, 0009451 RNA modification; PDB: 1SGV_B.
Probab=28.25  E-value=48  Score=20.38  Aligned_cols=19  Identities=16%  Similarity=0.174  Sum_probs=11.4

Q ss_pred             cceeEEEEcCCCcEEEeec
Q psy17586         42 HTIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~   60 (106)
                      ....+-+++|||+++++..
T Consensus        25 ~~g~~aa~~pdG~lvAL~~   43 (56)
T PF09142_consen   25 PPGPVAAFAPDGRLVALLE   43 (56)
T ss_dssp             --S-EEEE-TTS-EEEEEE
T ss_pred             CCceEEEECCCCcEEEEEE
Confidence            3445668999999999873


No 160
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the C-terminal, catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of 
Probab=27.64  E-value=61  Score=22.76  Aligned_cols=18  Identities=33%  Similarity=0.768  Sum_probs=15.0

Q ss_pred             eeEEEEcCCCcEEEeecC
Q psy17586         44 IIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~   61 (106)
                      .++|+.||+|..+.++..
T Consensus       106 ~~~y~~DPdG~~iEl~~~  123 (161)
T cd07256         106 FFLYLRDPDGHRIEIYTG  123 (161)
T ss_pred             eEEEEECCCCCeEEEeec
Confidence            469999999999998743


No 161
>PF10921 DUF2710:  Protein of unknown function (DUF2710);  InterPro: IPR024296 This family of uncharacterised proteins appears to be restricted to Mycobacteriaceae.
Probab=27.55  E-value=2.3e+02  Score=20.14  Aligned_cols=46  Identities=9%  Similarity=0.148  Sum_probs=36.5

Q ss_pred             CCceeEecceeEEEEcCCCcEEEeecC-----CCCHHHHHHHHHHHHHHHH
Q psy17586         35 IFWFQVDHTIIMYLIDPEGLFVDYYGQ-----NKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus        35 ~~dY~VDHSa~iYLmDPdGrfv~~f~~-----~~speeiAe~Ir~~l~~~~   80 (106)
                      +-+|.||---..-+.|.|||+..+--+     +.+-.+++++|...|.+-+
T Consensus        43 ~itysvdlGDv~avaNSdGrL~~LtLhpgv~t~YshgeLaerlN~ai~alr   93 (109)
T PF10921_consen   43 TITYSVDLGDVRAVANSDGRLLELTLHPGVMTGYSHGELAERLNTAITALR   93 (109)
T ss_pred             cceeeccCCcEEEEecCCCcEEEEEeccchhcCcchHHHHHHHHHHHHHHH
Confidence            447889888899999999999887533     3467899999998886654


No 162
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the C-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dio
Probab=27.46  E-value=60  Score=22.48  Aligned_cols=17  Identities=29%  Similarity=0.919  Sum_probs=14.4

Q ss_pred             eEEEEcCCCcEEEeecC
Q psy17586         45 IMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~   61 (106)
                      ++|+.||+|..+.++..
T Consensus       101 ~~yf~DPdG~~iE~~~~  117 (144)
T cd07239         101 FAYFLDPGGFVIEYTSE  117 (144)
T ss_pred             EEEEECCCCcEEEeccC
Confidence            48999999999987654


No 163
>PHA02533 17 large terminase protein; Provisional
Probab=27.42  E-value=1.3e+02  Score=26.40  Aligned_cols=39  Identities=21%  Similarity=0.257  Sum_probs=31.8

Q ss_pred             eeEEEEcCC---CcEEEeecC-CCCHHHHHHHHHHHHHHHHhh
Q psy17586         44 IIMYLIDPE---GLFVDYYGQ-NKKPEEVSNSIIVNMMKYENL   82 (106)
Q Consensus        44 a~iYLmDPd---Grfv~~f~~-~~speeiAe~Ir~~l~~~~~~   82 (106)
                      +.+-++||.   +|.++.+.. +.++...|+.|..+.+.|..+
T Consensus       331 s~~~V~~~~~~~~r~v~~~~~~~~~~~~~a~~I~~l~~~Yn~a  373 (534)
T PHA02533        331 SALHIIDITEYPYKQVAVYHNNTISPLILPDIIVDYLMEYNEA  373 (534)
T ss_pred             eEEEEEccCCCCcEEEEEEecCCCCHHHHHHHHHHHHHHhCce
Confidence            445788898   999999864 478999999999999988533


No 164
>PRK06724 hypothetical protein; Provisional
Probab=27.22  E-value=65  Score=22.04  Aligned_cols=18  Identities=17%  Similarity=0.390  Sum_probs=14.6

Q ss_pred             eeEEEEcCCCcEEEeecC
Q psy17586         44 IIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~   61 (106)
                      -.+|+.||||..+.++-.
T Consensus       106 ~~~~f~DPdG~~iEl~~~  123 (128)
T PRK06724        106 YTIDFYDPNGFIIEVAYT  123 (128)
T ss_pred             EEEEEECCCCCEEEEEeC
Confidence            467899999999987643


No 165
>PF15384 DUF4610:  Domain of unknown function (DUF4610)
Probab=27.22  E-value=1.3e+02  Score=23.67  Aligned_cols=65  Identities=9%  Similarity=0.015  Sum_probs=40.9

Q ss_pred             eEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHH--HhhhcCCcchhhhhhhccCCCCCCC
Q psy17586         39 QVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKY--ENLKKKSWFEDTIESLTSSGKPAQN  104 (106)
Q Consensus        39 ~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~--~~~~~~~~~~~~~~~~~~~~~~~~~  104 (106)
                      +.||++.+.|=... .-+.+=-+..+.-+-+++|+.++-..  +...+..=++++.+.+++-+|+.++
T Consensus        84 lqed~a~Ltls~g~-s~L~~dL~k~p~~Ea~~~Lq~L~f~lAe~v~~Le~~Laa~~~~a~sp~Ks~~~  150 (197)
T PF15384_consen   84 LQEDRASLTLSGGP-SALTFDLSKVPAPEAAPRLQALTFRLAERVCSLERRLAAVEETAASPRKSPQP  150 (197)
T ss_pred             EecCeEEEEecCCC-ccceEEhhhCCCchhhHHHHHHHHHHHHHHHHHHHHHhhccccccCCCCCCCc
Confidence            45888888884333 33444444555556677888877332  3444455566788888888888754


No 166
>TIGR01570 A_thal_3588 uncharacterized plant-specific domain TIGR01570. This model represents a region of about 170 amino acids found at the C-terminus of a family of plant proteins. These proteins typically have additional highly divergent N-terminal regions rich in low complexity sequence. PSI-BLAST reveals no clear similarity to any characterized protein. At least 12 distinct members are found in Arabidopsis thaliana.
Probab=27.16  E-value=40  Score=25.65  Aligned_cols=12  Identities=42%  Similarity=0.839  Sum_probs=9.9

Q ss_pred             ceeEEEEcCCCc
Q psy17586         43 TIIMYLIDPEGL   54 (106)
Q Consensus        43 Sa~iYLmDPdGr   54 (106)
                      |-.+|+|||+|.
T Consensus       138 SEsfyminPdg~  149 (161)
T TIGR01570       138 SESFYMINPEGN  149 (161)
T ss_pred             ceeEEeECCCCC
Confidence            557899999985


No 167
>PF11065 DUF2866:  Protein of unknown function (DUF2866);  InterPro: IPR021294  This bacterial family of proteins have no known function. 
Probab=27.08  E-value=76  Score=20.78  Aligned_cols=28  Identities=18%  Similarity=0.305  Sum_probs=21.3

Q ss_pred             EcCCCcEE-EeecCCCCHHHHHHHHHHHH
Q psy17586         49 IDPEGLFV-DYYGQNKKPEEVSNSIIVNM   76 (106)
Q Consensus        49 mDPdGrfv-~~f~~~~speeiAe~Ir~~l   76 (106)
                      ||-+|+.. ..++.+.++.+|++.|+...
T Consensus        27 i~~~g~~~RrvVpa~~T~~EIa~~ir~hv   55 (65)
T PF11065_consen   27 IDHDGRISRRVVPADSTEAEIAEAIRSHV   55 (65)
T ss_pred             ecCCcceeEEeecccCChHHHHHHHHccC
Confidence            56667654 45688889999999998776


No 168
>PF04759 DUF617:  Protein of unknown function, DUF617;  InterPro: IPR006460  This family of hypothetical plant proteins are defined by a region of about 170 amino acids found at the C terminus. These proteins have highly divergent N-terminal regions rich in low complexity sequence. PSI-BLAST reveals no clear similarity to any characterised protein. At least 12 distinct members are found in Arabidopsis thaliana (Mouse-ear cress).
Probab=26.82  E-value=40  Score=25.72  Aligned_cols=13  Identities=31%  Similarity=0.618  Sum_probs=10.3

Q ss_pred             ceeEEEEcCCCcE
Q psy17586         43 TIIMYLIDPEGLF   55 (106)
Q Consensus        43 Sa~iYLmDPdGrf   55 (106)
                      |=.+|+|||||.-
T Consensus       143 SEsfyminPdg~~  155 (166)
T PF04759_consen  143 SESFYMINPDGNG  155 (166)
T ss_pred             cceeEEECCCCCC
Confidence            4578999999953


No 169
>TIGR01352 tonB_Cterm TonB family C-terminal domain. This model represents the C-terminal of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to help span the periplasm.
Probab=26.74  E-value=1.1e+02  Score=18.25  Aligned_cols=37  Identities=11%  Similarity=0.223  Sum_probs=21.1

Q ss_pred             ceeEEEEcCCCcEEEeecCCCC-HHHHHHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNKK-PEEVSNSIIVNMMKY   79 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~s-peeiAe~Ir~~l~~~   79 (106)
                      ...-+.+|++|++...---..+ ...+-+...+.++.+
T Consensus        12 v~v~~~i~~~G~v~~~~i~~ssg~~~ld~~a~~av~~~   49 (74)
T TIGR01352        12 VVVRFTVDADGRVTSVSVLKSSGDEALDRAALEAVRKA   49 (74)
T ss_pred             EEEEEEECCCCCEEEEEEEEcCCChhHHHHHHHHHHhC
Confidence            3456899999998765322222 234444445555554


No 170
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=26.62  E-value=74  Score=20.19  Aligned_cols=17  Identities=24%  Similarity=0.497  Sum_probs=14.0

Q ss_pred             ceeEEEEcCCCcEEEee
Q psy17586         43 TIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f   59 (106)
                      ...+|+.||+|..+.++
T Consensus       102 ~~~~~~~DP~G~~ie~~  118 (119)
T cd08359         102 QRHFIVRDPNGVLIDIV  118 (119)
T ss_pred             ceEEEEECCCCCEEEEE
Confidence            35789999999988875


No 171
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein.  These APIs catalyze the conversion of the pentose pathway intermediate D-ribulose 5-phosphate into A5P, a precursor of 3-deoxy-D-manno-octulosonate, which is an integral carbohydrate component of various glycolipids coating the surface of the outer membrane of Gram-negative bacteria, including lipopolysaccharide and many group 2 K-antigen capsules. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other funct
Probab=26.58  E-value=76  Score=19.62  Aligned_cols=19  Identities=16%  Similarity=0.349  Sum_probs=15.6

Q ss_pred             ceeEEEEcCCCcEEEeecC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~   61 (106)
                      ...++++|.+|++++++..
T Consensus        25 ~~~~~v~d~~~~~~G~v~~   43 (114)
T cd04604          25 LGMTAVVDEDGRLVGIFTD   43 (114)
T ss_pred             ccEEEEEcCCCCEEEEech
Confidence            4577899999999999874


No 172
>PF02772 S-AdoMet_synt_M:  S-adenosylmethionine synthetase, central domain;  InterPro: IPR022629  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the central domain and is found in association with PF00438 from PFAM and PF02773 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3S82_B 2OBV_A 3RV2_A 1FUG_A 1RG9_D 1XRA_A 1P7L_C 1XRB_A 1MXA_A 1MXB_A ....
Probab=26.57  E-value=38  Score=24.32  Aligned_cols=18  Identities=33%  Similarity=0.602  Sum_probs=11.1

Q ss_pred             ceeEecceeEEEEcCCCcE
Q psy17586         37 WFQVDHTIIMYLIDPEGLF   55 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrf   55 (106)
                      .|.+|.- .-|++||.|+|
T Consensus       103 ~~~~~~~-t~~~INPtGrF  120 (120)
T PF02772_consen  103 EYLLDED-TKILINPTGRF  120 (120)
T ss_dssp             GGG-BTT--EEEESTTS--
T ss_pred             cccCCCC-cEEEECCCCCC
Confidence            3557766 88999999997


No 173
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals. ETEA shows homology to Fas-associated factor 1 (FAF1); both containing UAS and UBX (ubiquitin-associated) domains. Compared to FAF1, however, ETEA lacks the ubiquitin-associated UBA domain and a nuclear targeting domain. The function of ETEA is still unknown. A yeast two-hybrid assay showed that it can interact with Fas. Because of its homology to FAF1, it is postulated that ETEA could be involved in modulating Fas-mediated apoptosis of T-cells and eosinophils of atopic dermatitis patients, making them more resistant to apoptosis.
Probab=26.23  E-value=1.5e+02  Score=20.33  Aligned_cols=39  Identities=18%  Similarity=0.139  Sum_probs=28.4

Q ss_pred             EecceeEEEE---cCCCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         40 VDHTIIMYLI---DPEGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        40 VDHSa~iYLm---DPdGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      +..-.++-++   +.+..++..+.-..+|+++...|+.++.+
T Consensus        74 ~~~~P~~~~l~~~~~~~~vv~~i~G~~~~~~ll~~L~~~~~~  115 (116)
T cd02991          74 ERTYPFLAMIMLKDNRMTIVGRLEGLIQPEDLINRLTFIMDA  115 (116)
T ss_pred             CCCCCEEEEEEecCCceEEEEEEeCCCCHHHHHHHHHHHHhc
Confidence            3345556666   55556677777788999999999988754


No 174
>PRK10996 thioredoxin 2; Provisional
Probab=26.20  E-value=1.2e+02  Score=21.06  Aligned_cols=38  Identities=11%  Similarity=0.149  Sum_probs=28.6

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVN   75 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~   75 (106)
                      .|-|.....+.++ ++|+.+..+.-..+.+++.+.|.++
T Consensus       101 ~~~V~~~Ptlii~-~~G~~v~~~~G~~~~e~l~~~l~~~  138 (139)
T PRK10996        101 RFRIRSIPTIMIF-KNGQVVDMLNGAVPKAPFDSWLNEA  138 (139)
T ss_pred             hcCCCccCEEEEE-ECCEEEEEEcCCCCHHHHHHHHHHh
Confidence            5778777777766 5999998887777777777766554


No 175
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms]
Probab=26.05  E-value=65  Score=29.11  Aligned_cols=56  Identities=23%  Similarity=0.268  Sum_probs=32.6

Q ss_pred             cceeEEEEcCCCcEEEeecCCCCHHHHHH--HHHHHHHHHHhhhcCCcchhhhhhhccCCCC
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQNKKPEEVSN--SIIVNMMKYENLKKKSWFEDTIESLTSSGKP  101 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~~~speeiAe--~Ir~~l~~~~~~~~~~~~~~~~~~~~~~~~~  101 (106)
                      -|+.+|||||+|..+..-..+.+---+-.  ..|.++.+.-+.++...|+    -=+++|+|
T Consensus        99 ~ss~iYlid~~G~~iaASNw~~p~SFVG~nyafRpYf~~Am~gg~~r~ya----lGtts~~p  156 (603)
T COG4191          99 GSSAIYLIDPTGLTLAASNWNLPTSFVGRNYAFRPYFQDAMAGGSGRFYA----LGTTSGRP  156 (603)
T ss_pred             cCCeEEEECCCCcEEeeccCCCCCcccccCcccHHHHHHHHhcCCceeEe----eccccCCC
Confidence            47889999999999988766553322222  3455554444444444443    22455554


No 176
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The N-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=25.78  E-value=75  Score=19.98  Aligned_cols=17  Identities=29%  Similarity=0.604  Sum_probs=13.6

Q ss_pred             cceeEEEEcCCCcEEEe
Q psy17586         42 HTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~   58 (106)
                      ....+|+.||+|..+.+
T Consensus       109 ~~~~~~~~DP~G~~iE~  125 (126)
T cd08346         109 GERSIYFEDPDGLRLEL  125 (126)
T ss_pred             ceEEEEEECCCCCEEEe
Confidence            35678999999988765


No 177
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein, called SSP411, is specifically expressed in the testis in an age-dependent manner. The SSP411 mRNA is increased during spermiogenesis and is localized in round and elongated spermatids, suggesting a function in fertility regulation.
Probab=25.76  E-value=99  Score=21.63  Aligned_cols=20  Identities=5%  Similarity=-0.280  Sum_probs=15.6

Q ss_pred             EecceeEEEEcCCCcEEEee
Q psy17586         40 VDHTIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f   59 (106)
                      +.=.-.+.++||+|+.+..+
T Consensus        78 ~~G~Pt~vfl~~~G~~~~~~   97 (124)
T cd02955          78 QGGWPLNVFLTPDLKPFFGG   97 (124)
T ss_pred             CCCCCEEEEECCCCCEEeee
Confidence            44567899999999999443


No 178
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=25.73  E-value=76  Score=19.91  Aligned_cols=17  Identities=24%  Similarity=0.401  Sum_probs=14.1

Q ss_pred             ceeEEEEcCCCcEEEee
Q psy17586         43 TIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f   59 (106)
                      ...+|+.||+|..+.++
T Consensus       103 ~~~~~~~DP~Gn~iei~  119 (121)
T cd07251         103 GYSGYFADPDGHLWEVA  119 (121)
T ss_pred             ceEEEEECCCCCEEEEe
Confidence            45689999999988765


No 179
>PF14326 DUF4384:  Domain of unknown function (DUF4384)
Probab=25.64  E-value=79  Score=20.24  Aligned_cols=23  Identities=17%  Similarity=0.530  Sum_probs=17.8

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPE   66 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~spe   66 (106)
                      ..+|-+|++|+...+||.....+
T Consensus        21 l~l~~~~~~G~v~~L~Pn~~~~~   43 (83)
T PF14326_consen   21 LYLFYIDADGKVTLLFPNRYQPD   43 (83)
T ss_pred             EEEEEECCCCCEEEEecCccccC
Confidence            35777899999999998765544


No 180
>PF10084 DUF2322:  Uncharacterized protein conserved in bacteria (DUF2322);  InterPro: IPR016755 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=25.48  E-value=1.4e+02  Score=20.99  Aligned_cols=27  Identities=22%  Similarity=0.263  Sum_probs=23.1

Q ss_pred             EecceeEEEEcCCCcEEEeecCCCCHH
Q psy17586         40 VDHTIIMYLIDPEGLFVDYYGQNKKPE   66 (106)
Q Consensus        40 VDHSa~iYLmDPdGrfv~~f~~~~spe   66 (106)
                      |||-+.+=|+|.+|..+..++..-.-.
T Consensus        11 i~hl~~l~l~d~~g~~v~~I~n~pGk~   37 (100)
T PF10084_consen   11 IDHLAGLDLLDADGNVVAHIENKPGKL   37 (100)
T ss_pred             ccceeeeEeecCCCcEEEEecCCCCcc
Confidence            899999999999999999987655433


No 181
>PRK05788 cobalamin biosynthesis protein CbiG; Validated
Probab=24.95  E-value=1.4e+02  Score=24.24  Aligned_cols=35  Identities=14%  Similarity=0.166  Sum_probs=29.8

Q ss_pred             eeEEEEcCCCcEEEeecCCC--CHHHHHHHHHHHHHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNK--KPEEVSNSIIVNMMK   78 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~--speeiAe~Ir~~l~~   78 (106)
                      ..+.++|.+|+|+--+-.++  .+.+++..|..+|..
T Consensus        79 PaVvvvDe~G~~vIsLLsGH~GGAN~LA~~iA~~lga  115 (315)
T PRK05788         79 PAVVVVDEKGKFVISLLSGHHGGANELARDLAKILGA  115 (315)
T ss_pred             CCEEEEeCCCCEEEEcccCCcccHHHHHHHHHHHhCC
Confidence            47899999999999887776  489999999988743


No 182
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzi
Probab=24.94  E-value=86  Score=19.22  Aligned_cols=18  Identities=11%  Similarity=0.279  Sum_probs=15.0

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      ...++++|++|++++.+.
T Consensus        24 ~~~~~v~d~~g~~~Giv~   41 (106)
T cd04582          24 LRALTVVDADGQPLGFVT   41 (106)
T ss_pred             CCEEEEECCCCCEEEEEe
Confidence            346889999999999886


No 183
>PF14284 PcfJ:  PcfJ-like protein
Probab=24.86  E-value=73  Score=23.42  Aligned_cols=66  Identities=15%  Similarity=0.128  Sum_probs=30.9

Q ss_pred             eeecC--CccccceeeEEEEEecccccCCCCceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHHHHHHHHHH
Q psy17586          8 HFIGG--TLPLCRPLMYSIISTIPYLLSFIFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSIIVNMMKYE   80 (106)
Q Consensus         8 ~~~~g--~~~~~~~~~y~v~~~~~~~~~~~~dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~Ir~~l~~~~   80 (106)
                      |-+||  =...+..-...|++-+........-|||.-       +|+|+++..-+....+-+..+.+..++.+|.
T Consensus        95 HCV~s~~Y~~~~~~g~~~I~~~r~~~~~~~~~~TiEv-------~~~~~i~Q~rg~~N~~~~~~~~i~~~v~~w~  162 (169)
T PF14284_consen   95 HCVGSNRYAERIAKGESLIFSLRKKEEPEEPYYTIEV-------RPDGRIVQARGKCNRQPKYPEEIKEFVNKWA  162 (169)
T ss_pred             cCCCcHHHHHHHhcCCeEEEEEEecCCCceeeEEEEE-------CCCCeehhhhccccCCCCChHHHHHHHHHHH
Confidence            33444  233344333555554333222222356664       7788866555444433223444444555553


No 184
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=24.79  E-value=75  Score=20.00  Aligned_cols=13  Identities=31%  Similarity=0.629  Sum_probs=10.7

Q ss_pred             EEEEcCCCcEEEe
Q psy17586         46 MYLIDPEGLFVDY   58 (106)
Q Consensus        46 iYLmDPdGrfv~~   58 (106)
                      +|+.||+|..+.+
T Consensus       112 ~~~~DPdG~~iE~  124 (125)
T cd07241         112 SVILDPEGNRIEI  124 (125)
T ss_pred             EEEECCCCCEEEe
Confidence            5788999998765


No 185
>PRK12359 flavodoxin FldB; Provisional
Probab=24.55  E-value=1.9e+02  Score=21.46  Aligned_cols=44  Identities=9%  Similarity=-0.033  Sum_probs=28.7

Q ss_pred             CCceeEecceeEEEEcCCCcEEEeecCCCCHHH-HHHHHHHHHHHHH
Q psy17586         35 IFWFQVDHTIIMYLIDPEGLFVDYYGQNKKPEE-VSNSIIVNMMKYE   80 (106)
Q Consensus        35 ~~dY~VDHSa~iYLmDPdGrfv~~f~~~~spee-iAe~Ir~~l~~~~   80 (106)
                      .++|..+||.++  .|-.++|+++--...+-.+ --++|.+.++.-+
T Consensus       121 ~~gY~f~~s~a~--~~~~~~f~gl~lD~~nq~~~t~~ri~~W~~~~~  165 (172)
T PRK12359        121 TEGYEFTSSKPL--TADGQLFVGLALDEVNQYDLSDERIQQWCEQIL  165 (172)
T ss_pred             CCCcccccceee--EcCCCEEEEEEEcCCCchhhhHHHHHHHHHHHH
Confidence            467999999886  4444569998755554433 4456666665433


No 186
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins. Domain present in all 3 forms of cellular life. Present in two copies in inosine monophosphate dehydrogenase, of which one is disordered in the crystal structure [3]. A number of disease states are associated with CBS-containing proteins including homocystinuria, Becker's and Thomsen disease.
Probab=24.40  E-value=65  Score=16.12  Aligned_cols=17  Identities=24%  Similarity=0.288  Sum_probs=13.6

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      ..+++++.+|++++++.
T Consensus        24 ~~~~v~~~~~~~~g~i~   40 (49)
T smart00116       24 RRLPVVDEEGRLVGIVT   40 (49)
T ss_pred             CcccEECCCCeEEEEEE
Confidence            35678898899988876


No 187
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functio
Probab=24.33  E-value=1.2e+02  Score=17.50  Aligned_cols=35  Identities=17%  Similarity=0.139  Sum_probs=24.5

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSNSI   72 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe~I   72 (106)
                      .|-|.....++++ ++|+.+..+....+++++...|
T Consensus        58 ~~~v~~~P~~~~~-~~g~~~~~~~g~~~~~~l~~~i   92 (93)
T cd02947          58 EYGVRSIPTFLFF-KNGKEVDRVVGADPKEELEEFL   92 (93)
T ss_pred             hcCcccccEEEEE-ECCEEEEEEecCCCHHHHHHHh
Confidence            5778887777777 5677777777666666666544


No 188
>smart00732 YqgFc Likely ribonuclease with RNase H fold. YqgF proteins are likely to function as an alternative to RuvC in most bacteria, and could be the principal holliday junction resolvases in low-GC Gram-positive bacteria. In Spt6p orthologues, the catalytic residues are substituted indicating that they lack enzymatic functions.
Probab=24.24  E-value=1.2e+02  Score=19.01  Aligned_cols=37  Identities=19%  Similarity=0.172  Sum_probs=22.9

Q ss_pred             ceeEEEEcCCCcEEEeecCCC--CHHHHHHHHHHHHHHH
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK--KPEEVSNSIIVNMMKY   79 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~--speeiAe~Ir~~l~~~   79 (106)
                      ...+-++|++|++........  +.+++.+.|..++.++
T Consensus        12 ~i~~a~~d~~g~~~~~~~~~~~~~~~~~~~~l~~~i~~~   50 (99)
T smart00732       12 GIGVAVVDETGKLADPLEVIPRTNKEADAARLKKLIKKY   50 (99)
T ss_pred             eEEEEEECCCCCEecCEEEEEecCcchHHHHHHHHHHHh
Confidence            345556777777665433222  3456788888888765


No 189
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=23.98  E-value=85  Score=20.78  Aligned_cols=17  Identities=24%  Similarity=0.651  Sum_probs=13.9

Q ss_pred             eeEEEEcCCCcEEEeec
Q psy17586         44 IIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~   60 (106)
                      -.+|+-||+|..+.++.
T Consensus       124 r~~~~~DPdG~~iEl~e  140 (142)
T cd08353         124 RLCYIRGPEGILIELAE  140 (142)
T ss_pred             EEEEEECCCCCEEEeee
Confidence            35789999999988764


No 190
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=23.80  E-value=1.7e+02  Score=21.09  Aligned_cols=27  Identities=22%  Similarity=0.295  Sum_probs=22.0

Q ss_pred             EcCCCcEEEeecCCCCHHHHHHHHHHH
Q psy17586         49 IDPEGLFVDYYGQNKKPEEVSNSIIVN   75 (106)
Q Consensus        49 mDPdGrfv~~f~~~~speeiAe~Ir~~   75 (106)
                      ++|+|.++...|...+.++|.+-|+..
T Consensus         7 v~~dg~i~V~aP~~~s~~~I~~fl~~~   33 (205)
T PF01863_consen    7 VDPDGEIVVSAPPRVSKEEIERFLRSK   33 (205)
T ss_pred             EcCCCEEEEEECCCCCHHHHHHHHHHH
Confidence            678999999999999998876655543


No 191
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=23.68  E-value=84  Score=20.43  Aligned_cols=16  Identities=25%  Similarity=0.405  Sum_probs=13.4

Q ss_pred             eeEEEEcCCCcEEEee
Q psy17586         44 IIMYLIDPEGLFVDYY   59 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f   59 (106)
                      ..+|+.||||..+.+.
T Consensus        97 r~f~~~DPdGn~~~~~  112 (113)
T cd08356          97 REFFLHDPSGVLWHIG  112 (113)
T ss_pred             EEEEEECCCccEEEee
Confidence            5799999999988763


No 192
>PF13426 PAS_9:  PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A ....
Probab=23.47  E-value=86  Score=18.66  Aligned_cols=14  Identities=21%  Similarity=0.643  Sum_probs=11.2

Q ss_pred             eEEEEcCCCcEEEe
Q psy17586         45 IMYLIDPEGLFVDY   58 (106)
Q Consensus        45 ~iYLmDPdGrfv~~   58 (106)
                      .++++|++|+++..
T Consensus         3 ~i~i~d~~g~i~~~   16 (104)
T PF13426_consen    3 GIFILDPDGRILYV   16 (104)
T ss_dssp             EEEEEETTSBEEEE
T ss_pred             EEEEECCcCcEEeh
Confidence            57889999987765


No 193
>PF06057 VirJ:  Bacterial virulence protein (VirJ);  InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins. VirJ is thought to be involved in the type IV secretion system. It is thought that the substrate proteins localised to the periplasm may associate with the pilus in a manner that is mediated by VirJ, and suggest a two-step process for type IV secretion in Agrobacterium [].
Probab=23.46  E-value=76  Score=24.52  Aligned_cols=26  Identities=15%  Similarity=0.399  Sum_probs=21.6

Q ss_pred             EeecCCCCHHHHHHHHHHHHHHHHhh
Q psy17586         57 DYYGQNKKPEEVSNSIIVNMMKYENL   82 (106)
Q Consensus        57 ~~f~~~~speeiAe~Ir~~l~~~~~~   82 (106)
                      .+|-...+|++++++|.++|+.|.+.
T Consensus        39 ~Yfw~~rtP~~~a~Dl~~~i~~y~~~   64 (192)
T PF06057_consen   39 RYFWSERTPEQTAADLARIIRHYRAR   64 (192)
T ss_pred             HHHhhhCCHHHHHHHHHHHHHHHHHH
Confidence            45667889999999999999988644


No 194
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase. Members of this family all are enzymes active as catechol 2,3 dioxygenase (1.13.11.2), although some members have highly significant activity on catechol derivatives such as 3-methylcatechol, 3-chlorocatechol, and 4-chlorocatechol (see Mars, et al.). This enzyme is also called metapyrocatechase, as it performs a meta-cleavage (an extradiol ring cleavage), in contrast to the ortho-cleavage (intradiol ring cleavage)performed by catechol 1,2-dioxygenase (EC 1.13.11.1), also called pyrocatechase.
Probab=23.41  E-value=77  Score=24.28  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=15.9

Q ss_pred             cceeEEEEcCCCcEEEee
Q psy17586         42 HTIIMYLIDPEGLFVDYY   59 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f   59 (106)
                      +..++|+.||+|..+.++
T Consensus       246 ~~~~~y~~DPdG~~iEl~  263 (303)
T TIGR03211       246 RGQTIYFFDPSGNRNETF  263 (303)
T ss_pred             CceEEEEECCCCCEEEEe
Confidence            456899999999999987


No 195
>PF01939 DUF91:  Protein of unknown function DUF91;  InterPro: IPR002793  The function of these prokaryotic proteins is unknown. Computational analysis suggests that they may form a restriction endonuclease-like fold, similar to that found in a variety of endonucleases and DNA repair enzymes [].; PDB: 2VLD_A.
Probab=23.33  E-value=2.4e+02  Score=22.27  Aligned_cols=39  Identities=8%  Similarity=0.035  Sum_probs=26.2

Q ss_pred             eEEEEcCCCcEEEeecCCC-CHHHHHHHHHHHHHHHHhhh
Q psy17586         45 IMYLIDPEGLFVDYYGQNK-KPEEVSNSIIVNMMKYENLK   83 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~-speeiAe~Ir~~l~~~~~~~   83 (106)
                      =++-.|.+|+++..=--.. ...+.++++.+++...++..
T Consensus       139 DiL~~D~~G~~VVIElKR~~a~~~aV~QL~rY~~~l~~~~  178 (228)
T PF01939_consen  139 DILAKDKDGNLVVIELKRRRADRDAVEQLLRYVELLKRDP  178 (228)
T ss_dssp             EEEEE-TTS-EEEEEE-SS-B-HHHHHHHHHHHHHHHHHH
T ss_pred             eEEEECCCCCEEEEEEEeccCCHHHHHHHHHHHHHHhhcc
Confidence            4788999999887754433 55678888888988776544


No 196
>PF07293 DUF1450:  Protein of unknown function (DUF1450);  InterPro: IPR009910 This entry consists of several hypothetical bacterial proteins of around 80 residues in length representing two families. Members contain four highly conserved cysteine residues and their function is unknown.
Probab=23.23  E-value=1.2e+02  Score=20.23  Aligned_cols=23  Identities=22%  Similarity=0.271  Sum_probs=18.6

Q ss_pred             CCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         52 EGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        52 dGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      +|+.+..    .+++++.+.|.+.|++
T Consensus        52 nG~~V~A----~t~eeL~~kI~~~i~e   74 (78)
T PF07293_consen   52 NGEIVAA----ETAEELLEKIKEKIEE   74 (78)
T ss_pred             CCEEEec----CCHHHHHHHHHHHHhc
Confidence            3887765    7899999999998864


No 197
>PF06018 CodY:  CodY GAF-like domain;  InterPro: IPR010312 This family consists of several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions []. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk [].; GO: 0003677 DNA binding, 0005525 GTP binding; PDB: 2HGV_A 2GX5_D 2B0L_C 2B18_A.
Probab=22.66  E-value=1.4e+02  Score=22.78  Aligned_cols=20  Identities=20%  Similarity=0.373  Sum_probs=15.9

Q ss_pred             eeEEEEcCCCcEEEeecCCC
Q psy17586         44 IIMYLIDPEGLFVDYYGQNK   63 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~   63 (106)
                      +.+|+++.+|++.++.-...
T Consensus        36 aNvyIis~kGkiLGy~~~~~   55 (177)
T PF06018_consen   36 ANVYIISRKGKILGYSFIDD   55 (177)
T ss_dssp             SEEEEEETTSBEEEEE-SS-
T ss_pred             CcEEEEeCCccEEEEeccCC
Confidence            68999999999999876544


No 198
>PRK06777 4-aminobutyrate aminotransferase; Provisional
Probab=22.61  E-value=1.7e+02  Score=24.11  Aligned_cols=42  Identities=17%  Similarity=0.345  Sum_probs=30.8

Q ss_pred             eeEecceeEEEEcCCCc-EEEee------cCCCCHHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEGL-FVDYY------GQNKKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdGr-fv~~f------~~~~speeiAe~Ir~~l~~~   79 (106)
                      +.+.|.-..||.|.||+ +++++      ..+.+..++++.+++.+++.
T Consensus        24 ~~~~~~~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~ai~~ql~~~   72 (421)
T PRK06777         24 FYAERAENATLWDVEGREYIDFAAGIAVLNTGHRHPKVVAAVRQQLDQF   72 (421)
T ss_pred             eeEEeeecCEEEeCCCCEEEEcccCHHhhccCCCCHHHHHHHHHHHhhc
Confidence            67889999999999994 45543      33566777888888877653


No 199
>COG2088 SpoVG Uncharacterized protein, involved in the regulation of septum location [Cell envelope biogenesis, outer membrane]
Probab=22.59  E-value=1.4e+02  Score=20.78  Aligned_cols=33  Identities=21%  Similarity=0.328  Sum_probs=16.2

Q ss_pred             CCCcEEEeecCCCCHHHHHHHHHHHHHHHHhhhc
Q psy17586         51 PEGLFVDYYGQNKKPEEVSNSIIVNMMKYENLKK   84 (106)
Q Consensus        51 PdGrfv~~f~~~~speeiAe~Ir~~l~~~~~~~~   84 (106)
                      |+|.|+..+ ++.+++.-...-...+++|.+...
T Consensus        53 ~dgEFrDI~-HPI~~~~R~kIq~aVl~~Y~~~~~   85 (95)
T COG2088          53 PDGEFRDIA-HPINSDTREKIQDAVLKEYERLDE   85 (95)
T ss_pred             CCcchhhcc-CcCCHHHHHHHHHHHHHHHHHhch
Confidence            556666553 333333322222344577776655


No 200
>PRK13669 hypothetical protein; Provisional
Probab=22.29  E-value=1.3e+02  Score=20.16  Aligned_cols=23  Identities=26%  Similarity=0.468  Sum_probs=18.3

Q ss_pred             CCcEEEeecCCCCHHHHHHHHHHHHHH
Q psy17586         52 EGLFVDYYGQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        52 dGrfv~~f~~~~speeiAe~Ir~~l~~   78 (106)
                      +|+.+..    .++|++++.|.+.|++
T Consensus        52 ng~~V~a----~t~eeL~~kI~~~i~e   74 (78)
T PRK13669         52 NGEVVEG----ETPEELVENIYAHLEE   74 (78)
T ss_pred             CCeEeec----CCHHHHHHHHHHHHhh
Confidence            5676654    7899999999998865


No 201
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. The enzyme from Bacillus brevis contains manganese.
Probab=21.92  E-value=87  Score=23.73  Aligned_cols=20  Identities=30%  Similarity=0.733  Sum_probs=16.2

Q ss_pred             cceeEEEEcCCCcEEEeecC
Q psy17586         42 HTIIMYLIDPEGLFVDYYGQ   61 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~f~~   61 (106)
                      +..++|+.||+|-.+.++..
T Consensus       237 ~~~~~y~~DP~G~~iEl~~~  256 (294)
T TIGR02295       237 NAFFLYLRDPDGHRIELYTG  256 (294)
T ss_pred             cceEEEEECCCCCEEEEEec
Confidence            34569999999999998753


No 202
>PF00480 ROK:  ROK family;  InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames []. This family, known as ROK (Repressor, ORF, Kinase) includes the xylose operon repressor, xylR, from Bacillus subtilis, Lactobacillus pentosus and Staphylococcus xylosus; N-acetylglucosamine repressor, nagC, from Escherichia coli; glucokinase 2.7.1.2 from EC from Streptomyces coelicolor; fructokinase 2.7.1.4 from EC from Pediococcus pentosaceus, Streptococcus mutans and Zymomonas mobilis; allokinase 2.7.1.55 from EC and mlc from E. coli; and E. coli hypothetical proteins yajF and yhcI and the corresponding Haemophilus influenzae proteins. The repressor proteins (xylR and nagC) from this family possess an N-terminal region not present in the sugar kinases and which contains an helix-turn-helix DNA-binding motif.; PDB: 2GUP_A 3LM2_B 3EO3_A 2YHY_A 2YHW_A 2YI1_A 3MCP_A 1Z05_A 3HTV_A 3OHR_A ....
Probab=21.82  E-value=1.9e+02  Score=20.07  Aligned_cols=39  Identities=18%  Similarity=0.249  Sum_probs=29.3

Q ss_pred             ceeEEEEcCCCcEEEeecCC--CCHHHHHHHHHHHHHHHHh
Q psy17586         43 TIIMYLIDPEGLFVDYYGQN--KKPEEVSNSIIVNMMKYEN   81 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~--~speeiAe~Ir~~l~~~~~   81 (106)
                      +..+-|+|-+|+.+..-...  .+++++.+.|..++++..+
T Consensus         8 ~i~~~l~d~~g~ii~~~~~~~~~~~~~~~~~l~~~i~~~~~   48 (179)
T PF00480_consen    8 SIRIALVDLDGEIIYSESIPTPTSPEELLDALAELIERLLA   48 (179)
T ss_dssp             EEEEEEEETTSCEEEEEEEEHHSSHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEECCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHh
Confidence            45677899999887665444  5688888888888877753


No 203
>PRK07482 hypothetical protein; Provisional
Probab=21.75  E-value=1.9e+02  Score=24.29  Aligned_cols=41  Identities=17%  Similarity=0.225  Sum_probs=30.7

Q ss_pred             eeEecceeEEEEcCCC-cEEEeec------CCCCHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEG-LFVDYYG------QNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdG-rfv~~f~------~~~speeiAe~Ir~~l~~   78 (106)
                      -.|++.-..||.|.|| +++++..      .+....+|++.|++.+++
T Consensus        34 ~~i~~a~G~~l~D~dG~~ylD~~sg~~~~~lGh~~p~v~~Av~~q~~~   81 (461)
T PRK07482         34 RIVEGGEGIRITDAQGRRYIDAFAGLYCVNVGYGRTEVAEAIAEQAKE   81 (461)
T ss_pred             eeEEeeeeeEEEECCCCEEEEcccchhhhcCCCCCHHHHHHHHHHHHh
Confidence            5689999999999999 4555543      256677888888877754


No 204
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=21.73  E-value=1.1e+02  Score=19.20  Aligned_cols=18  Identities=17%  Similarity=-0.239  Sum_probs=14.2

Q ss_pred             ceeEEEEcCCCcEEEeec
Q psy17586         43 TIIMYLIDPEGLFVDYYG   60 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~   60 (106)
                      .-.+|+.||+|..+.+..
T Consensus       104 ~~~~~~~DP~G~~~~l~~  121 (122)
T cd07246         104 DRYGGVRDPFGHRWWIAT  121 (122)
T ss_pred             ceEEEEECCCCCEEEEec
Confidence            357899999999887653


No 205
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional
Probab=21.65  E-value=1.8e+02  Score=23.56  Aligned_cols=41  Identities=17%  Similarity=0.205  Sum_probs=30.5

Q ss_pred             eeEecceeEEEEcCCC-cEEEeec------CCCCHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEG-LFVDYYG------QNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdG-rfv~~f~------~~~speeiAe~Ir~~l~~   78 (106)
                      ..+.+.-..||.|.|| ++++++.      -+.+..++++.+++.+.+
T Consensus        23 ~~~~~~~G~~~~d~dG~~~lD~~~g~~~~~lGh~~p~v~~A~~~~~~~   70 (406)
T PRK12381         23 FIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASK   70 (406)
T ss_pred             ceEEEeecCEEEeCCCCEEEEcCcCHhhccCCCCCHHHHHHHHHHHhh
Confidence            4678888999999999 5666543      455667888888877754


No 206
>PF12401 DUF3662:  Protein of unknown function (DUF2662) ;  InterPro: IPR022128  This domain family is found in bacteria, and is approximately 120 amino acids in length. The family is found in association with PF00498 from PFAM. ; PDB: 2LC0_A.
Probab=21.55  E-value=37  Score=23.69  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=22.6

Q ss_pred             CCcEEEeecCCCCHHHHHHHHHHHHHHH
Q psy17586         52 EGLFVDYYGQNKKPEEVSNSIIVNMMKY   79 (106)
Q Consensus        52 dGrfv~~f~~~~speeiAe~Ir~~l~~~   79 (106)
                      +|-|...|+....|-+|+..|++.|++.
T Consensus        13 ~g~Far~F~~~vqPvEIa~~L~remd~~   40 (116)
T PF12401_consen   13 EGAFARVFRSEVQPVEIAKALRREMDDQ   40 (116)
T ss_dssp             STHHHHHHTTSS-THHHHHHHHHHHHHT
T ss_pred             HHHHHHhcCCCCcHHHHHHHHHHHHHhC
Confidence            4556677888899999999999999776


No 207
>PRK06058 4-aminobutyrate aminotransferase; Provisional
Probab=21.30  E-value=2.1e+02  Score=23.72  Aligned_cols=41  Identities=12%  Similarity=0.102  Sum_probs=30.6

Q ss_pred             eeEecceeEEEEcCCC-cEEEee------cCCCCHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEG-LFVDYY------GQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdG-rfv~~f------~~~~speeiAe~Ir~~l~~   78 (106)
                      ..+.+.-..||.|.|| ++++++      ..+....++.+.|++.+++
T Consensus        40 ~~i~~~~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~ai~~q~~~   87 (443)
T PRK06058         40 VYVARAGGGIVEDVDGNRLIDLGSGIAVTSVGNSAPRVVEAVREQVAR   87 (443)
T ss_pred             ceEEeeeeeEEEeCCCCEEEEcCcchhhhccCCCCHHHHHHHHHHHHh
Confidence            5689999999999999 455553      2456677888888877754


No 208
>PF01472 PUA:  PUA domain;  InterPro: IPR002478  The PUA (PseudoUridine synthase and Archaeosine transglycosylase) domain was named after the proteins in which it was first found []. PUA is a highly conserved RNA-binding motif found in a wide range of archaeal, bacterial and eukaryotic proteins, including enzymes that catalyse tRNA and rRNA post-transcriptional modifications, proteins involved in ribosome biogenesis and translation, as well as in enzymes involved in proline biosynthesis [, ]. The structures of several PUA-RNA complexes reveal a common RNA recognition surface, but also some versatility in the way in which the motif binds to RNA []. PUA motifs are involved in dyskeratosis congenita and cancer, pointing to links between RNA metabolism and human diseases [].; GO: 0003723 RNA binding; PDB: 1ZE2_A 1ZE1_A 1R3E_A 2AB4_A 3R90_D 2J5T_A 2J5V_B 1Q7H_A 2APO_A 2RFK_A ....
Probab=21.27  E-value=1.5e+02  Score=18.53  Aligned_cols=26  Identities=19%  Similarity=0.309  Sum_probs=22.7

Q ss_pred             eEEEEcCCCcEEEeecCCCCHHHHHH
Q psy17586         45 IMYLIDPEGLFVDYYGQNKKPEEVSN   70 (106)
Q Consensus        45 ~iYLmDPdGrfv~~f~~~~speeiAe   70 (106)
                      .+.+++++|++++.=....+.++|..
T Consensus        36 ~V~i~~~~g~~ia~G~a~~ss~ei~~   61 (74)
T PF01472_consen   36 EVAIVDEDGEVIAVGRANMSSEEIKK   61 (74)
T ss_dssp             EEEEEETTSSEEEEEEESSTHHHHHH
T ss_pred             EEEEEcCCCeEEEEEEEecCHHHHHH
Confidence            46799999999999999999988765


No 209
>PRK07483 hypothetical protein; Provisional
Probab=21.21  E-value=2.3e+02  Score=23.68  Aligned_cols=41  Identities=22%  Similarity=0.246  Sum_probs=31.0

Q ss_pred             eeEecceeEEEEcCCC-cEEEeec------CCCCHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEG-LFVDYYG------QNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdG-rfv~~f~------~~~speeiAe~Ir~~l~~   78 (106)
                      ..+.+.-..||.|.|| ++++++.      .+.+..+|++.+++.+++
T Consensus        14 ~~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~av~~ql~~   61 (443)
T PRK07483         14 PVAVAGEGIYLIDATGKRYLDASGGAAVSCLGHSHPRVIAAIHAQIDR   61 (443)
T ss_pred             ceEEeceEEEEEeCCCCEEEEcCccHhhhccCCCCHHHHHHHHHHHHh
Confidence            5688999999999999 5556543      556777888888877754


No 210
>PF00932 LTD:  Lamin Tail Domain;  InterPro: IPR001322 Intermediate filaments (IF) are primordial components of the cytoskeleton and the nuclear envelope []. They generally form filamentous structures 8 to 14 nm wide. IF proteins are members of a very large multigene family of proteins which has been subdivided in five major subgroups, type I: acidic cytokeratins, type II: basic cytokeratins, type III: vimentin, desmin, glial fibrillary acidic protein (GFAP), peripherin, and plasticin, type IV: neurofilaments L, H and M, alpha-internexin and nestin, and type V: nuclear lamins A, B1, B2 and C. The lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane that may provide a framework for the nuclear envelope and may interact with chromatin. All IF proteins are structurally similar in that they consist of a central rod domain arranged in coiled-coil alpha-helices, with at least two short characteristic interruptions; a N-terminal non-helical domain (head) of variable length; and a C-terminal domain (tail) which is also non-helical, and which shows extreme length variation between different IF proteins. The C-terminal domain has been charcterised for the lamins.; PDB: 3UMN_A 2KPW_A 3JT0_A 2LLL_A 1UFG_A 3GEF_D 1IFR_A 1IVT_A.
Probab=20.95  E-value=82  Score=20.76  Aligned_cols=21  Identities=29%  Similarity=0.311  Sum_probs=15.7

Q ss_pred             ceeEEEEcCCCcEEEeecCCC
Q psy17586         43 TIIMYLIDPEGLFVDYYGQNK   63 (106)
Q Consensus        43 Sa~iYLmDPdGrfv~~f~~~~   63 (106)
                      .-.++|+|++|+.+..+.+..
T Consensus        93 gd~i~L~d~~G~~vd~~~y~~  113 (116)
T PF00932_consen   93 GDTITLYDPSGEVVDSVSYGD  113 (116)
T ss_dssp             EEEEEEE-TTS-EEEEEEEEE
T ss_pred             CeEEEEECCCCCEEEEEEeCC
Confidence            568999999999999887643


No 211
>PLN02300 lactoylglutathione lyase
Probab=20.85  E-value=86  Score=24.19  Aligned_cols=23  Identities=26%  Similarity=0.626  Sum_probs=18.8

Q ss_pred             eeEEEEcCCCcEEEeecCCCCHH
Q psy17586         44 IIMYLIDPEGLFVDYYGQNKKPE   66 (106)
Q Consensus        44 a~iYLmDPdGrfv~~f~~~~spe   66 (106)
                      ..+|+.||+|..+.++.....+.
T Consensus       131 ~~~~~~DPdG~~iEl~~~~~~~~  153 (286)
T PLN02300        131 VIAFVKDPDGYKFELIQRGPTPE  153 (286)
T ss_pred             EEEEEECCCCCEEEEEeCCCCCC
Confidence            35799999999999998766555


No 212
>PF00903 Glyoxalase:  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein.;  InterPro: IPR004360 Glyoxalase I (4.4.1.5 from EC) (lactoylglutathione lyase) catalyzes the first step of the glyoxal pathway. S-lactoylglutathione is then converted by glyoxalase II to lactic acid []. Glyoxalase I is an ubiquitous enzyme which binds one mole of zinc per subunit. The bacterial and yeast enzymes are monomeric while the mammalian one is homodimeric. The sequence of glyoxalase I is well conserved. The domain represented by this entry is found in glyoxalase I and in other related proteins, including fosfomycin resistance proteins FosB [], FosA [], FosX [] and dioxygenases (eg. 4-hydroxyphenylpyruvate dioxygenase).; PDB: 1CJX_A 1NPB_E 3OJT_C 3OJN_A 2IG9_B 3OJJ_B 3OJK_D 1Q0C_D 1F1X_C 3BZA_B ....
Probab=20.61  E-value=90  Score=19.44  Aligned_cols=17  Identities=24%  Similarity=0.720  Sum_probs=12.0

Q ss_pred             cceeEEEEcCCCcEEEe
Q psy17586         42 HTIIMYLIDPEGLFVDY   58 (106)
Q Consensus        42 HSa~iYLmDPdGrfv~~   58 (106)
                      +...+|+-||+|-.+.+
T Consensus       112 ~~~~~y~~Dp~G~~iE~  128 (128)
T PF00903_consen  112 SGYSFYFRDPDGNLIEF  128 (128)
T ss_dssp             CEEEEEEEETTSEEEEE
T ss_pred             CEEEEEEECCCCCEEEC
Confidence            33444899999987653


No 213
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional
Probab=20.30  E-value=2.1e+02  Score=23.79  Aligned_cols=41  Identities=10%  Similarity=0.173  Sum_probs=30.5

Q ss_pred             eeEecceeEEEEcCCCc-EEEeec------CCCCHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEGL-FVDYYG------QNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdGr-fv~~f~------~~~speeiAe~Ir~~l~~   78 (106)
                      +.+.+.-..||.|.||+ +++++.      .+.+..+|++.+++.+.+
T Consensus        28 ~~i~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~ai~~q~~~   75 (429)
T PRK06173         28 YPVERADGVMITLKDGRRLIDGMSSWWAALHGYNHPRLNAAATNQLAK   75 (429)
T ss_pred             ceEEeceeeEEEcCCCCEEEEccchHHhccCCCCCHHHHHHHHHHHHh
Confidence            46899999999999995 555542      356667888877777654


No 214
>PF14269 Arylsulfotran_2:  Arylsulfotransferase (ASST)
Probab=20.23  E-value=1.2e+02  Score=24.28  Aligned_cols=28  Identities=21%  Similarity=0.233  Sum_probs=22.0

Q ss_pred             CCceeEe--cceeEEEEc-CCCcEEEeecCC
Q psy17586         35 IFWFQVD--HTIIMYLID-PEGLFVDYYGQN   62 (106)
Q Consensus        35 ~~dY~VD--HSa~iYLmD-PdGrfv~~f~~~   62 (106)
                      .++|+|+  |...||+|| .+|+.+=.+.-.
T Consensus       154 ~G~yLiS~R~~~~i~~I~~~tG~I~W~lgG~  184 (299)
T PF14269_consen  154 DGDYLISSRNTSTIYKIDPSTGKIIWRLGGK  184 (299)
T ss_pred             CccEEEEecccCEEEEEECCCCcEEEEeCCC
Confidence            5689875  999999999 778877776433


No 215
>PRK02261 methylaspartate mutase subunit S; Provisional
Probab=20.17  E-value=1e+02  Score=21.92  Aligned_cols=23  Identities=17%  Similarity=0.358  Sum_probs=19.9

Q ss_pred             EEEeecCCCCHHHHHHHHHHHHH
Q psy17586         55 FVDYYGQNKKPEEVSNSIIVNMM   77 (106)
Q Consensus        55 fv~~f~~~~speeiAe~Ir~~l~   77 (106)
                      |-..|+++.+.++++..|++.++
T Consensus       113 ~~~vf~~~~~~~~i~~~l~~~~~  135 (137)
T PRK02261        113 FDRVFPPGTDPEEAIDDLKKDLN  135 (137)
T ss_pred             CCEEECcCCCHHHHHHHHHHHhc
Confidence            67889999999999999888764


No 216
>cd01015 CSHase N-carbamoylsarcosine amidohydrolase (CSHase) hydrolyzes N-carbamoylsarcosine to sarcosine, carbon dioxide and ammonia. CSHase is involved in one of the two alternative pathways for creatinine degradation to glycine in microorganisms.This CSHase-containing pathway degrades creatinine via N-methylhydantoin  N-carbamoylsarcosine and sarcosine to glycine. Enzymes of this pathway are used in the diagnosis for renal disfunction, for determining creatinine levels in urine and serum.
Probab=20.13  E-value=2e+02  Score=20.59  Aligned_cols=42  Identities=5%  Similarity=-0.137  Sum_probs=27.1

Q ss_pred             EEEEcCCCcEEEeecCC-CCHHHHHHHHHHHHHHHHhhhcCCc
Q psy17586         46 MYLIDPEGLFVDYYGQN-KKPEEVSNSIIVNMMKYENLKKKSW   87 (106)
Q Consensus        46 iYLmDPdGrfv~~f~~~-~speeiAe~Ir~~l~~~~~~~~~~~   87 (106)
                      +.+||.+..|..-=... ...+++++.+.++++.+++++++-.
T Consensus         2 LlvID~Q~~f~~~~~~~~~~~~~~~~ni~~l~~~ar~~~~~Vi   44 (179)
T cd01015           2 LLVIDLVEGYTQPGSYLAPGIAAALENVQRLLAAARAAGVPVI   44 (179)
T ss_pred             EEEEEeecceeCCCCccccchHHHHHHHHHHHHHHHHcCCCEE
Confidence            45677777665311111 2457888999999999888776533


No 217
>TIGR03027 pepcterm_export putative polysaccharide export protein, PEP-CTERM sytem-associated. This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by Pfam model pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system.
Probab=20.12  E-value=2e+02  Score=20.58  Aligned_cols=35  Identities=23%  Similarity=0.456  Sum_probs=25.3

Q ss_pred             EEEcCCCcEE-----EeecCCCCHHHHHHHHHHHHHHHHh
Q psy17586         47 YLIDPEGLFV-----DYYGQNKKPEEVSNSIIVNMMKYEN   81 (106)
Q Consensus        47 YLmDPdGrfv-----~~f~~~~speeiAe~Ir~~l~~~~~   81 (106)
                      |.+++||..-     ...-.+.+++++.+.|+..+.++-+
T Consensus        23 ~~V~~dG~I~lP~iG~v~v~G~T~~e~~~~I~~~l~~~~~   62 (165)
T TIGR03027        23 VPVRPDGKITTPLVGDLVASGKTPTQLARDIEEKLAKYVR   62 (165)
T ss_pred             eEECCCCeEeecccCeEEECCCCHHHHHHHHHHHHHHhcc
Confidence            5667777543     2335678999999999999976543


No 218
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after the Threonyl-tRNA Synthetase, GTPase, and SpoT proteins where it occurs.  The function of the TGS domain is unknown.
Probab=20.05  E-value=1.9e+02  Score=16.41  Aligned_cols=27  Identities=15%  Similarity=0.391  Sum_probs=20.1

Q ss_pred             EEEEcCCCcEEEeecCCCCHHHHHHHHH
Q psy17586         46 MYLIDPEGLFVDYYGQNKKPEEVSNSII   73 (106)
Q Consensus        46 iYLmDPdGrfv~~f~~~~speeiAe~Ir   73 (106)
                      +|++=|+|+.+. ++.+.+..++++.+.
T Consensus         1 ~~~~~~~g~~~~-~~~~~t~~~~~~~~~   27 (60)
T cd01668           1 IYVFTPKGEIIE-LPAGATVLDFAYAIH   27 (60)
T ss_pred             CEEECCCCCEEE-cCCCCCHHHHHHHHC
Confidence            578888898655 688888888777554


No 219
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER
Probab=20.04  E-value=1e+02  Score=19.03  Aligned_cols=34  Identities=9%  Similarity=0.031  Sum_probs=26.3

Q ss_pred             ceeEecceeEEEEcCCCcEEEeecCCCCHHHHHH
Q psy17586         37 WFQVDHTIIMYLIDPEGLFVDYYGQNKKPEEVSN   70 (106)
Q Consensus        37 dY~VDHSa~iYLmDPdGrfv~~f~~~~speeiAe   70 (106)
                      .|.|.....++++++.|+....+.-..+.+++.+
T Consensus        70 ~~~i~~~P~~~~~~~~~~~~~~~~g~~~~~~l~~  103 (105)
T cd02998          70 KYGVSGFPTLKFFPKGSTEPVKYEGGRDLEDLVK  103 (105)
T ss_pred             hCCCCCcCEEEEEeCCCCCccccCCccCHHHHHh
Confidence            5889999999999988876767766667766654


No 220
>PRK09792 4-aminobutyrate transaminase; Provisional
Probab=20.01  E-value=2.3e+02  Score=23.30  Aligned_cols=41  Identities=15%  Similarity=0.288  Sum_probs=30.6

Q ss_pred             eeEecceeEEEEcCCCc-EEEee------cCCCCHHHHHHHHHHHHHH
Q psy17586         38 FQVDHTIIMYLIDPEGL-FVDYY------GQNKKPEEVSNSIIVNMMK   78 (106)
Q Consensus        38 Y~VDHSa~iYLmDPdGr-fv~~f------~~~~speeiAe~Ir~~l~~   78 (106)
                      +.|.+.-..||.|.||+ +++++      ..+.+..++++.|++.+.+
T Consensus        24 ~~~~~a~G~~l~D~dG~~ylD~~~g~~~~~lGh~~p~v~~ai~~ql~~   71 (421)
T PRK09792         24 FFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQ   71 (421)
T ss_pred             eeEEeccccEEEeCCCCEEEEccCchhhhcCCCCCHHHHHHHHHHHHh
Confidence            56788888899999995 55553      3367778888888887764


Done!